FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 14022

FusionGeneSummary for FSTL4_SLIT3

check button Fusion gene summary
Fusion gene informationFusion gene name: FSTL4_SLIT3
Fusion gene ID: 14022
HgeneTgene
Gene symbol

FSTL4

SLIT3

Gene ID

23105

6586

Gene namefollistatin like 4slit guidance ligand 3
Synonyms-MEGF5|SLIL2|SLIT1|Slit-3|slit2
Cytomap

5q31.1

5q34-q35.1

Type of geneprotein-codingprotein-coding
Descriptionfollistatin-related protein 4follistatin-like protein 4slit homolog 3 proteinmultiple EGF-like domains protein 5multiple epidermal growth factor-like domains protein 5slit homolog 3
Modification date2018051920180522
UniProtAcc

Q6MZW2

O75094

Ensembl transtripts involved in fusion geneENST00000265342, ENST00000507112, 
ENST00000519560, ENST00000332966, 
ENST00000404867, ENST00000521130, 
Fusion gene scores* DoF score3 X 3 X 2=184 X 4 X 4=64
# samples 34
** MAII scorelog2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(4/64*10)=-0.678071905112638
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: FSTL4 [Title/Abstract] AND SLIT3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneSLIT3

GO:0007411

axon guidance

11748139

TgeneSLIT3

GO:0021834

chemorepulsion involved in embryonic olfactory bulb interneuron precursor migration

11748139

TgeneSLIT3

GO:0048846

axon extension involved in axon guidance

16840550

TgeneSLIT3

GO:0050919

negative chemotaxis

11748139


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-AR-A24V-01AFSTL4chr5

132537625

-SLIT3chr5

168114121

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000265342ENST00000519560FSTL4chr5

132537625

-SLIT3chr5

168114121

-
In-frameENST00000265342ENST00000332966FSTL4chr5

132537625

-SLIT3chr5

168114121

-
In-frameENST00000265342ENST00000404867FSTL4chr5

132537625

-SLIT3chr5

168114121

-
5CDS-intronENST00000265342ENST00000521130FSTL4chr5

132537625

-SLIT3chr5

168114121

-
intron-3CDSENST00000507112ENST00000519560FSTL4chr5

132537625

-SLIT3chr5

168114121

-
intron-3CDSENST00000507112ENST00000332966FSTL4chr5

132537625

-SLIT3chr5

168114121

-
intron-3CDSENST00000507112ENST00000404867FSTL4chr5

132537625

-SLIT3chr5

168114121

-
intron-intronENST00000507112ENST00000521130FSTL4chr5

132537625

-SLIT3chr5

168114121

-

Top

FusionProtFeatures for FSTL4_SLIT3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
FSTL4

Q6MZW2

SLIT3

O75094

May act as molecular guidance cue in cellular migration,and function may be mediated by interaction with roundabouthomolog receptors.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneFSTL4chr5:132537625chr5:168114121ENST00000265342-1516187_198608843Calcium bindingOntology_term=ECO:0000255
HgeneFSTL4chr5:132537625chr5:168114121ENST00000265342-1516174_209608843DomainEF-hand
HgeneFSTL4chr5:132537625chr5:168114121ENST00000265342-1516251_338608843DomainNote=Ig-like 1
HgeneFSTL4chr5:132537625chr5:168114121ENST00000265342-1516341_426608843DomainNote=Ig-like 2
HgeneFSTL4chr5:132537625chr5:168114121ENST00000265342-151681_135608843DomainKazal-like
TgeneSLIT3chr5:132537625chr5:168114121ENST00000404867-28361074_111010581473DomainEGF-like 5
TgeneSLIT3chr5:132537625chr5:168114121ENST00000404867-28361119_115510581473DomainEGF-like 6
TgeneSLIT3chr5:132537625chr5:168114121ENST00000404867-28361158_133210581473DomainLaminin G-like
TgeneSLIT3chr5:132537625chr5:168114121ENST00000404867-28361340_136510581473DomainEGF-like 7
TgeneSLIT3chr5:132537625chr5:168114121ENST00000404867-28361368_140310581473DomainEGF-like 8
TgeneSLIT3chr5:132537625chr5:168114121ENST00000404867-28361408_144410581473DomainEGF-like 9
TgeneSLIT3chr5:132537625chr5:168114121ENST00000404867-28361449_152310581473DomainCTCK
TgeneSLIT3chr5:132537625chr5:168114121ENST00000519560-28361074_111010581524DomainEGF-like 5
TgeneSLIT3chr5:132537625chr5:168114121ENST00000519560-28361119_115510581524DomainEGF-like 6
TgeneSLIT3chr5:132537625chr5:168114121ENST00000519560-28361158_133210581524DomainLaminin G-like
TgeneSLIT3chr5:132537625chr5:168114121ENST00000519560-28361340_136510581524DomainEGF-like 7
TgeneSLIT3chr5:132537625chr5:168114121ENST00000519560-28361368_140310581524DomainEGF-like 8
TgeneSLIT3chr5:132537625chr5:168114121ENST00000519560-28361408_144410581524DomainEGF-like 9
TgeneSLIT3chr5:132537625chr5:168114121ENST00000519560-28361449_152310581524DomainCTCK

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneSLIT3chr5:132537625chr5:168114121ENST00000404867-28361034_107210581473DomainEGF-like 4
TgeneSLIT3chr5:132537625chr5:168114121ENST00000404867-2836215_26510581473DomainNote=LRRCT 1
TgeneSLIT3chr5:132537625chr5:168114121ENST00000404867-2836271_30710581473DomainNote=LRRNT 2
TgeneSLIT3chr5:132537625chr5:168114121ENST00000404867-283634_6110581473DomainNote=LRRNT
TgeneSLIT3chr5:132537625chr5:168114121ENST00000404867-2836437_48710581473DomainNote=LRRCT 2
TgeneSLIT3chr5:132537625chr5:168114121ENST00000404867-2836496_53210581473DomainNote=LRRNT 3
TgeneSLIT3chr5:132537625chr5:168114121ENST00000404867-2836663_71310581473DomainNote=LRRCT 3
TgeneSLIT3chr5:132537625chr5:168114121ENST00000404867-2836716_75210581473DomainNote=LRRNT 4
TgeneSLIT3chr5:132537625chr5:168114121ENST00000404867-2836857_90710581473DomainNote=LRRCT 4
TgeneSLIT3chr5:132537625chr5:168114121ENST00000404867-2836918_95310581473DomainEGF-like 1
TgeneSLIT3chr5:132537625chr5:168114121ENST00000404867-2836955_99410581473DomainEGF-like 2
TgeneSLIT3chr5:132537625chr5:168114121ENST00000404867-2836996_103210581473DomainEGF-like 3
TgeneSLIT3chr5:132537625chr5:168114121ENST00000519560-28361034_107210581524DomainEGF-like 4
TgeneSLIT3chr5:132537625chr5:168114121ENST00000519560-2836215_26510581524DomainNote=LRRCT 1
TgeneSLIT3chr5:132537625chr5:168114121ENST00000519560-2836271_30710581524DomainNote=LRRNT 2
TgeneSLIT3chr5:132537625chr5:168114121ENST00000519560-283634_6110581524DomainNote=LRRNT
TgeneSLIT3chr5:132537625chr5:168114121ENST00000519560-2836437_48710581524DomainNote=LRRCT 2
TgeneSLIT3chr5:132537625chr5:168114121ENST00000519560-2836496_53210581524DomainNote=LRRNT 3
TgeneSLIT3chr5:132537625chr5:168114121ENST00000519560-2836663_71310581524DomainNote=LRRCT 3
TgeneSLIT3chr5:132537625chr5:168114121ENST00000519560-2836716_75210581524DomainNote=LRRNT 4
TgeneSLIT3chr5:132537625chr5:168114121ENST00000519560-2836857_90710581524DomainNote=LRRCT 4
TgeneSLIT3chr5:132537625chr5:168114121ENST00000519560-2836918_95310581524DomainEGF-like 1
TgeneSLIT3chr5:132537625chr5:168114121ENST00000519560-2836955_99410581524DomainEGF-like 2
TgeneSLIT3chr5:132537625chr5:168114121ENST00000519560-2836996_103210581524DomainEGF-like 3
TgeneSLIT3chr5:132537625chr5:168114121ENST00000404867-2836110_13110581473RepeatNote=LRR 3
TgeneSLIT3chr5:132537625chr5:168114121ENST00000404867-2836134_15510581473RepeatNote=LRR 4
TgeneSLIT3chr5:132537625chr5:168114121ENST00000404867-2836158_17910581473RepeatNote=LRR 5
TgeneSLIT3chr5:132537625chr5:168114121ENST00000404867-2836182_20310581473RepeatNote=LRR 6
TgeneSLIT3chr5:132537625chr5:168114121ENST00000404867-2836308_32910581473RepeatNote=LRR 7
TgeneSLIT3chr5:132537625chr5:168114121ENST00000404867-2836332_35310581473RepeatNote=LRR 8
TgeneSLIT3chr5:132537625chr5:168114121ENST00000404867-2836356_37710581473RepeatNote=LRR 9
TgeneSLIT3chr5:132537625chr5:168114121ENST00000404867-2836380_40110581473RepeatNote=LRR 10
TgeneSLIT3chr5:132537625chr5:168114121ENST00000404867-2836404_42510581473RepeatNote=LRR 11
TgeneSLIT3chr5:132537625chr5:168114121ENST00000404867-2836533_55410581473RepeatNote=LRR 12
TgeneSLIT3chr5:132537625chr5:168114121ENST00000404867-2836558_57910581473RepeatNote=LRR 13
TgeneSLIT3chr5:132537625chr5:168114121ENST00000404867-2836582_60310581473RepeatNote=LRR 14
TgeneSLIT3chr5:132537625chr5:168114121ENST00000404867-2836606_62710581473RepeatNote=LRR 15
TgeneSLIT3chr5:132537625chr5:168114121ENST00000404867-283662_8310581473RepeatNote=LRR 1
TgeneSLIT3chr5:132537625chr5:168114121ENST00000404867-2836630_65110581473RepeatNote=LRR 16
TgeneSLIT3chr5:132537625chr5:168114121ENST00000404867-2836753_77510581473RepeatNote=LRR 17
TgeneSLIT3chr5:132537625chr5:168114121ENST00000404867-2836776_79710581473RepeatNote=LRR 18
TgeneSLIT3chr5:132537625chr5:168114121ENST00000404867-2836800_82110581473RepeatNote=LRR 19
TgeneSLIT3chr5:132537625chr5:168114121ENST00000404867-2836824_84510581473RepeatNote=LRR 20
TgeneSLIT3chr5:132537625chr5:168114121ENST00000404867-283686_10710581473RepeatNote=LRR 2
TgeneSLIT3chr5:132537625chr5:168114121ENST00000519560-2836110_13110581524RepeatNote=LRR 3
TgeneSLIT3chr5:132537625chr5:168114121ENST00000519560-2836134_15510581524RepeatNote=LRR 4
TgeneSLIT3chr5:132537625chr5:168114121ENST00000519560-2836158_17910581524RepeatNote=LRR 5
TgeneSLIT3chr5:132537625chr5:168114121ENST00000519560-2836182_20310581524RepeatNote=LRR 6
TgeneSLIT3chr5:132537625chr5:168114121ENST00000519560-2836308_32910581524RepeatNote=LRR 7
TgeneSLIT3chr5:132537625chr5:168114121ENST00000519560-2836332_35310581524RepeatNote=LRR 8
TgeneSLIT3chr5:132537625chr5:168114121ENST00000519560-2836356_37710581524RepeatNote=LRR 9
TgeneSLIT3chr5:132537625chr5:168114121ENST00000519560-2836380_40110581524RepeatNote=LRR 10
TgeneSLIT3chr5:132537625chr5:168114121ENST00000519560-2836404_42510581524RepeatNote=LRR 11
TgeneSLIT3chr5:132537625chr5:168114121ENST00000519560-2836533_55410581524RepeatNote=LRR 12
TgeneSLIT3chr5:132537625chr5:168114121ENST00000519560-2836558_57910581524RepeatNote=LRR 13
TgeneSLIT3chr5:132537625chr5:168114121ENST00000519560-2836582_60310581524RepeatNote=LRR 14
TgeneSLIT3chr5:132537625chr5:168114121ENST00000519560-2836606_62710581524RepeatNote=LRR 15
TgeneSLIT3chr5:132537625chr5:168114121ENST00000519560-283662_8310581524RepeatNote=LRR 1
TgeneSLIT3chr5:132537625chr5:168114121ENST00000519560-2836630_65110581524RepeatNote=LRR 16
TgeneSLIT3chr5:132537625chr5:168114121ENST00000519560-2836753_77510581524RepeatNote=LRR 17
TgeneSLIT3chr5:132537625chr5:168114121ENST00000519560-2836776_79710581524RepeatNote=LRR 18
TgeneSLIT3chr5:132537625chr5:168114121ENST00000519560-2836800_82110581524RepeatNote=LRR 19
TgeneSLIT3chr5:132537625chr5:168114121ENST00000519560-2836824_84510581524RepeatNote=LRR 20
TgeneSLIT3chr5:132537625chr5:168114121ENST00000519560-283686_10710581524RepeatNote=LRR 2


Top

FusionGeneSequence for FSTL4_SLIT3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_FSTL4_ENST00000265342_chr5_132537625_-_SLIT3_ENST00000519560_chr5_168114121_-_465aa
LRVCPWLQREAL_DRQ__LCGPQVPPRGPVRGHNQWLHMHLPPGLQWTLL_TPPTHGPTADQPMRPVRVPERGPVHRGAAGAHLPLPTRL
RRPQMREAHHCQLRGQRLLRGTGLRQGPTPGQHLPAGGH_QGQRHPSLQRRQ_PPGTGAVPGPRAAGL_QPEFPSNHSVQCGDSE_WAVS
QCGAGDAKPDPEPSSGQRNSKEPGEAPEAASSGHQQPPLPWRHPHLHRPLCLAPGHGPASRRLPRMHP_GAHQQRAAGLQGPPTTVPGGV
TRLQVLHRVQARPVPLRGEGQRGVRVPPRLDRPTLRSGGPGPLPRPQMPPWKMCGNWDLIHVQVCRGLWRGLV_QQE_LCQCLLSLQVSP
WAVPHLRPRGALLPVPARL_RRALPTRESVPGTSSPRGDPPPERLCIMCHSLQGAHHGMSWGLWAPVLPAHPQQAAEIRLPVHGRLLVCR

>In-frame_FSTL4_ENST00000265342_chr5_132537625_-_SLIT3_ENST00000332966_chr5_168114121_-_465aa
LRVCPWLQREAL_DRQ__LCGPQVPPRGPVRGHNQWLHMHLPPGLQWTLL_TPPTHGPTADQPMRPVRVPERGPVHRGAAGAHLPLPTRL
RRPQMREAHHCQLRGQRLLRGTGLRQGPTPGQHLPAGGH_QGQRHPSLQRRQ_PPGTGAVPGPRAAGL_QPEFPSNHSVQCGDSE_WAVS
QCGAGDAKPDPEPSSGQRNSKEPGEAPEAASSGHQQPPLPWRHPHLHRPLCLAPGHGPASRRLPRMHP_GAHQQRAAGLQGPPTTVPGGV
TRLQVLHRVQARPVPLRGEGQRGVRVPPRLDRPTLRSGGPGPLPRPQMPPWKMCGNWDLIHVQVCRGLWRGLV_QQE_LCQCLLSLQVSP
WAVPHLRPRGALLPVPARL_RRALPTRESVPGTSSPRGDPPPERLCIMCHSLQGAHHGMSWGLWAPVLPAHPQQAAEIRLPVHGRLLVCR

>In-frame_FSTL4_ENST00000265342_chr5_132537625_-_SLIT3_ENST00000404867_chr5_168114121_-_414aa
LRVCPWLQREAL_DRQ__LCGPQVPPRGPVRGHNQWLHMHLPPGLQWTLL_TPPTHGPTADQPMRPVRVPERGPVHRGAAGAHLPLPTRL
RRPQMREAHHCQLRGQRLLRGTGLRQGPTPGQHLPAGGH_QGQRHPSLQRRQ_PPGTGAVPGPRAAGL_QPEFPSNHSVQCGDSE_WAVS
QCGAGDAKPDPEPSSGQRNSKEPGEAPEAASSGHQQPPLPWRHPHLHRPLCLAPGHGPASRRLPRMHP_GAHQQRAAGLQGPPTTVPGGV
TRLQVLHRVQARPVPLRGEGQRGVRVPPRLDRPTLRSGGPGPLPRPQMPPWKMCGNWDLIHVQVCRGLWRGLV_QQE_LCQCLLSLQVSP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_FSTL4_ENST00000265342_chr5_132537625_-_SLIT3_ENST00000519560_chr5_168114121_-_1396nt
CTGCGAGTGTGTCCCTGGCTACAGCGGGAAGCTCTGTGAGACAGACAATGATGACTGTGTGGCCCACAAGTGCCGCCACGGGGCCCAGTG
CGTGGACACAATCAATGGCTACACATGCACCTGCCCCCAGGGCTTCAGTGGACCCTTCTGTGAACACCCCCCACCCATGGTCCTACTGCA
GACCAGCCCATGCGACCAGTACGAGTGCCAGAACGGGGCCCAGTGCATCGTGGTGCAGCAGGAGCCCACCTGCCGCTGCCCACCAGGCTT
CGCCGGCCCCAGATGCGAGAAGCTCATCACTGTCAACTTCGTGGGCAAAGACTCCTACGTGGAACTGGCCTCCGCCAAGGTCCGACCCCA
GGCCAACATCTCCCTGCAGGTGGCCACTGACAAGGACAACGGCATCCTTCTCTACAAAGGAGACAATGACCCCCTGGCACTGGAGCTGTA
CCAGGGCCACGTGCGGCTGGTCTATGACAGCCTGAGTTCCCCTCCAACCACAGTGTACAGTGTGGAGACAGTGAATGATGGGCAGTTTCA
CAGTGTGGAGCTGGTGACGCTAAACCAGACCCTGAACCTAGTAGTGGACAAAGGAACTCCAAAGAGCCTGGGGAAGCTCCAGAAGCAGCC
AGCAGTGGGCATCAACAGCCCCCTCTACCTTGGAGGCATCCCCACCTCCACCGGCCTCTCTGCCTTGCGCCAGGGCACGGACCGGCCTCT
AGGCGGCTTCCACGGATGCATCCATGAGGTGCGCATCAACAACGAGCTGCAGGACTTCAAGGCCCTCCCACCACAGTCCCTGGGGGTGTC
ACCAGGCTGCAAGTCCTGCACCGTGTGCAAGCACGGCCTGTGCCGCTCCGTGGAGAAGGACAGCGTGGTGTGCGAGTGCCGCCCAGGCTG
GACCGGCCCACTCTGCGATCAGGAGGCCCGGGACCCCTGCCTCGGCCACAGATGCCACCATGGAAAATGTGTGGCAACTGGGACCTCATA
CATGTGCAAGTGTGCCGAGGGCTATGGAGGGGACTTGTGTGACAACAAGAATGACTCTGCCAATGCCTGCTCAGCCTTCAAGTGTCACCA
TGGGCAGTGCCACATCTCAGACCAAGGGGAGCCCTACTGCCTGTGCCAGCCCGGCTTTAGCGGCGAGCACTGCCAACAAGAGAATCCGTG
CCTGGGACAAGTAGTCCGAGAGGTGATCCGCCGCCAGAAAGGTTATGCATCATGTGCCACAGCCTCCAAGGTGCCCATCATGGAATGTCG
TGGGGGCTGTGGGCCCCAGTGCTGCCAGCCCACCCGCAGCAAGCGGCGGAAATACGTCTTCCAGTGCACGGACGGCTCCTCGTTTGTAGA

>In-frame_FSTL4_ENST00000265342_chr5_132537625_-_SLIT3_ENST00000332966_chr5_168114121_-_1396nt
CTGCGAGTGTGTCCCTGGCTACAGCGGGAAGCTCTGTGAGACAGACAATGATGACTGTGTGGCCCACAAGTGCCGCCACGGGGCCCAGTG
CGTGGACACAATCAATGGCTACACATGCACCTGCCCCCAGGGCTTCAGTGGACCCTTCTGTGAACACCCCCCACCCATGGTCCTACTGCA
GACCAGCCCATGCGACCAGTACGAGTGCCAGAACGGGGCCCAGTGCATCGTGGTGCAGCAGGAGCCCACCTGCCGCTGCCCACCAGGCTT
CGCCGGCCCCAGATGCGAGAAGCTCATCACTGTCAACTTCGTGGGCAAAGACTCCTACGTGGAACTGGCCTCCGCCAAGGTCCGACCCCA
GGCCAACATCTCCCTGCAGGTGGCCACTGACAAGGACAACGGCATCCTTCTCTACAAAGGAGACAATGACCCCCTGGCACTGGAGCTGTA
CCAGGGCCACGTGCGGCTGGTCTATGACAGCCTGAGTTCCCCTCCAACCACAGTGTACAGTGTGGAGACAGTGAATGATGGGCAGTTTCA
CAGTGTGGAGCTGGTGACGCTAAACCAGACCCTGAACCTAGTAGTGGACAAAGGAACTCCAAAGAGCCTGGGGAAGCTCCAGAAGCAGCC
AGCAGTGGGCATCAACAGCCCCCTCTACCTTGGAGGCATCCCCACCTCCACCGGCCTCTCTGCCTTGCGCCAGGGCACGGACCGGCCTCT
AGGCGGCTTCCACGGATGCATCCATGAGGTGCGCATCAACAACGAGCTGCAGGACTTCAAGGCCCTCCCACCACAGTCCCTGGGGGTGTC
ACCAGGCTGCAAGTCCTGCACCGTGTGCAAGCACGGCCTGTGCCGCTCCGTGGAGAAGGACAGCGTGGTGTGCGAGTGCCGCCCAGGCTG
GACCGGCCCACTCTGCGATCAGGAGGCCCGGGACCCCTGCCTCGGCCACAGATGCCACCATGGAAAATGTGTGGCAACTGGGACCTCATA
CATGTGCAAGTGTGCCGAGGGCTATGGAGGGGACTTGTGTGACAACAAGAATGACTCTGCCAATGCCTGCTCAGCCTTCAAGTGTCACCA
TGGGCAGTGCCACATCTCAGACCAAGGGGAGCCCTACTGCCTGTGCCAGCCCGGCTTTAGCGGCGAGCACTGCCAACAAGAGAATCCGTG
CCTGGGACAAGTAGTCCGAGAGGTGATCCGCCGCCAGAAAGGTTATGCATCATGTGCCACAGCCTCCAAGGTGCCCATCATGGAATGTCG
TGGGGGCTGTGGGCCCCAGTGCTGCCAGCCCACCCGCAGCAAGCGGCGGAAATACGTCTTCCAGTGCACGGACGGCTCCTCGTTTGTAGA

>In-frame_FSTL4_ENST00000265342_chr5_132537625_-_SLIT3_ENST00000404867_chr5_168114121_-_1243nt
CTGCGAGTGTGTCCCTGGCTACAGCGGGAAGCTCTGTGAGACAGACAATGATGACTGTGTGGCCCACAAGTGCCGCCACGGGGCCCAGTG
CGTGGACACAATCAATGGCTACACATGCACCTGCCCCCAGGGCTTCAGTGGACCCTTCTGTGAACACCCCCCACCCATGGTCCTACTGCA
GACCAGCCCATGCGACCAGTACGAGTGCCAGAACGGGGCCCAGTGCATCGTGGTGCAGCAGGAGCCCACCTGCCGCTGCCCACCAGGCTT
CGCCGGCCCCAGATGCGAGAAGCTCATCACTGTCAACTTCGTGGGCAAAGACTCCTACGTGGAACTGGCCTCCGCCAAGGTCCGACCCCA
GGCCAACATCTCCCTGCAGGTGGCCACTGACAAGGACAACGGCATCCTTCTCTACAAAGGAGACAATGACCCCCTGGCACTGGAGCTGTA
CCAGGGCCACGTGCGGCTGGTCTATGACAGCCTGAGTTCCCCTCCAACCACAGTGTACAGTGTGGAGACAGTGAATGATGGGCAGTTTCA
CAGTGTGGAGCTGGTGACGCTAAACCAGACCCTGAACCTAGTAGTGGACAAAGGAACTCCAAAGAGCCTGGGGAAGCTCCAGAAGCAGCC
AGCAGTGGGCATCAACAGCCCCCTCTACCTTGGAGGCATCCCCACCTCCACCGGCCTCTCTGCCTTGCGCCAGGGCACGGACCGGCCTCT
AGGCGGCTTCCACGGATGCATCCATGAGGTGCGCATCAACAACGAGCTGCAGGACTTCAAGGCCCTCCCACCACAGTCCCTGGGGGTGTC
ACCAGGCTGCAAGTCCTGCACCGTGTGCAAGCACGGCCTGTGCCGCTCCGTGGAGAAGGACAGCGTGGTGTGCGAGTGCCGCCCAGGCTG
GACCGGCCCACTCTGCGATCAGGAGGCCCGGGACCCCTGCCTCGGCCACAGATGCCACCATGGAAAATGTGTGGCAACTGGGACCTCATA
CATGTGCAAGTGTGCCGAGGGCTATGGAGGGGACTTGTGTGACAACAAGAATGACTCTGCCAATGCCTGCTCAGCCTTCAAGTGTCACCA
TGGGCAGTGCCACATCTCAGACCAAGGGGAGCCCTACTGCCTGTGCCAGCCCGGCTTTAGCGGCGAGCACTGCCAACAAGTCTTCAGAGC


* Fusion transcript sequences (Full-length transcript).
>In-frame_FSTL4_ENST00000265342_chr5_132537625_-_SLIT3_ENST00000519560_chr5_168114121_-_8186nt
TCACGGGCTCCGGTCCCGGCGGCAGAAATAGGGCAGCCGCGGCGGCGGTGGCACAGCAGCGGGCAGCGGCGGCTCAGGGAGCTGGAGCCT
CAACAGCCTCCAGCGAGCCCGGGACCCGCCGACAGCCCGAGAAACCAGCCGAAGGACGCGGGGCGGGGTCGCCGCCGCCGCCACGGGGTG
CTCCCTCCCTCCCGCCCAAGTCCGGCCACCTGGTCTTCCCCTCGGCCCCGGCCGTCTCAGACTCATCAAAATGAAACCAGGAGGCTTTTG
GCTGCATCTCACACTGCTCGGAGCCTCCCTGCCGGCTGCGCTGGGATGGATGGACCCAGGAACCAGCAGAGGCCCGGATGTGGGTGTGGG
GGAGTCACAGGCAGAGGAGCCCAGAAGCTTTGAAGTCACAAGAAGAGAAGGGCTTTCCAGCCACAACGAGCTGCTGGCCTCCTGCGGGAA
GAAGTTCTGCAGCCGAGGGAGCCGGTGCGTGCTCAGCAGGAAGACAGGGGAGCCCGAATGCCAGTGCCTGGAGGCATGCAGGCCCAGCTA
CGTGCCTGTGTGCGGCTCTGATGGGAGGTTTTATGAAAACCACTGTAAGCTCCACCGTGCTGCTTGCCTCCTGGGAAAGAGGATCACCGT
CATCCACAGCAAGGACTGTTTCCTCAAAGGTGACACGTGCACCATGGCCGGCTACGCCCGCTTGAAGAATGTCCTTCTGGCACTCCAGAC
CCGTCTGCAGCCACTCCAAGAAGGAGACAGCAGACAAGACCCTGCCTCCCAGAAGCGCCTCCTGGTGGAATCTCTGTTCAGGGACTTAGA
TGCAGATGGCAATGGCCACCTCAGCAGCTCCGAACTGGCTCAGCATGTGCTGAAGAAGCAGGACCTGGATGAAGACTTACTTGGTTGCTC
ACCAGGTGACCTCCTCCGATTTGACGATTACAACAGTGACAGCTCCCTGACCCTCCGCGAGTTCTACATGGCCTTCCAAGTGGTTCAGCT
CAGCCTCGCCCCCGAGGACAGGGTCAGTGTGACCACAGTGACCGTGGGGCTGAGCACAGTGCTGACCTGCGCCGTCCATGGAGACCTGAG
GCCACCAATCATCTGGAAGCGCAACGGGCTCACCCTGAACTTCCTGGACTTGGAAGACATCAATGACTTTGGAGAGGATGATTCCCTGTA
CATCACCAAGGTGACCACCATCCACATGGGCAATTACACCTGCCATGCTTCCGGCCACGAGCAGCTGTTCCAGACCCACGTCCTGCAGGT
GAATGTGCCGCCAGTCATCCGTGTCTATCCAGAGAGCCAGGCACAGGAGCCTGGAGTGGCAGCCAGCCTAAGATGCCATGCTGAGGGCAT
TCCCATGCCCAGAATCACTTGGCTGAAAAACGGCGTGGATGTCTCAACTCAGATGTCCAAACAGCTCTCCCTTTTAGCCAATGGGAGCGA
ACTCCACATCAGCAGTGTTCGGTATGAAGACACAGGGGCATACACCTGCATTGCCAAAAATGAAGTGGGTGTGGATGAAGATATCTCCTC
GCTCTTCATTGAAGACTCAGCTAGAAAGACCCTTGCAAACATCCTGTGGCGAGAGGAAGGCCTCAGCGTGGGAAACATGTTCTATGTCTT
CTCCGACGACGGTATCATCGTCATCCATCCTGTGGACTGTGAGATCCAGAGGCACCTCAAACCCACGGAAAAGATTTTCATGAGCTATGA
AGAAATCTGTCCTCAAAGAGAAAAAAATGCAACCCAGCCCTGCCAGTGGGTATCTGCAGTCAATGTCCGGAACCGGTACATCTATGTGGC
CCAGCCAGCACTGAGCAGAGTCCTTGTGGTCGACATCCAAGCCCAGAAAGTCCTACAGTCCATAGGTGTGGACCCTCTGCCGGCTAAGCT
GTCCTATGACAAGTCACATGACCAAGTGTGGGTCCTGAGCTGGGGGGACGTGCACAAGTCCCGACCAAGTCTCCAGGTGATCACAGAAGC
CAGCACCGGCCAGAGCCAGCACCTCATCCGCACACCCTTTGCAGGAGTGGATGATTTCTTCATTCCCCCAACAAACCTCATCATCAACCA
CATCAGCTGCGAGTGTGTCCCTGGCTACAGCGGGAAGCTCTGTGAGACAGACAATGATGACTGTGTGGCCCACAAGTGCCGCCACGGGGC
CCAGTGCGTGGACACAATCAATGGCTACACATGCACCTGCCCCCAGGGCTTCAGTGGACCCTTCTGTGAACACCCCCCACCCATGGTCCT
ACTGCAGACCAGCCCATGCGACCAGTACGAGTGCCAGAACGGGGCCCAGTGCATCGTGGTGCAGCAGGAGCCCACCTGCCGCTGCCCACC
AGGCTTCGCCGGCCCCAGATGCGAGAAGCTCATCACTGTCAACTTCGTGGGCAAAGACTCCTACGTGGAACTGGCCTCCGCCAAGGTCCG
ACCCCAGGCCAACATCTCCCTGCAGGTGGCCACTGACAAGGACAACGGCATCCTTCTCTACAAAGGAGACAATGACCCCCTGGCACTGGA
GCTGTACCAGGGCCACGTGCGGCTGGTCTATGACAGCCTGAGTTCCCCTCCAACCACAGTGTACAGTGTGGAGACAGTGAATGATGGGCA
GTTTCACAGTGTGGAGCTGGTGACGCTAAACCAGACCCTGAACCTAGTAGTGGACAAAGGAACTCCAAAGAGCCTGGGGAAGCTCCAGAA
GCAGCCAGCAGTGGGCATCAACAGCCCCCTCTACCTTGGAGGCATCCCCACCTCCACCGGCCTCTCTGCCTTGCGCCAGGGCACGGACCG
GCCTCTAGGCGGCTTCCACGGATGCATCCATGAGGTGCGCATCAACAACGAGCTGCAGGACTTCAAGGCCCTCCCACCACAGTCCCTGGG
GGTGTCACCAGGCTGCAAGTCCTGCACCGTGTGCAAGCACGGCCTGTGCCGCTCCGTGGAGAAGGACAGCGTGGTGTGCGAGTGCCGCCC
AGGCTGGACCGGCCCACTCTGCGATCAGGAGGCCCGGGACCCCTGCCTCGGCCACAGATGCCACCATGGAAAATGTGTGGCAACTGGGAC
CTCATACATGTGCAAGTGTGCCGAGGGCTATGGAGGGGACTTGTGTGACAACAAGAATGACTCTGCCAATGCCTGCTCAGCCTTCAAGTG
TCACCATGGGCAGTGCCACATCTCAGACCAAGGGGAGCCCTACTGCCTGTGCCAGCCCGGCTTTAGCGGCGAGCACTGCCAACAAGAGAA
TCCGTGCCTGGGACAAGTAGTCCGAGAGGTGATCCGCCGCCAGAAAGGTTATGCATCATGTGCCACAGCCTCCAAGGTGCCCATCATGGA
ATGTCGTGGGGGCTGTGGGCCCCAGTGCTGCCAGCCCACCCGCAGCAAGCGGCGGAAATACGTCTTCCAGTGCACGGACGGCTCCTCGTT
TGTAGAAGAGGTGGAGAGACACTTAGAGTGCGGCTGCCTCGCGTGTTCCTAAGCCCCTGCCCGCCTGCCTGCCACCTCTCGGACTCCAGC
TTGATGGAGTTGGGACAGCCATGTGGGACCCCCTGGTGATTCAGCATGAAGGAAATGAAGCTGGAGAGGAAGGTAAAGAAGAAGAGAATA
TTAAGTATATTGTAAAATAAACAAAAAATAGAACTTATTTTTATTATGGAAAGTGACTATTTTCATCTTTTATTATATAAATATATTACA
CCATCTGCGTATATGTACCATATAGTGAGTTATTTTTACCAAGTTTTGTGTTGTGTATTTGTTGTGTTTTTAAAAATAGCTGTTTAAAAA
TTTAAGAAAAAAATAGACTAATAAAAATGCTTTAAAACAAAAGGATAAGAATAAAGAATGATAGCCTGTCTGAGGAAGGAGGAAGATGTT
TTCATGTTTATGAAACGGTATTATGTCGGCAGTAGACCAAGAGCTGCTCATTGAGATCAGAAAAAGGAATAAGAGGAAGAGAGAGAAGGA
AAAGACCTTTGTTTCTTGTTTTTTAACTCCCTTTTATTTTTCCTCCCCTAAAATTACCCAGCTTTTCGGAGTCCTGGATGTCAGTGCCCA
AAATGCCCAGTTCTTCCAGGAAAAGCTGCTGAGCCCTGGCCTTCTCAGTCTCACTGCCACTCAAAAATATTGCTGTCCCTGTCTGTCCCA
GACCCCCCTTCAGGGTATCTGAACCCACTGGGGGACCCCTCTTCTCCTTCCTGGGTGGCCCTGGCTTCCGTATCTGAACCCACTGGGGGA
CCCCTCTTCTCCTTCCTGGCTGGCCCTGGCTTCCAATCGAGGACTGACTATTGAAGTCTGCTACAGGTGTCATTTGGAACTGTCTTACCA
AATTTTAAAACAGCTGCTATTTTTCCTGCTCCTCCCCAGGAGAGGGGTCTTCCTAGAGGAGGCGAGGGAAGAGAATATCATGGTGTCTCC
TCAGGACCCATGCACTGGCCCTCTCTCCTCCTTCCAGGTAATTTTTCATTGGAATGTATCCCAGTAGAGAAGGTAGTCAGCCCTTCTTGG
AAGCGGAAGGCTGGGAGCCAAGTCAAGTCTGCCCACAGCGCTAGATGTCCAACTCTGGAAGGTTCTTGGAGGCTCTTGTTGTAAGACAGG
CCTCTGCCACCTGATCCTCCAGGTCACCAGCATGACGATAGAGACTCCTTGCCCATCTGTGACACTTTCCAATGCATATCCAAACTTTAC
CTTATTTTATCTATGCAACCCCTGCCTCCCTGGGAAGGATAAGGGAGTAGAGCTGGGTTCACTAAGAAGGAAGTTTAGGCCCTCACAGGC
TCTGGAACTTGCCTTAAGCCACACACCAGATAAGTGGAGGAGCCAGACCAGAAGTCCAGACCCAAAGCTTGAGATTCTTCCTCTAGAATG
GGTGAGCACAGGTGATTCAGGCGGCTTAAATCCATCAGAGCAGCCCTGCCGGAAAAGGAAATAATATGATGTTTTTTCCTGCTCTTGTTC
TGCCTTGCTCACTCCTTCTCCCTCCGCAGTATCTGGAAAGATTCTGGAGACCAGGGCTTATGCATCTAGGGAAAGTGACCAAGGGCAGCC
TATCCAGCCTCTGCCTCCATTCCTGAAGGGGACTTCCCTGCCCCTGTTTCTTTCCATGTCTCTCCCTCCCTCACTCCCATTTGCCCCCTT
CCACCCCATCAGGTTAGCCACATATCTTCCAGGGCTCAGCTGTTCACACCAACTCCCTGGCTCTTATCATCCATCCCTCCTTCCCCCAGG
AGCTTCCACTGTAGGAGTTTCAGGGAGAAGAGTTTGGAATTCATTGGACCTTTCAGCCCTCAGGTTCCCTAGAGGAGCCTAGTTGATCTG
TGAGTACCAATGGTGGGCCAAAGACGCAGGGAATAATGAAGGGAGAAAGAAAAGAAAGGAAGATGGAGGAAAACGAGGCAACTGGAAGAA
GGAAGGAAGGAAAGAAGGAAGGGATGGAGGGGATGAAGAGAAGGGAGAGAGGGATATAGCTGAGGAATTTATCTAAAAATGTGCATGTAA
ATCTCCATTATGTTCCAGGTACTGTGCCTTATGATGGCTTTGTTTTTTGTTGTCATTAGAGACAAGGTCTTGCTTTGTCACCCAGGCTGG
AGTAGAGTGGTTCGATCATAGCTCACCGCAGCCTCAACCTCCTAGGCTCAAGCCATCTTCCTGCCTCAGTCTCCCAAAATGCTGGGATTA
CAGGTGTGAGCCACTATGCTCAGCCTGTTTCAAACATTATTATAATAGCAGATTTATTTAGTACTTTATTATACATCAGATACCACTCTA
ATTGTGAAATAGATATATATTCATTTAATTATTGAAACAACCATGTAGTTAAAACACTATTAACTCATTTTACAGTTGAGTAGACTGAGA
CACAGAGAAGTTAAAGAACTTGCCCAAGAGTAAATGTCTAATAAACCGTAGAGCCAGGATCTGGGCCCAGGCTGTCTGACTCCAGAACTT
GCTCACTCAACCACTAAACCATCCTGCTTCTCATGGGAAAGAAACACATCCTGCCTTTGAGGATCCTACAGCCTGTGACAAAAACAGTCA
TAAAAATGGACAATTGCCTTATTACACAAGGAGCTCTTAAGTGGCAATACAAGCAATGGAAGTGGCTGTCCAGAGGAGGGAACTTCTAGT
CCTAGGTCTTTAAGGATGAATAGGAGTTTGCCAGAGTGAGAAAGGGAATTGAACTTTCCTGGGAGTGGCCTTTTAAAAAGCAATGAGATA
TGGCCAGGCCTGGCTTGTTTGGGGAAGAGTCAAAATCTAGGGTGGCAAGAGTATGGGAAGCACACTGAGGAGCAGAGAGAAATGGGGTAG
GTAGGAAGGTAGGGTTTTGACCACAAAGAGCTGTGCATGCTAAACTGGGCCACAGGTGCCAGCAGGGTTGTTTGAGGAAGGGAAGAGCAA
GACAAGCTCTGGTTTAGGAAGAGAGCTGTGGCAGCATAAAGGCCTGAAAGAGGAGACAGAGCTGTCACCCAAAATGGACTTGAGAGCTCC
CTGTGGTTTACTCTGTGGCTAGAAAACACTGCCGGCCAGATGGATCACAAATGTCTATGGTAGCTTAGAAGCTCTGCTCTTGAAGAGGAT
CCTGGGATCTGCCCAACACCCTTCCCAACCTCCATTTCCCCATCCCCACCTCCATTGCCCCATCCCCCCTCTCCCCCTAGGCAGGTGGAT
CTGAGCCTTATCCCACCACCAATGCCCCTGCTAGCCTCTCCCCACCCAGCCCAGAGCCTACTCAGCCTGCCATCTCAAGAGCCCCACCGA
GGGTCACTGGCTTCCTGGGAGGAGTCACCAGGCTGCCAGCTTTCCCTCTGCCTCCCCAAGGAACCTGAGACCTCCCTCTGCTCATCACCC
TGGGCCCAATCCTGAATCCAGCCCCCATCAACCAAGACAGCAAAAGGGCCAGGTCTGTCCCTTATAATTTTGAGCCTTCTCCCTCAAGTT
TGGAAGCCCTGACTTTAAGAAATGCCAAATGCAAGGACCATTAAGAAAATTCTCCCCGAAATGAGGCTCCTCTAACAAATGATGATTAAA
ACGCTCTCTCCTTGAGCAGTCACATTCTAGAAACAGGACATTCCATGAGGCAGGAAGAGTTCAGTTAATTTGCTCCTGAAAAAGTGTGGT
TCAGTGTTTGTGTGGCAATGTACGTGGGCAGAAGAGGCCGCTCAAGCTGTGTCCCCCCTGAGCAGGATTCAGGAAAGGGAAAAGAAGTTC
TCTTCAACTCAGCCAAGGGGCCGTACGATGGCCGATGAGATTATGTATTTAAAAGTTCTTTGTAAAGTGTAAACTAAAAACCTTAAATGT
AAGATGCTGTTGTTATTATTACTGTTGTTGTTGCTGTTATGGACATGCCAAAAGGCCCTTGTTAGAAGACAGTTTTGCCTTTTCAATCTC
ATAGCAAGGAACTCAAGTCTGATGCTTCAAAAAGATGAGAAGAAGGGCAAGAAGAGGGATAACTCCCAAGCTCAGAGGGAAAAAAAAGGT
GGGGGAAAAGAGCCCCAGGGTGACCTTCAGGAAAGGCCAGGACCAGGATGATCTAACCTTTCCCTTCACCAGAAACAAAGCTATTGCCAG
ACTGAACCCTAAAGTCAAGCAGTCACCCACTGCCTTTGCTGGGAGCAGAAGCCCATAGCAACAAGTGACCTGCCCCTCAGACTCAAGATC
CCAGATACCAGAGCTGGAGGAGTCATAGGGCATTACTGGTAGGCAGGAAAACTGAGGGTCGAACAAATGGAAGAATGCGGTGATCATAGA
CCAAAGACACACAGATAATTAACCCCATGTGTCCACCCAGGCCAAAGTTCTTCCTGCTACCCCACAGTGGATGTCCAGGCAGATGGTCCC
CACATGATGGGGAAGCAGAGGGCATAGTGTGGTTTTGTGGGACTTGTTCATGTTTTGTAGTGTGGGCTCAACAGTGCCAAAGGAAACACT
AGGGAAAAGTTGGTGAAACATGCCAGCTAGCAGGACCAGTAAAGGCATAATCAGGCATTTGGCAAAGCTTGCTTTTCTAATTCAATGATA
GGTTCTAATAGGAAATTTTTGAAGATTTTTTAAAACAATGTTATAGTGGCACTTCCCCAGTATGGAATAAATAACATGCATTCTTTTTTC

>In-frame_FSTL4_ENST00000265342_chr5_132537625_-_SLIT3_ENST00000332966_chr5_168114121_-_3701nt
TCACGGGCTCCGGTCCCGGCGGCAGAAATAGGGCAGCCGCGGCGGCGGTGGCACAGCAGCGGGCAGCGGCGGCTCAGGGAGCTGGAGCCT
CAACAGCCTCCAGCGAGCCCGGGACCCGCCGACAGCCCGAGAAACCAGCCGAAGGACGCGGGGCGGGGTCGCCGCCGCCGCCACGGGGTG
CTCCCTCCCTCCCGCCCAAGTCCGGCCACCTGGTCTTCCCCTCGGCCCCGGCCGTCTCAGACTCATCAAAATGAAACCAGGAGGCTTTTG
GCTGCATCTCACACTGCTCGGAGCCTCCCTGCCGGCTGCGCTGGGATGGATGGACCCAGGAACCAGCAGAGGCCCGGATGTGGGTGTGGG
GGAGTCACAGGCAGAGGAGCCCAGAAGCTTTGAAGTCACAAGAAGAGAAGGGCTTTCCAGCCACAACGAGCTGCTGGCCTCCTGCGGGAA
GAAGTTCTGCAGCCGAGGGAGCCGGTGCGTGCTCAGCAGGAAGACAGGGGAGCCCGAATGCCAGTGCCTGGAGGCATGCAGGCCCAGCTA
CGTGCCTGTGTGCGGCTCTGATGGGAGGTTTTATGAAAACCACTGTAAGCTCCACCGTGCTGCTTGCCTCCTGGGAAAGAGGATCACCGT
CATCCACAGCAAGGACTGTTTCCTCAAAGGTGACACGTGCACCATGGCCGGCTACGCCCGCTTGAAGAATGTCCTTCTGGCACTCCAGAC
CCGTCTGCAGCCACTCCAAGAAGGAGACAGCAGACAAGACCCTGCCTCCCAGAAGCGCCTCCTGGTGGAATCTCTGTTCAGGGACTTAGA
TGCAGATGGCAATGGCCACCTCAGCAGCTCCGAACTGGCTCAGCATGTGCTGAAGAAGCAGGACCTGGATGAAGACTTACTTGGTTGCTC
ACCAGGTGACCTCCTCCGATTTGACGATTACAACAGTGACAGCTCCCTGACCCTCCGCGAGTTCTACATGGCCTTCCAAGTGGTTCAGCT
CAGCCTCGCCCCCGAGGACAGGGTCAGTGTGACCACAGTGACCGTGGGGCTGAGCACAGTGCTGACCTGCGCCGTCCATGGAGACCTGAG
GCCACCAATCATCTGGAAGCGCAACGGGCTCACCCTGAACTTCCTGGACTTGGAAGACATCAATGACTTTGGAGAGGATGATTCCCTGTA
CATCACCAAGGTGACCACCATCCACATGGGCAATTACACCTGCCATGCTTCCGGCCACGAGCAGCTGTTCCAGACCCACGTCCTGCAGGT
GAATGTGCCGCCAGTCATCCGTGTCTATCCAGAGAGCCAGGCACAGGAGCCTGGAGTGGCAGCCAGCCTAAGATGCCATGCTGAGGGCAT
TCCCATGCCCAGAATCACTTGGCTGAAAAACGGCGTGGATGTCTCAACTCAGATGTCCAAACAGCTCTCCCTTTTAGCCAATGGGAGCGA
ACTCCACATCAGCAGTGTTCGGTATGAAGACACAGGGGCATACACCTGCATTGCCAAAAATGAAGTGGGTGTGGATGAAGATATCTCCTC
GCTCTTCATTGAAGACTCAGCTAGAAAGACCCTTGCAAACATCCTGTGGCGAGAGGAAGGCCTCAGCGTGGGAAACATGTTCTATGTCTT
CTCCGACGACGGTATCATCGTCATCCATCCTGTGGACTGTGAGATCCAGAGGCACCTCAAACCCACGGAAAAGATTTTCATGAGCTATGA
AGAAATCTGTCCTCAAAGAGAAAAAAATGCAACCCAGCCCTGCCAGTGGGTATCTGCAGTCAATGTCCGGAACCGGTACATCTATGTGGC
CCAGCCAGCACTGAGCAGAGTCCTTGTGGTCGACATCCAAGCCCAGAAAGTCCTACAGTCCATAGGTGTGGACCCTCTGCCGGCTAAGCT
GTCCTATGACAAGTCACATGACCAAGTGTGGGTCCTGAGCTGGGGGGACGTGCACAAGTCCCGACCAAGTCTCCAGGTGATCACAGAAGC
CAGCACCGGCCAGAGCCAGCACCTCATCCGCACACCCTTTGCAGGAGTGGATGATTTCTTCATTCCCCCAACAAACCTCATCATCAACCA
CATCAGCTGCGAGTGTGTCCCTGGCTACAGCGGGAAGCTCTGTGAGACAGACAATGATGACTGTGTGGCCCACAAGTGCCGCCACGGGGC
CCAGTGCGTGGACACAATCAATGGCTACACATGCACCTGCCCCCAGGGCTTCAGTGGACCCTTCTGTGAACACCCCCCACCCATGGTCCT
ACTGCAGACCAGCCCATGCGACCAGTACGAGTGCCAGAACGGGGCCCAGTGCATCGTGGTGCAGCAGGAGCCCACCTGCCGCTGCCCACC
AGGCTTCGCCGGCCCCAGATGCGAGAAGCTCATCACTGTCAACTTCGTGGGCAAAGACTCCTACGTGGAACTGGCCTCCGCCAAGGTCCG
ACCCCAGGCCAACATCTCCCTGCAGGTGGCCACTGACAAGGACAACGGCATCCTTCTCTACAAAGGAGACAATGACCCCCTGGCACTGGA
GCTGTACCAGGGCCACGTGCGGCTGGTCTATGACAGCCTGAGTTCCCCTCCAACCACAGTGTACAGTGTGGAGACAGTGAATGATGGGCA
GTTTCACAGTGTGGAGCTGGTGACGCTAAACCAGACCCTGAACCTAGTAGTGGACAAAGGAACTCCAAAGAGCCTGGGGAAGCTCCAGAA
GCAGCCAGCAGTGGGCATCAACAGCCCCCTCTACCTTGGAGGCATCCCCACCTCCACCGGCCTCTCTGCCTTGCGCCAGGGCACGGACCG
GCCTCTAGGCGGCTTCCACGGATGCATCCATGAGGTGCGCATCAACAACGAGCTGCAGGACTTCAAGGCCCTCCCACCACAGTCCCTGGG
GGTGTCACCAGGCTGCAAGTCCTGCACCGTGTGCAAGCACGGCCTGTGCCGCTCCGTGGAGAAGGACAGCGTGGTGTGCGAGTGCCGCCC
AGGCTGGACCGGCCCACTCTGCGATCAGGAGGCCCGGGACCCCTGCCTCGGCCACAGATGCCACCATGGAAAATGTGTGGCAACTGGGAC
CTCATACATGTGCAAGTGTGCCGAGGGCTATGGAGGGGACTTGTGTGACAACAAGAATGACTCTGCCAATGCCTGCTCAGCCTTCAAGTG
TCACCATGGGCAGTGCCACATCTCAGACCAAGGGGAGCCCTACTGCCTGTGCCAGCCCGGCTTTAGCGGCGAGCACTGCCAACAAGAGAA
TCCGTGCCTGGGACAAGTAGTCCGAGAGGTGATCCGCCGCCAGAAAGGTTATGCATCATGTGCCACAGCCTCCAAGGTGCCCATCATGGA
ATGTCGTGGGGGCTGTGGGCCCCAGTGCTGCCAGCCCACCCGCAGCAAGCGGCGGAAATACGTCTTCCAGTGCACGGACGGCTCCTCGTT
TGTAGAAGAGGTGGAGAGACACTTAGAGTGCGGCTGCCTCGCGTGTTCCTAAGCCCCTGCCCGCCTGCCTGCCACCTCTCGGACTCCAGC
TTGATGGAGTTGGGACAGCCATGTGGGACCCCCTGGTGATTCAGCATGAAGGAAATGAAGCTGGAGAGGAAGGTAAAGAAGAAGAGAATA
TTAAGTATATTGTAAAATAAACAAAAAATAGAACTTATTTTTATTATGGAAAGTGACTATTTTCATCTTTTATTATATAAATATATTACA

>In-frame_FSTL4_ENST00000265342_chr5_132537625_-_SLIT3_ENST00000404867_chr5_168114121_-_3319nt
TCACGGGCTCCGGTCCCGGCGGCAGAAATAGGGCAGCCGCGGCGGCGGTGGCACAGCAGCGGGCAGCGGCGGCTCAGGGAGCTGGAGCCT
CAACAGCCTCCAGCGAGCCCGGGACCCGCCGACAGCCCGAGAAACCAGCCGAAGGACGCGGGGCGGGGTCGCCGCCGCCGCCACGGGGTG
CTCCCTCCCTCCCGCCCAAGTCCGGCCACCTGGTCTTCCCCTCGGCCCCGGCCGTCTCAGACTCATCAAAATGAAACCAGGAGGCTTTTG
GCTGCATCTCACACTGCTCGGAGCCTCCCTGCCGGCTGCGCTGGGATGGATGGACCCAGGAACCAGCAGAGGCCCGGATGTGGGTGTGGG
GGAGTCACAGGCAGAGGAGCCCAGAAGCTTTGAAGTCACAAGAAGAGAAGGGCTTTCCAGCCACAACGAGCTGCTGGCCTCCTGCGGGAA
GAAGTTCTGCAGCCGAGGGAGCCGGTGCGTGCTCAGCAGGAAGACAGGGGAGCCCGAATGCCAGTGCCTGGAGGCATGCAGGCCCAGCTA
CGTGCCTGTGTGCGGCTCTGATGGGAGGTTTTATGAAAACCACTGTAAGCTCCACCGTGCTGCTTGCCTCCTGGGAAAGAGGATCACCGT
CATCCACAGCAAGGACTGTTTCCTCAAAGGTGACACGTGCACCATGGCCGGCTACGCCCGCTTGAAGAATGTCCTTCTGGCACTCCAGAC
CCGTCTGCAGCCACTCCAAGAAGGAGACAGCAGACAAGACCCTGCCTCCCAGAAGCGCCTCCTGGTGGAATCTCTGTTCAGGGACTTAGA
TGCAGATGGCAATGGCCACCTCAGCAGCTCCGAACTGGCTCAGCATGTGCTGAAGAAGCAGGACCTGGATGAAGACTTACTTGGTTGCTC
ACCAGGTGACCTCCTCCGATTTGACGATTACAACAGTGACAGCTCCCTGACCCTCCGCGAGTTCTACATGGCCTTCCAAGTGGTTCAGCT
CAGCCTCGCCCCCGAGGACAGGGTCAGTGTGACCACAGTGACCGTGGGGCTGAGCACAGTGCTGACCTGCGCCGTCCATGGAGACCTGAG
GCCACCAATCATCTGGAAGCGCAACGGGCTCACCCTGAACTTCCTGGACTTGGAAGACATCAATGACTTTGGAGAGGATGATTCCCTGTA
CATCACCAAGGTGACCACCATCCACATGGGCAATTACACCTGCCATGCTTCCGGCCACGAGCAGCTGTTCCAGACCCACGTCCTGCAGGT
GAATGTGCCGCCAGTCATCCGTGTCTATCCAGAGAGCCAGGCACAGGAGCCTGGAGTGGCAGCCAGCCTAAGATGCCATGCTGAGGGCAT
TCCCATGCCCAGAATCACTTGGCTGAAAAACGGCGTGGATGTCTCAACTCAGATGTCCAAACAGCTCTCCCTTTTAGCCAATGGGAGCGA
ACTCCACATCAGCAGTGTTCGGTATGAAGACACAGGGGCATACACCTGCATTGCCAAAAATGAAGTGGGTGTGGATGAAGATATCTCCTC
GCTCTTCATTGAAGACTCAGCTAGAAAGACCCTTGCAAACATCCTGTGGCGAGAGGAAGGCCTCAGCGTGGGAAACATGTTCTATGTCTT
CTCCGACGACGGTATCATCGTCATCCATCCTGTGGACTGTGAGATCCAGAGGCACCTCAAACCCACGGAAAAGATTTTCATGAGCTATGA
AGAAATCTGTCCTCAAAGAGAAAAAAATGCAACCCAGCCCTGCCAGTGGGTATCTGCAGTCAATGTCCGGAACCGGTACATCTATGTGGC
CCAGCCAGCACTGAGCAGAGTCCTTGTGGTCGACATCCAAGCCCAGAAAGTCCTACAGTCCATAGGTGTGGACCCTCTGCCGGCTAAGCT
GTCCTATGACAAGTCACATGACCAAGTGTGGGTCCTGAGCTGGGGGGACGTGCACAAGTCCCGACCAAGTCTCCAGGTGATCACAGAAGC
CAGCACCGGCCAGAGCCAGCACCTCATCCGCACACCCTTTGCAGGAGTGGATGATTTCTTCATTCCCCCAACAAACCTCATCATCAACCA
CATCAGCTGCGAGTGTGTCCCTGGCTACAGCGGGAAGCTCTGTGAGACAGACAATGATGACTGTGTGGCCCACAAGTGCCGCCACGGGGC
CCAGTGCGTGGACACAATCAATGGCTACACATGCACCTGCCCCCAGGGCTTCAGTGGACCCTTCTGTGAACACCCCCCACCCATGGTCCT
ACTGCAGACCAGCCCATGCGACCAGTACGAGTGCCAGAACGGGGCCCAGTGCATCGTGGTGCAGCAGGAGCCCACCTGCCGCTGCCCACC
AGGCTTCGCCGGCCCCAGATGCGAGAAGCTCATCACTGTCAACTTCGTGGGCAAAGACTCCTACGTGGAACTGGCCTCCGCCAAGGTCCG
ACCCCAGGCCAACATCTCCCTGCAGGTGGCCACTGACAAGGACAACGGCATCCTTCTCTACAAAGGAGACAATGACCCCCTGGCACTGGA
GCTGTACCAGGGCCACGTGCGGCTGGTCTATGACAGCCTGAGTTCCCCTCCAACCACAGTGTACAGTGTGGAGACAGTGAATGATGGGCA
GTTTCACAGTGTGGAGCTGGTGACGCTAAACCAGACCCTGAACCTAGTAGTGGACAAAGGAACTCCAAAGAGCCTGGGGAAGCTCCAGAA
GCAGCCAGCAGTGGGCATCAACAGCCCCCTCTACCTTGGAGGCATCCCCACCTCCACCGGCCTCTCTGCCTTGCGCCAGGGCACGGACCG
GCCTCTAGGCGGCTTCCACGGATGCATCCATGAGGTGCGCATCAACAACGAGCTGCAGGACTTCAAGGCCCTCCCACCACAGTCCCTGGG
GGTGTCACCAGGCTGCAAGTCCTGCACCGTGTGCAAGCACGGCCTGTGCCGCTCCGTGGAGAAGGACAGCGTGGTGTGCGAGTGCCGCCC
AGGCTGGACCGGCCCACTCTGCGATCAGGAGGCCCGGGACCCCTGCCTCGGCCACAGATGCCACCATGGAAAATGTGTGGCAACTGGGAC
CTCATACATGTGCAAGTGTGCCGAGGGCTATGGAGGGGACTTGTGTGACAACAAGAATGACTCTGCCAATGCCTGCTCAGCCTTCAAGTG
TCACCATGGGCAGTGCCACATCTCAGACCAAGGGGAGCCCTACTGCCTGTGCCAGCCCGGCTTTAGCGGCGAGCACTGCCAACAAGTCTT


Top

FusionGenePPI for FSTL4_SLIT3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
FSTL4KCMF1, UBR4, RPL23SLIT3CAPN1, OTUB1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for FSTL4_SLIT3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for FSTL4_SLIT3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneSLIT3C0019284Diaphragmatic Hernia1CTD_human
TgeneSLIT3C0036341Schizophrenia1PSYGENET
TgeneSLIT3C0041696Unipolar Depression1PSYGENET
TgeneSLIT3C1269683Major Depressive Disorder1PSYGENET