FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 13832

FusionGeneSummary for FOXP1_COQ10B

check button Fusion gene summary
Fusion gene informationFusion gene name: FOXP1_COQ10B
Fusion gene ID: 13832
HgeneTgene
Gene symbol

FOXP1

COQ10B

Gene ID

27086

80219

Gene nameforkhead box P1coenzyme Q10B
Synonyms12CC4|HSPC215|MFH|QRF1|hFKH1B-
Cytomap

3p13

2q33.1

Type of geneprotein-codingprotein-coding
Descriptionforkhead box protein P1fork head-related protein like Bglutamine-rich factor 1mac-1-regulated forkheadcoenzyme Q-binding protein COQ10 homolog B, mitochondrialcoenzyme Q10 homolog B
Modification date2018052220180523
UniProtAcc

Q9H334

Q9H8M1

Ensembl transtripts involved in fusion geneENST00000318789, ENST00000475937, 
ENST00000493089, ENST00000484350, 
ENST00000318779, ENST00000491238, 
ENST00000498215, ENST00000468577, 
ENST00000472382, 
ENST00000263960, 
ENST00000409398, ENST00000488445, 
ENST00000545340, ENST00000409010, 
Fusion gene scores* DoF score21 X 13 X 11=30034 X 3 X 4=48
# samples 264
** MAII scorelog2(26/3003*10)=-3.52982094652869
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/48*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: FOXP1 [Title/Abstract] AND COQ10B [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Tumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneFOXP1

GO:0002903

negative regulation of B cell apoptotic process

25267198

HgeneFOXP1

GO:0030316

osteoclast differentiation

18799727

HgeneFOXP1

GO:0032496

response to lipopolysaccharide

18799727

HgeneFOXP1

GO:0032680

regulation of tumor necrosis factor production

18799727

HgeneFOXP1

GO:0035926

chemokine (C-C motif) ligand 2 secretion

18799727

HgeneFOXP1

GO:0036035

osteoclast development

18799727

HgeneFOXP1

GO:0042116

macrophage activation

18799727

HgeneFOXP1

GO:0042117

monocyte activation

18799727

HgeneFOXP1

GO:0045655

regulation of monocyte differentiation

15286807

HgeneFOXP1

GO:0045892

negative regulation of transcription, DNA-templated

20950788

HgeneFOXP1

GO:0050706

regulation of interleukin-1 beta secretion

18799727

HgeneFOXP1

GO:0050727

regulation of inflammatory response

18799727

HgeneFOXP1

GO:0060766

negative regulation of androgen receptor signaling pathway

18640093

HgeneFOXP1

GO:1900424

regulation of defense response to bacterium

18799727

HgeneFOXP1

GO:1901256

regulation of macrophage colony-stimulating factor production

18799727

HgeneFOXP1

GO:2001182

regulation of interleukin-12 secretion

18799727


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPRADTCGA-J4-A83N-01AFOXP1chr3

71090479

-COQ10Bchr2

198334794

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000318789ENST00000263960FOXP1chr3

71090479

-COQ10Bchr2

198334794

+
In-frameENST00000318789ENST00000409398FOXP1chr3

71090479

-COQ10Bchr2

198334794

+
5CDS-intronENST00000318789ENST00000488445FOXP1chr3

71090479

-COQ10Bchr2

198334794

+
5CDS-intronENST00000318789ENST00000545340FOXP1chr3

71090479

-COQ10Bchr2

198334794

+
5CDS-intronENST00000318789ENST00000409010FOXP1chr3

71090479

-COQ10Bchr2

198334794

+
Frame-shitENST00000475937ENST00000263960FOXP1chr3

71090479

-COQ10Bchr2

198334794

+
Frame-shitENST00000475937ENST00000409398FOXP1chr3

71090479

-COQ10Bchr2

198334794

+
5CDS-intronENST00000475937ENST00000488445FOXP1chr3

71090479

-COQ10Bchr2

198334794

+
5CDS-intronENST00000475937ENST00000545340FOXP1chr3

71090479

-COQ10Bchr2

198334794

+
5CDS-intronENST00000475937ENST00000409010FOXP1chr3

71090479

-COQ10Bchr2

198334794

+
In-frameENST00000493089ENST00000263960FOXP1chr3

71090479

-COQ10Bchr2

198334794

+
In-frameENST00000493089ENST00000409398FOXP1chr3

71090479

-COQ10Bchr2

198334794

+
5CDS-intronENST00000493089ENST00000488445FOXP1chr3

71090479

-COQ10Bchr2

198334794

+
5CDS-intronENST00000493089ENST00000545340FOXP1chr3

71090479

-COQ10Bchr2

198334794

+
5CDS-intronENST00000493089ENST00000409010FOXP1chr3

71090479

-COQ10Bchr2

198334794

+
Frame-shitENST00000484350ENST00000263960FOXP1chr3

71090479

-COQ10Bchr2

198334794

+
Frame-shitENST00000484350ENST00000409398FOXP1chr3

71090479

-COQ10Bchr2

198334794

+
5CDS-intronENST00000484350ENST00000488445FOXP1chr3

71090479

-COQ10Bchr2

198334794

+
5CDS-intronENST00000484350ENST00000545340FOXP1chr3

71090479

-COQ10Bchr2

198334794

+
5CDS-intronENST00000484350ENST00000409010FOXP1chr3

71090479

-COQ10Bchr2

198334794

+
intron-3CDSENST00000318779ENST00000263960FOXP1chr3

71090479

-COQ10Bchr2

198334794

+
intron-3CDSENST00000318779ENST00000409398FOXP1chr3

71090479

-COQ10Bchr2

198334794

+
intron-intronENST00000318779ENST00000488445FOXP1chr3

71090479

-COQ10Bchr2

198334794

+
intron-intronENST00000318779ENST00000545340FOXP1chr3

71090479

-COQ10Bchr2

198334794

+
intron-intronENST00000318779ENST00000409010FOXP1chr3

71090479

-COQ10Bchr2

198334794

+
Frame-shitENST00000491238ENST00000263960FOXP1chr3

71090479

-COQ10Bchr2

198334794

+
Frame-shitENST00000491238ENST00000409398FOXP1chr3

71090479

-COQ10Bchr2

198334794

+
5CDS-intronENST00000491238ENST00000488445FOXP1chr3

71090479

-COQ10Bchr2

198334794

+
5CDS-intronENST00000491238ENST00000545340FOXP1chr3

71090479

-COQ10Bchr2

198334794

+
5CDS-intronENST00000491238ENST00000409010FOXP1chr3

71090479

-COQ10Bchr2

198334794

+
Frame-shitENST00000498215ENST00000263960FOXP1chr3

71090479

-COQ10Bchr2

198334794

+
Frame-shitENST00000498215ENST00000409398FOXP1chr3

71090479

-COQ10Bchr2

198334794

+
5CDS-intronENST00000498215ENST00000488445FOXP1chr3

71090479

-COQ10Bchr2

198334794

+
5CDS-intronENST00000498215ENST00000545340FOXP1chr3

71090479

-COQ10Bchr2

198334794

+
5CDS-intronENST00000498215ENST00000409010FOXP1chr3

71090479

-COQ10Bchr2

198334794

+
Frame-shitENST00000468577ENST00000263960FOXP1chr3

71090479

-COQ10Bchr2

198334794

+
Frame-shitENST00000468577ENST00000409398FOXP1chr3

71090479

-COQ10Bchr2

198334794

+
5CDS-intronENST00000468577ENST00000488445FOXP1chr3

71090479

-COQ10Bchr2

198334794

+
5CDS-intronENST00000468577ENST00000545340FOXP1chr3

71090479

-COQ10Bchr2

198334794

+
5CDS-intronENST00000468577ENST00000409010FOXP1chr3

71090479

-COQ10Bchr2

198334794

+
5UTR-3CDSENST00000472382ENST00000263960FOXP1chr3

71090479

-COQ10Bchr2

198334794

+
5UTR-3CDSENST00000472382ENST00000409398FOXP1chr3

71090479

-COQ10Bchr2

198334794

+
5UTR-intronENST00000472382ENST00000488445FOXP1chr3

71090479

-COQ10Bchr2

198334794

+
5UTR-intronENST00000472382ENST00000545340FOXP1chr3

71090479

-COQ10Bchr2

198334794

+
5UTR-intronENST00000472382ENST00000409010FOXP1chr3

71090479

-COQ10Bchr2

198334794

+

Top

FusionProtFeatures for FOXP1_COQ10B


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
FOXP1

Q9H334

COQ10B

Q9H8M1

Required for the function of coenzyme Q in therespiratory chain. May serve as a chaperone or may be involved inthe transport of Q6 from its site of synthesis to the catalyticsites of the respiratory complexes (By similarity). {ECO:0000250}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneFOXP1chr3:71090479chr2:198334794ENST00000318789-112155_230289678Compositional biasNote=Gln-rich
HgeneFOXP1chr3:71090479chr2:198334794ENST00000475937-102055_230289678Compositional biasNote=Gln-rich
HgeneFOXP1chr3:71090479chr2:198334794ENST00000493089-112155_230289677Compositional biasNote=Gln-rich
HgeneFOXP1chr3:71090479chr2:198334794ENST00000498215-71755_230289678Compositional biasNote=Gln-rich

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneFOXP1chr3:71090479chr2:198334794ENST00000318779-1755_230-159115Compositional biasNote=Gln-rich
HgeneFOXP1chr3:71090479chr2:198334794ENST00000484350-61655_230213602Compositional biasNote=Gln-rich
HgeneFOXP1chr3:71090479chr2:198334794ENST00000318779-17465_555-159115DNA bindingFork-head
HgeneFOXP1chr3:71090479chr2:198334794ENST00000318789-1121465_555289678DNA bindingFork-head
HgeneFOXP1chr3:71090479chr2:198334794ENST00000475937-1020465_555289678DNA bindingFork-head
HgeneFOXP1chr3:71090479chr2:198334794ENST00000484350-616465_555213602DNA bindingFork-head
HgeneFOXP1chr3:71090479chr2:198334794ENST00000493089-1121465_555289677DNA bindingFork-head
HgeneFOXP1chr3:71090479chr2:198334794ENST00000498215-717465_555289678DNA bindingFork-head
HgeneFOXP1chr3:71090479chr2:198334794ENST00000318779-17348_369-159115RegionNote=Leucine-zipper
HgeneFOXP1chr3:71090479chr2:198334794ENST00000318779-17382_386-159115RegionCTBP1-binding
HgeneFOXP1chr3:71090479chr2:198334794ENST00000318789-1121348_369289678RegionNote=Leucine-zipper
HgeneFOXP1chr3:71090479chr2:198334794ENST00000318789-1121382_386289678RegionCTBP1-binding
HgeneFOXP1chr3:71090479chr2:198334794ENST00000475937-1020348_369289678RegionNote=Leucine-zipper
HgeneFOXP1chr3:71090479chr2:198334794ENST00000475937-1020382_386289678RegionCTBP1-binding
HgeneFOXP1chr3:71090479chr2:198334794ENST00000484350-616348_369213602RegionNote=Leucine-zipper
HgeneFOXP1chr3:71090479chr2:198334794ENST00000484350-616382_386213602RegionCTBP1-binding
HgeneFOXP1chr3:71090479chr2:198334794ENST00000493089-1121348_369289677RegionNote=Leucine-zipper
HgeneFOXP1chr3:71090479chr2:198334794ENST00000493089-1121382_386289677RegionCTBP1-binding
HgeneFOXP1chr3:71090479chr2:198334794ENST00000498215-717348_369289678RegionNote=Leucine-zipper
HgeneFOXP1chr3:71090479chr2:198334794ENST00000498215-717382_386289678RegionCTBP1-binding
HgeneFOXP1chr3:71090479chr2:198334794ENST00000318779-17306_331-159115Zinc fingerNote=C2H2-type
HgeneFOXP1chr3:71090479chr2:198334794ENST00000318789-1121306_331289678Zinc fingerNote=C2H2-type
HgeneFOXP1chr3:71090479chr2:198334794ENST00000475937-1020306_331289678Zinc fingerNote=C2H2-type
HgeneFOXP1chr3:71090479chr2:198334794ENST00000484350-616306_331213602Zinc fingerNote=C2H2-type
HgeneFOXP1chr3:71090479chr2:198334794ENST00000493089-1121306_331289677Zinc fingerNote=C2H2-type
HgeneFOXP1chr3:71090479chr2:198334794ENST00000498215-717306_331289678Zinc fingerNote=C2H2-type


Top

FusionGeneSequence for FOXP1_COQ10B


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_FOXP1_ENST00000318789_chr3_71090479_-_COQ10B_ENST00000263960_chr2_198334794_+_379aa
MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQALQVARQLLLQQQQQQQVSGLKSPKRNDKQ
PALQVPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQVLLQQQQALMLQQQQLQEFTKKQQEQLQLQLLQQQHAGKQPKEQQQVATQQLA
FQQQLLQMQQLQQQHLLSLQRQGLLTIQPGQPALPLQPLAQGMIPTELQQLWKEVTSAHTAEETTGNNHSSLDLTTTCVSSSAPSKTSLI
MNPHASTNGQLSVHTPKRERHLVLMGDFSIIWRLFGVLAQVFLATQELVPWIFQFLLNFDHFYIPSLPHSFLMKL_SRW_LPLKEEHVSC

>In-frame_FOXP1_ENST00000318789_chr3_71090479_-_COQ10B_ENST00000409398_chr2_198334794_+_379aa
MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQALQVARQLLLQQQQQQQVSGLKSPKRNDKQ
PALQVPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQVLLQQQQALMLQQQQLQEFTKKQQEQLQLQLLQQQHAGKQPKEQQQVATQQLA
FQQQLLQMQQLQQQHLLSLQRQGLLTIQPGQPALPLQPLAQGMIPTELQQLWKEVTSAHTAEETTGNNHSSLDLTTTCVSSSAPSKTSLI
MNPHASTNGQLSVHTPKRERHLVLMGDFSIIWRLFGVLAQVFLATQELVPWIFQFLLNFDHFYIPSLPHSFLMKL_SRW_LPLKEEHVSC

>In-frame_FOXP1_ENST00000493089_chr3_71090479_-_COQ10B_ENST00000263960_chr2_198334794_+_379aa
MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQALQVARQLLLQQQQQQQVSGLKSPKRNDKQ
PALQVPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQVLLQQQQALMLQQQQLQEFTKKQQEQLQLQLLQQQHAGKQPKEQQQVATQQLA
FQQQLLQMQQLQQQHLLSLQRQGLLTIQPGQPALPLQPLAQGMIPTELQQLWKEVTSAHTAEETTGNNHSSLDLTTTCVSSSAPSKTSLI
MNPHASTNGQLSVHTPKRERHLVLMGDFSIIWRLFGVLAQVFLATQELVPWIFQFLLNFDHFYIPSLPHSFLMKL_SRW_LPLKEEHVSC

>In-frame_FOXP1_ENST00000493089_chr3_71090479_-_COQ10B_ENST00000409398_chr2_198334794_+_379aa
MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQALQVARQLLLQQQQQQQVSGLKSPKRNDKQ
PALQVPVSVAMMTPQVITPQQMQQILQQQVLSPQQLQVLLQQQQALMLQQQQLQEFTKKQQEQLQLQLLQQQHAGKQPKEQQQVATQQLA
FQQQLLQMQQLQQQHLLSLQRQGLLTIQPGQPALPLQPLAQGMIPTELQQLWKEVTSAHTAEETTGNNHSSLDLTTTCVSSSAPSKTSLI
MNPHASTNGQLSVHTPKRERHLVLMGDFSIIWRLFGVLAQVFLATQELVPWIFQFLLNFDHFYIPSLPHSFLMKL_SRW_LPLKEEHVSC


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_FOXP1_ENST00000318789_chr3_71090479_-_COQ10B_ENST00000263960_chr2_198334794_+_1139nt
ATGATGCAAGAATCTGGGACTGAGACAAAAAGTAACGGTTCAGCCATCCAGAATGGGTCGGGCGGCAGCAACCACTTACTAGAGTGCGGC
GGTCTTCGGGAGGGGCGGTCCAACGGAGAGACGCCGGCCGTGGACATCGGGGCAGCTGACCTCGCCCACGCCCAGCAGCAGCAGCAACAG
GCACTTCAGGTGGCAAGACAGCTCCTTCTTCAGCAGCAACAGCAGCAGCAAGTTAGTGGATTAAAATCTCCCAAGAGGAATGACAAACAA
CCAGCTCTTCAGGTTCCCGTGTCAGTGGCTATGATGACACCTCAAGTTATCACTCCCCAGCAAATGCAGCAGATCCTCCAGCAACAAGTG
CTGAGCCCTCAGCAGCTCCAGGTTCTCCTCCAGCAGCAGCAGGCCCTCATGCTTCAACAGCAGCAGCTTCAAGAGTTTTATAAAAAACAA
CAGGAACAGTTGCAGCTTCAACTTTTACAACAACAACATGCTGGAAAACAGCCTAAAGAGCAACAGCAGGTGGCTACCCAGCAGTTGGCT
TTTCAGCAGCAGCTTTTACAGATGCAGCAGTTACAGCAGCAGCACCTCCTGTCTTTGCAGCGCCAAGGCCTTCTGACAATTCAGCCCGGG
CAGCCTGCCCTTCCCCTTCAACCTCTTGCTCAAGGCATGATTCCAACAGAACTGCAGCAGCTCTGGAAAGAAGTGACAAGTGCTCATACT
GCAGAAGAAACCACAGGCAACAATCACAGCAGTTTGGATCTGACCACGACATGTGTCTCCTCCTCTGCACCTTCCAAGACCTCCTTAATA
ATGAACCCACATGCCTCTACCAATGGACAGCTCTCAGTCCACACTCCCAAAAGGGAAAGGCATCTTGTACTGATGGGAGACTTTTCAATC
ATTTGGAGACTATTTGGCGTTTTAGCCCAGGTCTTCCTGGCTACCCAAGAACTTGTACCTTGGATTTTTCAATTTCTTTTGAATTTCGAT
CACTTCTACATTCCCAGCTTGCCACACTCTTTTTTGATGAAGTTGTGAAGCAGATGGTAGCTGCCTTTGAAAGAAGAGCATGTAAGCTGT

>In-frame_FOXP1_ENST00000318789_chr3_71090479_-_COQ10B_ENST00000409398_chr2_198334794_+_1139nt
ATGATGCAAGAATCTGGGACTGAGACAAAAAGTAACGGTTCAGCCATCCAGAATGGGTCGGGCGGCAGCAACCACTTACTAGAGTGCGGC
GGTCTTCGGGAGGGGCGGTCCAACGGAGAGACGCCGGCCGTGGACATCGGGGCAGCTGACCTCGCCCACGCCCAGCAGCAGCAGCAACAG
GCACTTCAGGTGGCAAGACAGCTCCTTCTTCAGCAGCAACAGCAGCAGCAAGTTAGTGGATTAAAATCTCCCAAGAGGAATGACAAACAA
CCAGCTCTTCAGGTTCCCGTGTCAGTGGCTATGATGACACCTCAAGTTATCACTCCCCAGCAAATGCAGCAGATCCTCCAGCAACAAGTG
CTGAGCCCTCAGCAGCTCCAGGTTCTCCTCCAGCAGCAGCAGGCCCTCATGCTTCAACAGCAGCAGCTTCAAGAGTTTTATAAAAAACAA
CAGGAACAGTTGCAGCTTCAACTTTTACAACAACAACATGCTGGAAAACAGCCTAAAGAGCAACAGCAGGTGGCTACCCAGCAGTTGGCT
TTTCAGCAGCAGCTTTTACAGATGCAGCAGTTACAGCAGCAGCACCTCCTGTCTTTGCAGCGCCAAGGCCTTCTGACAATTCAGCCCGGG
CAGCCTGCCCTTCCCCTTCAACCTCTTGCTCAAGGCATGATTCCAACAGAACTGCAGCAGCTCTGGAAAGAAGTGACAAGTGCTCATACT
GCAGAAGAAACCACAGGCAACAATCACAGCAGTTTGGATCTGACCACGACATGTGTCTCCTCCTCTGCACCTTCCAAGACCTCCTTAATA
ATGAACCCACATGCCTCTACCAATGGACAGCTCTCAGTCCACACTCCCAAAAGGGAAAGGCATCTTGTACTGATGGGAGACTTTTCAATC
ATTTGGAGACTATTTGGCGTTTTAGCCCAGGTCTTCCTGGCTACCCAAGAACTTGTACCTTGGATTTTTCAATTTCTTTTGAATTTCGAT
CACTTCTACATTCCCAGCTTGCCACACTCTTTTTTGATGAAGTTGTGAAGCAGATGGTAGCTGCCTTTGAAAGAAGAGCATGTAAGCTGT

>In-frame_FOXP1_ENST00000493089_chr3_71090479_-_COQ10B_ENST00000263960_chr2_198334794_+_1139nt
ATGATGCAAGAATCTGGGACTGAGACAAAAAGTAACGGTTCAGCCATCCAGAATGGGTCGGGCGGCAGCAACCACTTACTAGAGTGCGGC
GGTCTTCGGGAGGGGCGGTCCAACGGAGAGACGCCGGCCGTGGACATCGGGGCAGCTGACCTCGCCCACGCCCAGCAGCAGCAGCAACAG
GCACTTCAGGTGGCAAGACAGCTCCTTCTTCAGCAGCAACAGCAGCAGCAAGTTAGTGGATTAAAATCTCCCAAGAGGAATGACAAACAA
CCAGCTCTTCAGGTTCCCGTGTCAGTGGCTATGATGACACCTCAAGTTATCACTCCCCAGCAAATGCAGCAGATCCTCCAGCAACAAGTG
CTGAGCCCTCAGCAGCTCCAGGTTCTCCTCCAGCAGCAGCAGGCCCTCATGCTTCAACAGCAGCAGCTTCAAGAGTTTTATAAAAAACAA
CAGGAACAGTTGCAGCTTCAACTTTTACAACAACAACATGCTGGAAAACAGCCTAAAGAGCAACAGCAGGTGGCTACCCAGCAGTTGGCT
TTTCAGCAGCAGCTTTTACAGATGCAGCAGTTACAGCAGCAGCACCTCCTGTCTTTGCAGCGCCAAGGCCTTCTGACAATTCAGCCCGGG
CAGCCTGCCCTTCCCCTTCAACCTCTTGCTCAAGGCATGATTCCAACAGAACTGCAGCAGCTCTGGAAAGAAGTGACAAGTGCTCATACT
GCAGAAGAAACCACAGGCAACAATCACAGCAGTTTGGATCTGACCACGACATGTGTCTCCTCCTCTGCACCTTCCAAGACCTCCTTAATA
ATGAACCCACATGCCTCTACCAATGGACAGCTCTCAGTCCACACTCCCAAAAGGGAAAGGCATCTTGTACTGATGGGAGACTTTTCAATC
ATTTGGAGACTATTTGGCGTTTTAGCCCAGGTCTTCCTGGCTACCCAAGAACTTGTACCTTGGATTTTTCAATTTCTTTTGAATTTCGAT
CACTTCTACATTCCCAGCTTGCCACACTCTTTTTTGATGAAGTTGTGAAGCAGATGGTAGCTGCCTTTGAAAGAAGAGCATGTAAGCTGT

>In-frame_FOXP1_ENST00000493089_chr3_71090479_-_COQ10B_ENST00000409398_chr2_198334794_+_1139nt
ATGATGCAAGAATCTGGGACTGAGACAAAAAGTAACGGTTCAGCCATCCAGAATGGGTCGGGCGGCAGCAACCACTTACTAGAGTGCGGC
GGTCTTCGGGAGGGGCGGTCCAACGGAGAGACGCCGGCCGTGGACATCGGGGCAGCTGACCTCGCCCACGCCCAGCAGCAGCAGCAACAG
GCACTTCAGGTGGCAAGACAGCTCCTTCTTCAGCAGCAACAGCAGCAGCAAGTTAGTGGATTAAAATCTCCCAAGAGGAATGACAAACAA
CCAGCTCTTCAGGTTCCCGTGTCAGTGGCTATGATGACACCTCAAGTTATCACTCCCCAGCAAATGCAGCAGATCCTCCAGCAACAAGTG
CTGAGCCCTCAGCAGCTCCAGGTTCTCCTCCAGCAGCAGCAGGCCCTCATGCTTCAACAGCAGCAGCTTCAAGAGTTTTATAAAAAACAA
CAGGAACAGTTGCAGCTTCAACTTTTACAACAACAACATGCTGGAAAACAGCCTAAAGAGCAACAGCAGGTGGCTACCCAGCAGTTGGCT
TTTCAGCAGCAGCTTTTACAGATGCAGCAGTTACAGCAGCAGCACCTCCTGTCTTTGCAGCGCCAAGGCCTTCTGACAATTCAGCCCGGG
CAGCCTGCCCTTCCCCTTCAACCTCTTGCTCAAGGCATGATTCCAACAGAACTGCAGCAGCTCTGGAAAGAAGTGACAAGTGCTCATACT
GCAGAAGAAACCACAGGCAACAATCACAGCAGTTTGGATCTGACCACGACATGTGTCTCCTCCTCTGCACCTTCCAAGACCTCCTTAATA
ATGAACCCACATGCCTCTACCAATGGACAGCTCTCAGTCCACACTCCCAAAAGGGAAAGGCATCTTGTACTGATGGGAGACTTTTCAATC
ATTTGGAGACTATTTGGCGTTTTAGCCCAGGTCTTCCTGGCTACCCAAGAACTTGTACCTTGGATTTTTCAATTTCTTTTGAATTTCGAT
CACTTCTACATTCCCAGCTTGCCACACTCTTTTTTGATGAAGTTGTGAAGCAGATGGTAGCTGCCTTTGAAAGAAGAGCATGTAAGCTGT


* Fusion transcript sequences (Full-length transcript).
>In-frame_FOXP1_ENST00000318789_chr3_71090479_-_COQ10B_ENST00000263960_chr2_198334794_+_3049nt
GGGGGGTGGGCGCCAGCGCCCCGGCGAACGGCAAAGAGGGAGCCGCTCCCGCTCGGGGGGCCGCTGGAGTGCCCAGCGGGAACCCGAAAG
TTTGTAAGAGGAAGAGAGCGCGCGGCGAGCGAGCGAGCGGGCCGGGGGCAGCGGCAGCGGCGCCGGGGACCATGGTGCTGCCGGCGCCTC
CTCCGCGGGCGTGAAGGCGGCGCTCCTACTCCCTCCCCGGACTCCGCGGTGTCCCAGAAGCTTTTGTTGACAATTCCAGTTTCCGAACAA
AACATTTCGGCAATGGTGAGGGCTTCGATCCCTTCTCTGATTTGCTGTCAGCCATGAACGGATGGATGTGATGCCTGCTAGCCAAAAGGC
TTCCCTCTGTGTGTTGCAGTCCTGTGGCATTATGCATGCCCCCTCCCAGTGACCCCAGGCTTTTTATGGCTGTGAGACACGTTAAAATTT
CAGGGGTAAGACGTGACCTTTTGAGGTGACTATAACTGAAGATTGCTTTACAGAAGCCAAAAAAGGTTTTTGAGTCATGATGCAAGAATC
TGGGACTGAGACAAAAAGTAACGGTTCAGCCATCCAGAATGGGTCGGGCGGCAGCAACCACTTACTAGAGTGCGGCGGTCTTCGGGAGGG
GCGGTCCAACGGAGAGACGCCGGCCGTGGACATCGGGGCAGCTGACCTCGCCCACGCCCAGCAGCAGCAGCAACAGGCACTTCAGGTGGC
AAGACAGCTCCTTCTTCAGCAGCAACAGCAGCAGCAAGTTAGTGGATTAAAATCTCCCAAGAGGAATGACAAACAACCAGCTCTTCAGGT
TCCCGTGTCAGTGGCTATGATGACACCTCAAGTTATCACTCCCCAGCAAATGCAGCAGATCCTCCAGCAACAAGTGCTGAGCCCTCAGCA
GCTCCAGGTTCTCCTCCAGCAGCAGCAGGCCCTCATGCTTCAACAGCAGCAGCTTCAAGAGTTTTATAAAAAACAACAGGAACAGTTGCA
GCTTCAACTTTTACAACAACAACATGCTGGAAAACAGCCTAAAGAGCAACAGCAGGTGGCTACCCAGCAGTTGGCTTTTCAGCAGCAGCT
TTTACAGATGCAGCAGTTACAGCAGCAGCACCTCCTGTCTTTGCAGCGCCAAGGCCTTCTGACAATTCAGCCCGGGCAGCCTGCCCTTCC
CCTTCAACCTCTTGCTCAAGGCATGATTCCAACAGAACTGCAGCAGCTCTGGAAAGAAGTGACAAGTGCTCATACTGCAGAAGAAACCAC
AGGCAACAATCACAGCAGTTTGGATCTGACCACGACATGTGTCTCCTCCTCTGCACCTTCCAAGACCTCCTTAATAATGAACCCACATGC
CTCTACCAATGGACAGCTCTCAGTCCACACTCCCAAAAGGGAAAGGCATCTTGTACTGATGGGAGACTTTTCAATCATTTGGAGACTATT
TGGCGTTTTAGCCCAGGTCTTCCTGGCTACCCAAGAACTTGTACCTTGGATTTTTCAATTTCTTTTGAATTTCGATCACTTCTACATTCC
CAGCTTGCCACACTCTTTTTTGATGAAGTTGTGAAGCAGATGGTAGCTGCCTTTGAAAGAAGAGCATGTAAGCTGTATGGTCCAGAAACA
AATATACCTCGGGAGTTAATGCTTCATGAAGTCCATCACACATAAAGGCAAAAAAGAACTGGTGCCACCTGCTTCTGACTTTAGTTTGTT
CACTTTTAGGAAGTATTTTCATGACATGTTTTCAGAAGCCAGAAAGCATTTGTTAAACGCAGCTTTGGTTATAAACCTGCACCATTGAAA
ATTTGCACATAGAATATAGACTCACTTGTACATAGAATTATTTCTTCAAGTATAATTCAAAATAATATGGACATTATCATGTTCTGCATT
ACAATAATGGGATGTCATCACCATTGCTAGAATACTGGCATGATTCTTCTGAGCAGAAGTTGAAACTGTAAATTTAAACCTTTTAATTAT
CACCTTACCTGAAAGAGGTTAGTTAAGATATTCACACAGTATGTATTATATTAACCATATCACACTTAAGTTATTAAATTCAGACTATTT
GTAACTTATTGTTATAGGGCCTGCCGTATGGCTTAGGATATTTGAGTAATCATATATTTAAAGTAAAAACTTTGGGCTGGGCACAGTGGC
TCACACCTGTAATCCCAGCACTTGGGGAAGCTGAGGTGGGCAGATCAGTTGAGGTCAGGAGTTCTAGACCAGCCTGGTCAACATGGCGAA
ACCCCATCTCTACTAAAAATACAAAAATTAGCTGGGCGTGGTGGCACACACCTGTAATCCCAGTTACTTGGGAGGCTGAGGCACAAGAAT
CGCTTGAACCCGGGAGGCGGAGGTTGCAGTTAGCCAAGATCGCCCTGCTGCACTCCAGCCTGGGCAACAGAGGGAGACTCTGTCTCCAAA
AACAAAAACAAAAACTGTTAGTGAAGGTTCCCTGGGACTTTTGATATTTTAAAAATTGTTCTTATGACTAGTAGATAAATTCATTGCCAT
AATGAGGCTAGCTCCCAGATAAACAGTGTATTTTCTTCTTTTTTTTTTTTTTTTTGGTGAGTGGTCCAGAGCTTTAAGCTACTTTTCCAG
TAGTTTGCCACTTTCTCCGAGGTAGTTTGGCTGCTCTTTCAGTAATGCTAATTGTGTGTCAAATTTTGTCTACAACAGTAGGCAACAGAT
GAAGATAAGTTGGTTGAATGTCTCCAGCACTATGCATCCCTATTTTCTATTTATTGTGTACACTCACTTTCAGTAATGTGTTTCAAACTG
GTATTTTTTAAAAAACAAATCAATGTAAGGACTGAAGTTGAAGTAGCAATGTAATAAAGTTAATTTGTTTATTTTTTGTACAGTTAGTTT
GGTTATTGAAATCTTCCTATATTGTTTAAATGTGTATTTGCATAGACATAGTAAAGTGTTACAGCATTTCATGTCTTAAAAATATCTATG

>In-frame_FOXP1_ENST00000318789_chr3_71090479_-_COQ10B_ENST00000409398_chr2_198334794_+_1909nt
GGGGGGTGGGCGCCAGCGCCCCGGCGAACGGCAAAGAGGGAGCCGCTCCCGCTCGGGGGGCCGCTGGAGTGCCCAGCGGGAACCCGAAAG
TTTGTAAGAGGAAGAGAGCGCGCGGCGAGCGAGCGAGCGGGCCGGGGGCAGCGGCAGCGGCGCCGGGGACCATGGTGCTGCCGGCGCCTC
CTCCGCGGGCGTGAAGGCGGCGCTCCTACTCCCTCCCCGGACTCCGCGGTGTCCCAGAAGCTTTTGTTGACAATTCCAGTTTCCGAACAA
AACATTTCGGCAATGGTGAGGGCTTCGATCCCTTCTCTGATTTGCTGTCAGCCATGAACGGATGGATGTGATGCCTGCTAGCCAAAAGGC
TTCCCTCTGTGTGTTGCAGTCCTGTGGCATTATGCATGCCCCCTCCCAGTGACCCCAGGCTTTTTATGGCTGTGAGACACGTTAAAATTT
CAGGGGTAAGACGTGACCTTTTGAGGTGACTATAACTGAAGATTGCTTTACAGAAGCCAAAAAAGGTTTTTGAGTCATGATGCAAGAATC
TGGGACTGAGACAAAAAGTAACGGTTCAGCCATCCAGAATGGGTCGGGCGGCAGCAACCACTTACTAGAGTGCGGCGGTCTTCGGGAGGG
GCGGTCCAACGGAGAGACGCCGGCCGTGGACATCGGGGCAGCTGACCTCGCCCACGCCCAGCAGCAGCAGCAACAGGCACTTCAGGTGGC
AAGACAGCTCCTTCTTCAGCAGCAACAGCAGCAGCAAGTTAGTGGATTAAAATCTCCCAAGAGGAATGACAAACAACCAGCTCTTCAGGT
TCCCGTGTCAGTGGCTATGATGACACCTCAAGTTATCACTCCCCAGCAAATGCAGCAGATCCTCCAGCAACAAGTGCTGAGCCCTCAGCA
GCTCCAGGTTCTCCTCCAGCAGCAGCAGGCCCTCATGCTTCAACAGCAGCAGCTTCAAGAGTTTTATAAAAAACAACAGGAACAGTTGCA
GCTTCAACTTTTACAACAACAACATGCTGGAAAACAGCCTAAAGAGCAACAGCAGGTGGCTACCCAGCAGTTGGCTTTTCAGCAGCAGCT
TTTACAGATGCAGCAGTTACAGCAGCAGCACCTCCTGTCTTTGCAGCGCCAAGGCCTTCTGACAATTCAGCCCGGGCAGCCTGCCCTTCC
CCTTCAACCTCTTGCTCAAGGCATGATTCCAACAGAACTGCAGCAGCTCTGGAAAGAAGTGACAAGTGCTCATACTGCAGAAGAAACCAC
AGGCAACAATCACAGCAGTTTGGATCTGACCACGACATGTGTCTCCTCCTCTGCACCTTCCAAGACCTCCTTAATAATGAACCCACATGC
CTCTACCAATGGACAGCTCTCAGTCCACACTCCCAAAAGGGAAAGGCATCTTGTACTGATGGGAGACTTTTCAATCATTTGGAGACTATT
TGGCGTTTTAGCCCAGGTCTTCCTGGCTACCCAAGAACTTGTACCTTGGATTTTTCAATTTCTTTTGAATTTCGATCACTTCTACATTCC
CAGCTTGCCACACTCTTTTTTGATGAAGTTGTGAAGCAGATGGTAGCTGCCTTTGAAAGAAGAGCATGTAAGCTGTATGGTCCAGAAACA
AATATACCTCGGGAGTTAATGCTTCATGAAGTCCATCACACATAAAGGCAAAAAAGAACTGGTGCCACCTGCTTCTGACTTTAGTTTGTT
CACTTTTAGGAAGTATTTTCATGACATGTTTTCAGAAGCCAGAAAGCATTTGTTAAACGCAGCTTTGGTTATAAACCTGCACCATTGAAA
ATTTGCACATAGAATATAGACTCACTTGTACATAGAATTATTTCTTCAAGTATAATTCAAAATAATATGGACATTATCATGTTCTGCATT

>In-frame_FOXP1_ENST00000493089_chr3_71090479_-_COQ10B_ENST00000263960_chr2_198334794_+_3152nt
ATTTATTGTGTGGCGGTTGCACGCTGTACTCGCGGCGGCCCGGCCCTCGCCCGGGAGTGCGTGTGTGCGCGCGTGTGTGCGCGAGTGAGT
GTGTGCGCGGGGTGCGCGCGCGGGCGGGAGTGGGCGCGCGCGGGGAAAGGCCCGAAAACACCTTAGTTTGCACCGAGAGACCATTTGCAG
CGGAACCCGAAAGTTTGTAAGAGGAAGAGAGCGCGCGGCGAGCGAGCGAGCGGGCCGGGGGCAGCGGCAGCGGCGCCGGGGACCATGGTG
CTGCCGGCGCCTCCTCCGCGGGCGTGAAGGCGGCGCTCCTACTCCCTCCCCGGACTCCGCGGTGTCCCAGAAGCTTTTGTTGACAATTCC
AGTTTCCGAACAAAACATTTCGGCAATGGTGAGGGCTTCGATCCCTTCTCTGATTTGCTGTCAGCCATGAACGGATGGATGTGATGCCTG
CTAGCCAAAAGGCTTCCCTCTGTGTGTTGCAGTCCTGTGGCATTATGCATGCCCCCTCCCAGTGACCCCAGGCTTTTTATGGCTGTGAGA
CACGTTAAAATTTCAGGGGTAAGACGTGACCTTTTGAGGTGACTATAACTGAAGATTGCTTTACAGAAGCCAAAAAAGGTTTTTGAGTCA
TGATGCAAGAATCTGGGACTGAGACAAAAAGTAACGGTTCAGCCATCCAGAATGGGTCGGGCGGCAGCAACCACTTACTAGAGTGCGGCG
GTCTTCGGGAGGGGCGGTCCAACGGAGAGACGCCGGCCGTGGACATCGGGGCAGCTGACCTCGCCCACGCCCAGCAGCAGCAGCAACAGG
CACTTCAGGTGGCAAGACAGCTCCTTCTTCAGCAGCAACAGCAGCAGCAAGTTAGTGGATTAAAATCTCCCAAGAGGAATGACAAACAAC
CAGCTCTTCAGGTTCCCGTGTCAGTGGCTATGATGACACCTCAAGTTATCACTCCCCAGCAAATGCAGCAGATCCTCCAGCAACAAGTGC
TGAGCCCTCAGCAGCTCCAGGTTCTCCTCCAGCAGCAGCAGGCCCTCATGCTTCAACAGCAGCAGCTTCAAGAGTTTTATAAAAAACAAC
AGGAACAGTTGCAGCTTCAACTTTTACAACAACAACATGCTGGAAAACAGCCTAAAGAGCAACAGCAGGTGGCTACCCAGCAGTTGGCTT
TTCAGCAGCAGCTTTTACAGATGCAGCAGTTACAGCAGCAGCACCTCCTGTCTTTGCAGCGCCAAGGCCTTCTGACAATTCAGCCCGGGC
AGCCTGCCCTTCCCCTTCAACCTCTTGCTCAAGGCATGATTCCAACAGAACTGCAGCAGCTCTGGAAAGAAGTGACAAGTGCTCATACTG
CAGAAGAAACCACAGGCAACAATCACAGCAGTTTGGATCTGACCACGACATGTGTCTCCTCCTCTGCACCTTCCAAGACCTCCTTAATAA
TGAACCCACATGCCTCTACCAATGGACAGCTCTCAGTCCACACTCCCAAAAGGGAAAGGCATCTTGTACTGATGGGAGACTTTTCAATCA
TTTGGAGACTATTTGGCGTTTTAGCCCAGGTCTTCCTGGCTACCCAAGAACTTGTACCTTGGATTTTTCAATTTCTTTTGAATTTCGATC
ACTTCTACATTCCCAGCTTGCCACACTCTTTTTTGATGAAGTTGTGAAGCAGATGGTAGCTGCCTTTGAAAGAAGAGCATGTAAGCTGTA
TGGTCCAGAAACAAATATACCTCGGGAGTTAATGCTTCATGAAGTCCATCACACATAAAGGCAAAAAAGAACTGGTGCCACCTGCTTCTG
ACTTTAGTTTGTTCACTTTTAGGAAGTATTTTCATGACATGTTTTCAGAAGCCAGAAAGCATTTGTTAAACGCAGCTTTGGTTATAAACC
TGCACCATTGAAAATTTGCACATAGAATATAGACTCACTTGTACATAGAATTATTTCTTCAAGTATAATTCAAAATAATATGGACATTAT
CATGTTCTGCATTACAATAATGGGATGTCATCACCATTGCTAGAATACTGGCATGATTCTTCTGAGCAGAAGTTGAAACTGTAAATTTAA
ACCTTTTAATTATCACCTTACCTGAAAGAGGTTAGTTAAGATATTCACACAGTATGTATTATATTAACCATATCACACTTAAGTTATTAA
ATTCAGACTATTTGTAACTTATTGTTATAGGGCCTGCCGTATGGCTTAGGATATTTGAGTAATCATATATTTAAAGTAAAAACTTTGGGC
TGGGCACAGTGGCTCACACCTGTAATCCCAGCACTTGGGGAAGCTGAGGTGGGCAGATCAGTTGAGGTCAGGAGTTCTAGACCAGCCTGG
TCAACATGGCGAAACCCCATCTCTACTAAAAATACAAAAATTAGCTGGGCGTGGTGGCACACACCTGTAATCCCAGTTACTTGGGAGGCT
GAGGCACAAGAATCGCTTGAACCCGGGAGGCGGAGGTTGCAGTTAGCCAAGATCGCCCTGCTGCACTCCAGCCTGGGCAACAGAGGGAGA
CTCTGTCTCCAAAAACAAAAACAAAAACTGTTAGTGAAGGTTCCCTGGGACTTTTGATATTTTAAAAATTGTTCTTATGACTAGTAGATA
AATTCATTGCCATAATGAGGCTAGCTCCCAGATAAACAGTGTATTTTCTTCTTTTTTTTTTTTTTTTTGGTGAGTGGTCCAGAGCTTTAA
GCTACTTTTCCAGTAGTTTGCCACTTTCTCCGAGGTAGTTTGGCTGCTCTTTCAGTAATGCTAATTGTGTGTCAAATTTTGTCTACAACA
GTAGGCAACAGATGAAGATAAGTTGGTTGAATGTCTCCAGCACTATGCATCCCTATTTTCTATTTATTGTGTACACTCACTTTCAGTAAT
GTGTTTCAAACTGGTATTTTTTAAAAAACAAATCAATGTAAGGACTGAAGTTGAAGTAGCAATGTAATAAAGTTAATTTGTTTATTTTTT
GTACAGTTAGTTTGGTTATTGAAATCTTCCTATATTGTTTAAATGTGTATTTGCATAGACATAGTAAAGTGTTACAGCATTTCATGTCTT
AAAAATATCTATGAAGATATCTAAAATATCTATTTCTATGAAGAAACAGACTTTAACAAATATAAGCAAAATTCAGTTTTCTTTTAACCA

>In-frame_FOXP1_ENST00000493089_chr3_71090479_-_COQ10B_ENST00000409398_chr2_198334794_+_2012nt
ATTTATTGTGTGGCGGTTGCACGCTGTACTCGCGGCGGCCCGGCCCTCGCCCGGGAGTGCGTGTGTGCGCGCGTGTGTGCGCGAGTGAGT
GTGTGCGCGGGGTGCGCGCGCGGGCGGGAGTGGGCGCGCGCGGGGAAAGGCCCGAAAACACCTTAGTTTGCACCGAGAGACCATTTGCAG
CGGAACCCGAAAGTTTGTAAGAGGAAGAGAGCGCGCGGCGAGCGAGCGAGCGGGCCGGGGGCAGCGGCAGCGGCGCCGGGGACCATGGTG
CTGCCGGCGCCTCCTCCGCGGGCGTGAAGGCGGCGCTCCTACTCCCTCCCCGGACTCCGCGGTGTCCCAGAAGCTTTTGTTGACAATTCC
AGTTTCCGAACAAAACATTTCGGCAATGGTGAGGGCTTCGATCCCTTCTCTGATTTGCTGTCAGCCATGAACGGATGGATGTGATGCCTG
CTAGCCAAAAGGCTTCCCTCTGTGTGTTGCAGTCCTGTGGCATTATGCATGCCCCCTCCCAGTGACCCCAGGCTTTTTATGGCTGTGAGA
CACGTTAAAATTTCAGGGGTAAGACGTGACCTTTTGAGGTGACTATAACTGAAGATTGCTTTACAGAAGCCAAAAAAGGTTTTTGAGTCA
TGATGCAAGAATCTGGGACTGAGACAAAAAGTAACGGTTCAGCCATCCAGAATGGGTCGGGCGGCAGCAACCACTTACTAGAGTGCGGCG
GTCTTCGGGAGGGGCGGTCCAACGGAGAGACGCCGGCCGTGGACATCGGGGCAGCTGACCTCGCCCACGCCCAGCAGCAGCAGCAACAGG
CACTTCAGGTGGCAAGACAGCTCCTTCTTCAGCAGCAACAGCAGCAGCAAGTTAGTGGATTAAAATCTCCCAAGAGGAATGACAAACAAC
CAGCTCTTCAGGTTCCCGTGTCAGTGGCTATGATGACACCTCAAGTTATCACTCCCCAGCAAATGCAGCAGATCCTCCAGCAACAAGTGC
TGAGCCCTCAGCAGCTCCAGGTTCTCCTCCAGCAGCAGCAGGCCCTCATGCTTCAACAGCAGCAGCTTCAAGAGTTTTATAAAAAACAAC
AGGAACAGTTGCAGCTTCAACTTTTACAACAACAACATGCTGGAAAACAGCCTAAAGAGCAACAGCAGGTGGCTACCCAGCAGTTGGCTT
TTCAGCAGCAGCTTTTACAGATGCAGCAGTTACAGCAGCAGCACCTCCTGTCTTTGCAGCGCCAAGGCCTTCTGACAATTCAGCCCGGGC
AGCCTGCCCTTCCCCTTCAACCTCTTGCTCAAGGCATGATTCCAACAGAACTGCAGCAGCTCTGGAAAGAAGTGACAAGTGCTCATACTG
CAGAAGAAACCACAGGCAACAATCACAGCAGTTTGGATCTGACCACGACATGTGTCTCCTCCTCTGCACCTTCCAAGACCTCCTTAATAA
TGAACCCACATGCCTCTACCAATGGACAGCTCTCAGTCCACACTCCCAAAAGGGAAAGGCATCTTGTACTGATGGGAGACTTTTCAATCA
TTTGGAGACTATTTGGCGTTTTAGCCCAGGTCTTCCTGGCTACCCAAGAACTTGTACCTTGGATTTTTCAATTTCTTTTGAATTTCGATC
ACTTCTACATTCCCAGCTTGCCACACTCTTTTTTGATGAAGTTGTGAAGCAGATGGTAGCTGCCTTTGAAAGAAGAGCATGTAAGCTGTA
TGGTCCAGAAACAAATATACCTCGGGAGTTAATGCTTCATGAAGTCCATCACACATAAAGGCAAAAAAGAACTGGTGCCACCTGCTTCTG
ACTTTAGTTTGTTCACTTTTAGGAAGTATTTTCATGACATGTTTTCAGAAGCCAGAAAGCATTTGTTAAACGCAGCTTTGGTTATAAACC
TGCACCATTGAAAATTTGCACATAGAATATAGACTCACTTGTACATAGAATTATTTCTTCAAGTATAATTCAAAATAATATGGACATTAT


Top

FusionGenePPI for FOXP1_COQ10B


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
FOXP1CTBP1, FOXP1, FOXP2, FOXP4, GATAD2B, MTA1, NCOR2, ELAVL1, MYC, IL3RA, CCDC183, UNK, RCC1, HOXD13, QSER1, SATB1, SATB2, CTBP2, MYH10, LIG3, C10orf2, CUX1, VRK3, XRCC1, CHD1L, RPA2, BLM, MRE11A, MYL12B, TBP, TP53, TTF2, ZBTB10, MYL9, RPA3, TFCP2, TOP2A, UBP1, FOXP3, AURKA, SNRNP70COQ10BELAVL1, CLPB, CYCS, TIMM8B, BCKDHA, ECH1, PITRM1, POLDIP2, STOML2, CHCHD2, C1QBP


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for FOXP1_COQ10B


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for FOXP1_COQ10B


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneFOXP1C0024232Lymphatic Metastasis1CTD_human
HgeneFOXP1C0027626Neoplasm Invasiveness1CTD_human
HgeneFOXP1C0030297Pancreatic Neoplasm1CTD_human
HgeneFOXP1C0042900Vitiligo1CTD_human
HgeneFOXP1C0279628Adenocarcinoma Of Esophagus1CTD_human
HgeneFOXP1C1510586Autism Spectrum Disorders1CTD_human
HgeneFOXP1C3495559Juvenile arthritis1CTD_human
HgeneFOXP1C4013764MENTAL RETARDATION WITH LANGUAGE IMPAIRMENT AND WITH OR WITHOUT AUTISTIC FEATURES1CTD_human;ORPHANET;UNIPROT