FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 13830

FusionGeneSummary for FOXP1_ARMC8

check button Fusion gene summary
Fusion gene informationFusion gene name: FOXP1_ARMC8
Fusion gene ID: 13830
HgeneTgene
Gene symbol

FOXP1

ARMC8

Gene ID

27086

25852

Gene nameforkhead box P1armadillo repeat containing 8
Synonyms12CC4|HSPC215|MFH|QRF1|hFKH1BGID5|HSPC056|S863-2|VID28
Cytomap

3p13

3q22.3

Type of geneprotein-codingprotein-coding
Descriptionforkhead box protein P1fork head-related protein like Bglutamine-rich factor 1mac-1-regulated forkheadarmadillo repeat-containing protein 8GID complex subunit 5, VID28 homolog
Modification date2018052220180523
UniProtAcc

Q9H334

Q8IUR7

Ensembl transtripts involved in fusion geneENST00000318789, ENST00000475937, 
ENST00000493089, ENST00000484350, 
ENST00000318779, ENST00000491238, 
ENST00000498215, ENST00000468577, 
ENST00000472382, 
ENST00000481646, 
ENST00000469044, ENST00000491704, 
ENST00000358441, ENST00000489213, 
ENST00000461822, ENST00000485396, 
ENST00000471453, ENST00000470821, 
ENST00000393058, ENST00000538260, 
Fusion gene scores* DoF score21 X 13 X 11=30035 X 5 X 4=100
# samples 265
** MAII scorelog2(26/3003*10)=-3.52982094652869
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/100*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: FOXP1 [Title/Abstract] AND ARMC8 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, retained protein feature but frameshift.
DDR (DNA damage repair) gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneFOXP1

GO:0002903

negative regulation of B cell apoptotic process

25267198

HgeneFOXP1

GO:0030316

osteoclast differentiation

18799727

HgeneFOXP1

GO:0032496

response to lipopolysaccharide

18799727

HgeneFOXP1

GO:0032680

regulation of tumor necrosis factor production

18799727

HgeneFOXP1

GO:0035926

chemokine (C-C motif) ligand 2 secretion

18799727

HgeneFOXP1

GO:0036035

osteoclast development

18799727

HgeneFOXP1

GO:0042116

macrophage activation

18799727

HgeneFOXP1

GO:0042117

monocyte activation

18799727

HgeneFOXP1

GO:0045655

regulation of monocyte differentiation

15286807

HgeneFOXP1

GO:0045892

negative regulation of transcription, DNA-templated

20950788

HgeneFOXP1

GO:0050706

regulation of interleukin-1 beta secretion

18799727

HgeneFOXP1

GO:0050727

regulation of inflammatory response

18799727

HgeneFOXP1

GO:0060766

negative regulation of androgen receptor signaling pathway

18640093

HgeneFOXP1

GO:1900424

regulation of defense response to bacterium

18799727

HgeneFOXP1

GO:1901256

regulation of macrophage colony-stimulating factor production

18799727

HgeneFOXP1

GO:2001182

regulation of interleukin-12 secretion

18799727


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-HN-A2NL-01AFOXP1chr3

71247353

-ARMC8chr3

137928659

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000318789ENST00000481646FOXP1chr3

71247353

-ARMC8chr3

137928659

+
Frame-shitENST00000318789ENST00000469044FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000318789ENST00000491704FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000318789ENST00000358441FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000318789ENST00000489213FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000318789ENST00000461822FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000318789ENST00000485396FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000318789ENST00000471453FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000318789ENST00000470821FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000318789ENST00000393058FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000318789ENST00000538260FOXP1chr3

71247353

-ARMC8chr3

137928659

+
In-frameENST00000475937ENST00000481646FOXP1chr3

71247353

-ARMC8chr3

137928659

+
In-frameENST00000475937ENST00000469044FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000475937ENST00000491704FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000475937ENST00000358441FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000475937ENST00000489213FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000475937ENST00000461822FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000475937ENST00000485396FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000475937ENST00000471453FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000475937ENST00000470821FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000475937ENST00000393058FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000475937ENST00000538260FOXP1chr3

71247353

-ARMC8chr3

137928659

+
Frame-shitENST00000493089ENST00000481646FOXP1chr3

71247353

-ARMC8chr3

137928659

+
Frame-shitENST00000493089ENST00000469044FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000493089ENST00000491704FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000493089ENST00000358441FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000493089ENST00000489213FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000493089ENST00000461822FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000493089ENST00000485396FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000493089ENST00000471453FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000493089ENST00000470821FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000493089ENST00000393058FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000493089ENST00000538260FOXP1chr3

71247353

-ARMC8chr3

137928659

+
Frame-shitENST00000484350ENST00000481646FOXP1chr3

71247353

-ARMC8chr3

137928659

+
Frame-shitENST00000484350ENST00000469044FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000484350ENST00000491704FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000484350ENST00000358441FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000484350ENST00000489213FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000484350ENST00000461822FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000484350ENST00000485396FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000484350ENST00000471453FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000484350ENST00000470821FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000484350ENST00000393058FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000484350ENST00000538260FOXP1chr3

71247353

-ARMC8chr3

137928659

+
Frame-shitENST00000318779ENST00000481646FOXP1chr3

71247353

-ARMC8chr3

137928659

+
Frame-shitENST00000318779ENST00000469044FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000318779ENST00000491704FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000318779ENST00000358441FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000318779ENST00000489213FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000318779ENST00000461822FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000318779ENST00000485396FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000318779ENST00000471453FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000318779ENST00000470821FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000318779ENST00000393058FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000318779ENST00000538260FOXP1chr3

71247353

-ARMC8chr3

137928659

+
intron-3CDSENST00000491238ENST00000481646FOXP1chr3

71247353

-ARMC8chr3

137928659

+
intron-3CDSENST00000491238ENST00000469044FOXP1chr3

71247353

-ARMC8chr3

137928659

+
intron-intronENST00000491238ENST00000491704FOXP1chr3

71247353

-ARMC8chr3

137928659

+
intron-intronENST00000491238ENST00000358441FOXP1chr3

71247353

-ARMC8chr3

137928659

+
intron-intronENST00000491238ENST00000489213FOXP1chr3

71247353

-ARMC8chr3

137928659

+
intron-intronENST00000491238ENST00000461822FOXP1chr3

71247353

-ARMC8chr3

137928659

+
intron-intronENST00000491238ENST00000485396FOXP1chr3

71247353

-ARMC8chr3

137928659

+
intron-intronENST00000491238ENST00000471453FOXP1chr3

71247353

-ARMC8chr3

137928659

+
intron-intronENST00000491238ENST00000470821FOXP1chr3

71247353

-ARMC8chr3

137928659

+
intron-intronENST00000491238ENST00000393058FOXP1chr3

71247353

-ARMC8chr3

137928659

+
intron-intronENST00000491238ENST00000538260FOXP1chr3

71247353

-ARMC8chr3

137928659

+
In-frameENST00000498215ENST00000481646FOXP1chr3

71247353

-ARMC8chr3

137928659

+
In-frameENST00000498215ENST00000469044FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000498215ENST00000491704FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000498215ENST00000358441FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000498215ENST00000489213FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000498215ENST00000461822FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000498215ENST00000485396FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000498215ENST00000471453FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000498215ENST00000470821FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000498215ENST00000393058FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000498215ENST00000538260FOXP1chr3

71247353

-ARMC8chr3

137928659

+
In-frameENST00000468577ENST00000481646FOXP1chr3

71247353

-ARMC8chr3

137928659

+
In-frameENST00000468577ENST00000469044FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000468577ENST00000491704FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000468577ENST00000358441FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000468577ENST00000489213FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000468577ENST00000461822FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000468577ENST00000485396FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000468577ENST00000471453FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000468577ENST00000470821FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000468577ENST00000393058FOXP1chr3

71247353

-ARMC8chr3

137928659

+
5CDS-intronENST00000468577ENST00000538260FOXP1chr3

71247353

-ARMC8chr3

137928659

+
intron-3CDSENST00000472382ENST00000481646FOXP1chr3

71247353

-ARMC8chr3

137928659

+
intron-3CDSENST00000472382ENST00000469044FOXP1chr3

71247353

-ARMC8chr3

137928659

+
intron-intronENST00000472382ENST00000491704FOXP1chr3

71247353

-ARMC8chr3

137928659

+
intron-intronENST00000472382ENST00000358441FOXP1chr3

71247353

-ARMC8chr3

137928659

+
intron-intronENST00000472382ENST00000489213FOXP1chr3

71247353

-ARMC8chr3

137928659

+
intron-intronENST00000472382ENST00000461822FOXP1chr3

71247353

-ARMC8chr3

137928659

+
intron-intronENST00000472382ENST00000485396FOXP1chr3

71247353

-ARMC8chr3

137928659

+
intron-intronENST00000472382ENST00000471453FOXP1chr3

71247353

-ARMC8chr3

137928659

+
intron-intronENST00000472382ENST00000470821FOXP1chr3

71247353

-ARMC8chr3

137928659

+
intron-intronENST00000472382ENST00000393058FOXP1chr3

71247353

-ARMC8chr3

137928659

+
intron-intronENST00000472382ENST00000538260FOXP1chr3

71247353

-ARMC8chr3

137928659

+

Top

FusionProtFeatures for FOXP1_ARMC8


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
FOXP1

Q9H334

ARMC8

Q8IUR7


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for FOXP1_ARMC8


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_FOXP1_ENST00000475937_chr3_71247353_-_ARMC8_ENST00000481646_chr3_137928659_+_719aa
MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQEVTASSRHTVDRLFDPDPQKVLQGVIDMKN
AVIGNNKQKANLIVLGAVPRLLYLLQQETSSTELKTECAVVLGSLAMGTENNVKSLLDCHIIPALLQGLLSPDLKFIEACLRCLRTIFTS
PVTPEELLTTDATVIPHLMALLSRSRTTQEYICQIFSHCCKGPDHQTILFNHGAVQNIAHLLTSLSYKVRMQALKCFSVLAFENPQVSMT
LVNVLVDGELLPQIFVKMLQRDKPIEMQLTSAKCLTYMCRAGAIRTDDNCIVLKTLPCLVRMCSKERLLEERVEGAETLATLIEPDVELQ
RIASITDHLIAMLADTFKTPSSVSAITDIKRLDHDLKHAHELRQAAFKLTASLGANDEDIRKKIIETENMMDRIVTGLSESSVKVRLAAV
RCLHSLSRSVQQLRTSFQDHAVWKPLMKVLQNAPDEILVVASSMLCNLLLEFSPSKEPILESGAVELLCGLTQSENPALRVNGIWALMNM
AFQAEQKIKADILRSLSTEQLFRLLSDSDLNVLMKTLGLLRNLLSTRPHIDKIMSTHGKQIMQAVTLILEGEHNIEVKEQTLCILANIAD

>In-frame_FOXP1_ENST00000475937_chr3_71247353_-_ARMC8_ENST00000469044_chr3_137928659_+_719aa
MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQEVTASSRHTVDRLFDPDPQKVLQGVIDMKN
AVIGNNKQKANLIVLGAVPRLLYLLQQETSSTELKTECAVVLGSLAMGTENNVKSLLDCHIIPALLQGLLSPDLKFIEACLRCLRTIFTS
PVTPEELLTTDATVIPHLMALLSRSRTTQEYICQIFSHCCKGPDHQTILFNHGAVQNIAHLLTSLSYKVRMQALKCFSVLAFENPQVSMT
LVNVLVDGELLPQIFVKMLQRDKPIEMQLTSAKCLTYMCRAGAIRTDDNCIVLKTLPCLVRMCSKERLLEERVEGAETLATLIEPDVELQ
RIASITDHLIAMLADTFKTPSSVSAITDIKRLDHDLKHAHELRQAAFKLTASLGANDEDIRKKIIETENMMDRIVTGLSESSVKVRLAAV
RCLHSLSRSVQQLRTSFQDHAVWKPLMKVLQNAPDEILVVASSMLCNLLLEFSPSKEPILESGAVELLCGLTQSENPALRVNGIWALMNM
AFQAEQKIKADILRSLSTEQLFRLLSDSDLNVLMKTLGLLRNLLSTRPHIDKIMSTHGKQIMQAVTLILEGEHNIEVKEQTLCILANIAD

>In-frame_FOXP1_ENST00000498215_chr3_71247353_-_ARMC8_ENST00000481646_chr3_137928659_+_719aa
MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQEVTASSRHTVDRLFDPDPQKVLQGVIDMKN
AVIGNNKQKANLIVLGAVPRLLYLLQQETSSTELKTECAVVLGSLAMGTENNVKSLLDCHIIPALLQGLLSPDLKFIEACLRCLRTIFTS
PVTPEELLTTDATVIPHLMALLSRSRTTQEYICQIFSHCCKGPDHQTILFNHGAVQNIAHLLTSLSYKVRMQALKCFSVLAFENPQVSMT
LVNVLVDGELLPQIFVKMLQRDKPIEMQLTSAKCLTYMCRAGAIRTDDNCIVLKTLPCLVRMCSKERLLEERVEGAETLATLIEPDVELQ
RIASITDHLIAMLADTFKTPSSVSAITDIKRLDHDLKHAHELRQAAFKLTASLGANDEDIRKKIIETENMMDRIVTGLSESSVKVRLAAV
RCLHSLSRSVQQLRTSFQDHAVWKPLMKVLQNAPDEILVVASSMLCNLLLEFSPSKEPILESGAVELLCGLTQSENPALRVNGIWALMNM
AFQAEQKIKADILRSLSTEQLFRLLSDSDLNVLMKTLGLLRNLLSTRPHIDKIMSTHGKQIMQAVTLILEGEHNIEVKEQTLCILANIAD

>In-frame_FOXP1_ENST00000498215_chr3_71247353_-_ARMC8_ENST00000469044_chr3_137928659_+_719aa
MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQEVTASSRHTVDRLFDPDPQKVLQGVIDMKN
AVIGNNKQKANLIVLGAVPRLLYLLQQETSSTELKTECAVVLGSLAMGTENNVKSLLDCHIIPALLQGLLSPDLKFIEACLRCLRTIFTS
PVTPEELLTTDATVIPHLMALLSRSRTTQEYICQIFSHCCKGPDHQTILFNHGAVQNIAHLLTSLSYKVRMQALKCFSVLAFENPQVSMT
LVNVLVDGELLPQIFVKMLQRDKPIEMQLTSAKCLTYMCRAGAIRTDDNCIVLKTLPCLVRMCSKERLLEERVEGAETLATLIEPDVELQ
RIASITDHLIAMLADTFKTPSSVSAITDIKRLDHDLKHAHELRQAAFKLTASLGANDEDIRKKIIETENMMDRIVTGLSESSVKVRLAAV
RCLHSLSRSVQQLRTSFQDHAVWKPLMKVLQNAPDEILVVASSMLCNLLLEFSPSKEPILESGAVELLCGLTQSENPALRVNGIWALMNM
AFQAEQKIKADILRSLSTEQLFRLLSDSDLNVLMKTLGLLRNLLSTRPHIDKIMSTHGKQIMQAVTLILEGEHNIEVKEQTLCILANIAD

>In-frame_FOXP1_ENST00000468577_chr3_71247353_-_ARMC8_ENST00000481646_chr3_137928659_+_719aa
MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQEVTASSRHTVDRLFDPDPQKVLQGVIDMKN
AVIGNNKQKANLIVLGAVPRLLYLLQQETSSTELKTECAVVLGSLAMGTENNVKSLLDCHIIPALLQGLLSPDLKFIEACLRCLRTIFTS
PVTPEELLTTDATVIPHLMALLSRSRTTQEYICQIFSHCCKGPDHQTILFNHGAVQNIAHLLTSLSYKVRMQALKCFSVLAFENPQVSMT
LVNVLVDGELLPQIFVKMLQRDKPIEMQLTSAKCLTYMCRAGAIRTDDNCIVLKTLPCLVRMCSKERLLEERVEGAETLATLIEPDVELQ
RIASITDHLIAMLADTFKTPSSVSAITDIKRLDHDLKHAHELRQAAFKLTASLGANDEDIRKKIIETENMMDRIVTGLSESSVKVRLAAV
RCLHSLSRSVQQLRTSFQDHAVWKPLMKVLQNAPDEILVVASSMLCNLLLEFSPSKEPILESGAVELLCGLTQSENPALRVNGIWALMNM
AFQAEQKIKADILRSLSTEQLFRLLSDSDLNVLMKTLGLLRNLLSTRPHIDKIMSTHGKQIMQAVTLILEGEHNIEVKEQTLCILANIAD

>In-frame_FOXP1_ENST00000468577_chr3_71247353_-_ARMC8_ENST00000469044_chr3_137928659_+_719aa
MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQEVTASSRHTVDRLFDPDPQKVLQGVIDMKN
AVIGNNKQKANLIVLGAVPRLLYLLQQETSSTELKTECAVVLGSLAMGTENNVKSLLDCHIIPALLQGLLSPDLKFIEACLRCLRTIFTS
PVTPEELLTTDATVIPHLMALLSRSRTTQEYICQIFSHCCKGPDHQTILFNHGAVQNIAHLLTSLSYKVRMQALKCFSVLAFENPQVSMT
LVNVLVDGELLPQIFVKMLQRDKPIEMQLTSAKCLTYMCRAGAIRTDDNCIVLKTLPCLVRMCSKERLLEERVEGAETLATLIEPDVELQ
RIASITDHLIAMLADTFKTPSSVSAITDIKRLDHDLKHAHELRQAAFKLTASLGANDEDIRKKIIETENMMDRIVTGLSESSVKVRLAAV
RCLHSLSRSVQQLRTSFQDHAVWKPLMKVLQNAPDEILVVASSMLCNLLLEFSPSKEPILESGAVELLCGLTQSENPALRVNGIWALMNM
AFQAEQKIKADILRSLSTEQLFRLLSDSDLNVLMKTLGLLRNLLSTRPHIDKIMSTHGKQIMQAVTLILEGEHNIEVKEQTLCILANIAD


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_FOXP1_ENST00000475937_chr3_71247353_-_ARMC8_ENST00000481646_chr3_137928659_+_2157nt
ATGATGCAAGAATCTGGGACTGAGACAAAAAGTAACGGTTCAGCCATCCAGAATGGGTCGGGCGGCAGCAACCACTTACTAGAGTGCGGC
GGTCTTCGGGAGGGGCGGTCCAACGGAGAGACGCCGGCCGTGGACATCGGGGCAGCTGACCTCGCCCACGCCCAGCAGCAGCAGCAACAG
GAAGTAACAGCTAGCAGTCGCCACTATGTTGACAGGCTATTTGACCCTGATCCCCAGAAAGTTCTACAAGGTGTCATAGACATGAAAAAT
GCTGTAATTGGAAACAACAAGCAGAAAGCCAATCTCATTGTTTTAGGAGCTGTTCCAAGATTGTTGTACTTGCTTCAGCAAGAAACCTCA
AGCACAGAGCTGAAAACTGAATGTGCAGTGGTGTTGGGAAGTCTTGCTATGGGTACTGAAAACAATGTCAAGTCTCTACTGGACTGCCAT
ATTATCCCTGCCTTATTGCAAGGACTACTGTCCCCAGACCTGAAGTTTATTGAAGCTTGCCTCCGATGCCTGCGTACCATCTTCACCAGT
CCTGTCACTCCAGAGGAGCTACTGTATACAGATGCCACAGTGATACCACACCTCATGGCACTGCTTAGCAGGTCCCGCTATACCCAGGAG
TACATCTGTCAGATCTTCTCACACTGCTGTAAAGGGCCAGATCATCAAACAATTTTATTTAACCACGGTGCAGTTCAGAATATTGCTCAC
CTACTAACCTCACTGTCCTACAAAGTTCGAATGCAAGCACTGAAATGTTTCTCAGTTTTAGCTTTTGAAAACCCCCAGGTATCGATGACC
CTGGTAAATGTTTTGGTTGATGGAGAATTGTTACCACAGATTTTTGTGAAGATGTTACAGAGGGATAAGCCTATTGAGATGCAGCTCACA
TCAGCAAAATGTTTAACTTACATGTGTAGAGCTGGAGCAATTCGGACAGATGATAACTGTATTGTATTAAAGACATTACCTTGTTTGGTT
CGAATGTGCAGTAAGGAGAGATTACTAGAGGAGAGAGTTGAAGGAGCTGAGACACTTGCCTATCTGATTGAACCAGATGTTGAGCTACAG
AGAATCGCTAGCATAACTGATCACCTCATTGCCATGCTTGCTGATTATTTCAAGTATCCCAGCTCAGTGAGTGCCATCACTGATATTAAA
AGGCTTGATCATGATTTAAAACATGCTCACGAACTCCGCCAGGCTGCATTCAAGCTCTATGCCTCTCTTGGAGCAAATGATGAAGACATC
CGGAAGAAGATCATTGAGACTGAAAATATGATGGACCGAATTGTGACTGGCTTGTCTGAGTCTAGTGTCAAGGTGCGGTTAGCTGCCGTC
AGATGTTTGCACAGTTTATCCAGATCTGTGCAGCAGCTTCGAACCAGTTTCCAGGATCATGCTGTTTGGAAACCTTTAATGAAGGTTTTA
CAAAATGCACCAGATGAAATCCTAGTGGTAGCATCTTCCATGCTGTGTAATCTTCTTCTTGAATTTTCTCCAAGCAAAGAGCCAATTTTG
GAATCAGGAGCCGTAGAGCTACTTTGTGGATTAACTCAGAGTGAAAATCCTGCTTTACGAGTGAATGGAATTTGGGCTTTAATGAATATG
GCATTTCAGGCTGAACAAAAAATAAAAGCAGATATTTTACGAAGCTTGAGTACTGAACAGCTATTCCGGTTATTATCAGATTCAGATTTG
AATGTGCTGATGAAGACATTGGGACTTCTTAGAAATCTCCTCTCCACTCGTCCTCATATAGATAAAATAATGAGTACTCATGGAAAGCAA
ATTATGCAAGCCGTCACTCTTATTCTAGAAGGGGAACATAACATTGAGGTCAAAGAGCAGACACTGTGCATCTTAGCCAACATAGCGGAT
GGGACAACAGCAAAAGATCTTATTATGACCAATGATGATATCCTACAGAAAATCAAGTATTACATGGGCCATTCACATGTTAAACTGCAG
CTTGCAGCCATGTTTTGTATATCAAACCTCATATGGAATGAAGAGGAAGGTTCACAAGAACGCCAGGATAAATTACGAGACATGGGCATC

>In-frame_FOXP1_ENST00000475937_chr3_71247353_-_ARMC8_ENST00000469044_chr3_137928659_+_2157nt
ATGATGCAAGAATCTGGGACTGAGACAAAAAGTAACGGTTCAGCCATCCAGAATGGGTCGGGCGGCAGCAACCACTTACTAGAGTGCGGC
GGTCTTCGGGAGGGGCGGTCCAACGGAGAGACGCCGGCCGTGGACATCGGGGCAGCTGACCTCGCCCACGCCCAGCAGCAGCAGCAACAG
GAAGTAACAGCTAGCAGTCGCCACTATGTTGACAGGCTATTTGACCCTGATCCCCAGAAAGTTCTACAAGGTGTCATAGACATGAAAAAT
GCTGTAATTGGAAACAACAAGCAGAAAGCCAATCTCATTGTTTTAGGAGCTGTTCCAAGATTGTTGTACTTGCTTCAGCAAGAAACCTCA
AGCACAGAGCTGAAAACTGAATGTGCAGTGGTGTTGGGAAGTCTTGCTATGGGTACTGAAAACAATGTCAAGTCTCTACTGGACTGCCAT
ATTATCCCTGCCTTATTGCAAGGACTACTGTCCCCAGACCTGAAGTTTATTGAAGCTTGCCTCCGATGCCTGCGTACCATCTTCACCAGT
CCTGTCACTCCAGAGGAGCTACTGTATACAGATGCCACAGTGATACCACACCTCATGGCACTGCTTAGCAGGTCCCGCTATACCCAGGAG
TACATCTGTCAGATCTTCTCACACTGCTGTAAAGGGCCAGATCATCAAACAATTTTATTTAACCACGGTGCAGTTCAGAATATTGCTCAC
CTACTAACCTCACTGTCCTACAAAGTTCGAATGCAAGCACTGAAATGTTTCTCAGTTTTAGCTTTTGAAAACCCCCAGGTATCGATGACC
CTGGTAAATGTTTTGGTTGATGGAGAATTGTTACCACAGATTTTTGTGAAGATGTTACAGAGGGATAAGCCTATTGAGATGCAGCTCACA
TCAGCAAAATGTTTAACTTACATGTGTAGAGCTGGAGCAATTCGGACAGATGATAACTGTATTGTATTAAAGACATTACCTTGTTTGGTT
CGAATGTGCAGTAAGGAGAGATTACTAGAGGAGAGAGTTGAAGGAGCTGAGACACTTGCCTATCTGATTGAACCAGATGTTGAGCTACAG
AGAATCGCTAGCATAACTGATCACCTCATTGCCATGCTTGCTGATTATTTCAAGTATCCCAGCTCAGTGAGTGCCATCACTGATATTAAA
AGGCTTGATCATGATTTAAAACATGCTCACGAACTCCGCCAGGCTGCATTCAAGCTCTATGCCTCTCTTGGAGCAAATGATGAAGACATC
CGGAAGAAGATCATTGAGACTGAAAATATGATGGACCGAATTGTGACTGGCTTGTCTGAGTCTAGTGTCAAGGTGCGGTTAGCTGCCGTC
AGATGTTTGCACAGTTTATCCAGATCTGTGCAGCAGCTTCGAACCAGTTTCCAGGATCATGCTGTTTGGAAACCTTTAATGAAGGTTTTA
CAAAATGCACCAGATGAAATCCTAGTGGTAGCATCTTCCATGCTGTGTAATCTTCTTCTTGAATTTTCTCCAAGCAAAGAGCCAATTTTG
GAATCAGGAGCCGTAGAGCTACTTTGTGGATTAACTCAGAGTGAAAATCCTGCTTTACGAGTGAATGGAATTTGGGCTTTAATGAATATG
GCATTTCAGGCTGAACAAAAAATAAAAGCAGATATTTTACGAAGCTTGAGTACTGAACAGCTATTCCGGTTATTATCAGATTCAGATTTG
AATGTGCTGATGAAGACATTGGGACTTCTTAGAAATCTCCTCTCCACTCGTCCTCATATAGATAAAATAATGAGTACTCATGGAAAGCAA
ATTATGCAAGCCGTCACTCTTATTCTAGAAGGGGAACATAACATTGAGGTCAAAGAGCAGACACTGTGCATCTTAGCCAACATAGCGGAT
GGGACAACAGCAAAAGATCTTATTATGACCAATGATGATATCCTACAGAAAATCAAGTATTACATGGGCCATTCACATGTTAAACTGCAG
CTTGCAGCCATGTTTTGTATATCAAACCTCATATGGAATGAAGAGGAAGGTTCACAAGAACGCCAGGATAAATTACGAGACATGGGCATC

>In-frame_FOXP1_ENST00000498215_chr3_71247353_-_ARMC8_ENST00000481646_chr3_137928659_+_2157nt
ATGATGCAAGAATCTGGGACTGAGACAAAAAGTAACGGTTCAGCCATCCAGAATGGGTCGGGCGGCAGCAACCACTTACTAGAGTGCGGC
GGTCTTCGGGAGGGGCGGTCCAACGGAGAGACGCCGGCCGTGGACATCGGGGCAGCTGACCTCGCCCACGCCCAGCAGCAGCAGCAACAG
GAAGTAACAGCTAGCAGTCGCCACTATGTTGACAGGCTATTTGACCCTGATCCCCAGAAAGTTCTACAAGGTGTCATAGACATGAAAAAT
GCTGTAATTGGAAACAACAAGCAGAAAGCCAATCTCATTGTTTTAGGAGCTGTTCCAAGATTGTTGTACTTGCTTCAGCAAGAAACCTCA
AGCACAGAGCTGAAAACTGAATGTGCAGTGGTGTTGGGAAGTCTTGCTATGGGTACTGAAAACAATGTCAAGTCTCTACTGGACTGCCAT
ATTATCCCTGCCTTATTGCAAGGACTACTGTCCCCAGACCTGAAGTTTATTGAAGCTTGCCTCCGATGCCTGCGTACCATCTTCACCAGT
CCTGTCACTCCAGAGGAGCTACTGTATACAGATGCCACAGTGATACCACACCTCATGGCACTGCTTAGCAGGTCCCGCTATACCCAGGAG
TACATCTGTCAGATCTTCTCACACTGCTGTAAAGGGCCAGATCATCAAACAATTTTATTTAACCACGGTGCAGTTCAGAATATTGCTCAC
CTACTAACCTCACTGTCCTACAAAGTTCGAATGCAAGCACTGAAATGTTTCTCAGTTTTAGCTTTTGAAAACCCCCAGGTATCGATGACC
CTGGTAAATGTTTTGGTTGATGGAGAATTGTTACCACAGATTTTTGTGAAGATGTTACAGAGGGATAAGCCTATTGAGATGCAGCTCACA
TCAGCAAAATGTTTAACTTACATGTGTAGAGCTGGAGCAATTCGGACAGATGATAACTGTATTGTATTAAAGACATTACCTTGTTTGGTT
CGAATGTGCAGTAAGGAGAGATTACTAGAGGAGAGAGTTGAAGGAGCTGAGACACTTGCCTATCTGATTGAACCAGATGTTGAGCTACAG
AGAATCGCTAGCATAACTGATCACCTCATTGCCATGCTTGCTGATTATTTCAAGTATCCCAGCTCAGTGAGTGCCATCACTGATATTAAA
AGGCTTGATCATGATTTAAAACATGCTCACGAACTCCGCCAGGCTGCATTCAAGCTCTATGCCTCTCTTGGAGCAAATGATGAAGACATC
CGGAAGAAGATCATTGAGACTGAAAATATGATGGACCGAATTGTGACTGGCTTGTCTGAGTCTAGTGTCAAGGTGCGGTTAGCTGCCGTC
AGATGTTTGCACAGTTTATCCAGATCTGTGCAGCAGCTTCGAACCAGTTTCCAGGATCATGCTGTTTGGAAACCTTTAATGAAGGTTTTA
CAAAATGCACCAGATGAAATCCTAGTGGTAGCATCTTCCATGCTGTGTAATCTTCTTCTTGAATTTTCTCCAAGCAAAGAGCCAATTTTG
GAATCAGGAGCCGTAGAGCTACTTTGTGGATTAACTCAGAGTGAAAATCCTGCTTTACGAGTGAATGGAATTTGGGCTTTAATGAATATG
GCATTTCAGGCTGAACAAAAAATAAAAGCAGATATTTTACGAAGCTTGAGTACTGAACAGCTATTCCGGTTATTATCAGATTCAGATTTG
AATGTGCTGATGAAGACATTGGGACTTCTTAGAAATCTCCTCTCCACTCGTCCTCATATAGATAAAATAATGAGTACTCATGGAAAGCAA
ATTATGCAAGCCGTCACTCTTATTCTAGAAGGGGAACATAACATTGAGGTCAAAGAGCAGACACTGTGCATCTTAGCCAACATAGCGGAT
GGGACAACAGCAAAAGATCTTATTATGACCAATGATGATATCCTACAGAAAATCAAGTATTACATGGGCCATTCACATGTTAAACTGCAG
CTTGCAGCCATGTTTTGTATATCAAACCTCATATGGAATGAAGAGGAAGGTTCACAAGAACGCCAGGATAAATTACGAGACATGGGCATC

>In-frame_FOXP1_ENST00000498215_chr3_71247353_-_ARMC8_ENST00000469044_chr3_137928659_+_2157nt
ATGATGCAAGAATCTGGGACTGAGACAAAAAGTAACGGTTCAGCCATCCAGAATGGGTCGGGCGGCAGCAACCACTTACTAGAGTGCGGC
GGTCTTCGGGAGGGGCGGTCCAACGGAGAGACGCCGGCCGTGGACATCGGGGCAGCTGACCTCGCCCACGCCCAGCAGCAGCAGCAACAG
GAAGTAACAGCTAGCAGTCGCCACTATGTTGACAGGCTATTTGACCCTGATCCCCAGAAAGTTCTACAAGGTGTCATAGACATGAAAAAT
GCTGTAATTGGAAACAACAAGCAGAAAGCCAATCTCATTGTTTTAGGAGCTGTTCCAAGATTGTTGTACTTGCTTCAGCAAGAAACCTCA
AGCACAGAGCTGAAAACTGAATGTGCAGTGGTGTTGGGAAGTCTTGCTATGGGTACTGAAAACAATGTCAAGTCTCTACTGGACTGCCAT
ATTATCCCTGCCTTATTGCAAGGACTACTGTCCCCAGACCTGAAGTTTATTGAAGCTTGCCTCCGATGCCTGCGTACCATCTTCACCAGT
CCTGTCACTCCAGAGGAGCTACTGTATACAGATGCCACAGTGATACCACACCTCATGGCACTGCTTAGCAGGTCCCGCTATACCCAGGAG
TACATCTGTCAGATCTTCTCACACTGCTGTAAAGGGCCAGATCATCAAACAATTTTATTTAACCACGGTGCAGTTCAGAATATTGCTCAC
CTACTAACCTCACTGTCCTACAAAGTTCGAATGCAAGCACTGAAATGTTTCTCAGTTTTAGCTTTTGAAAACCCCCAGGTATCGATGACC
CTGGTAAATGTTTTGGTTGATGGAGAATTGTTACCACAGATTTTTGTGAAGATGTTACAGAGGGATAAGCCTATTGAGATGCAGCTCACA
TCAGCAAAATGTTTAACTTACATGTGTAGAGCTGGAGCAATTCGGACAGATGATAACTGTATTGTATTAAAGACATTACCTTGTTTGGTT
CGAATGTGCAGTAAGGAGAGATTACTAGAGGAGAGAGTTGAAGGAGCTGAGACACTTGCCTATCTGATTGAACCAGATGTTGAGCTACAG
AGAATCGCTAGCATAACTGATCACCTCATTGCCATGCTTGCTGATTATTTCAAGTATCCCAGCTCAGTGAGTGCCATCACTGATATTAAA
AGGCTTGATCATGATTTAAAACATGCTCACGAACTCCGCCAGGCTGCATTCAAGCTCTATGCCTCTCTTGGAGCAAATGATGAAGACATC
CGGAAGAAGATCATTGAGACTGAAAATATGATGGACCGAATTGTGACTGGCTTGTCTGAGTCTAGTGTCAAGGTGCGGTTAGCTGCCGTC
AGATGTTTGCACAGTTTATCCAGATCTGTGCAGCAGCTTCGAACCAGTTTCCAGGATCATGCTGTTTGGAAACCTTTAATGAAGGTTTTA
CAAAATGCACCAGATGAAATCCTAGTGGTAGCATCTTCCATGCTGTGTAATCTTCTTCTTGAATTTTCTCCAAGCAAAGAGCCAATTTTG
GAATCAGGAGCCGTAGAGCTACTTTGTGGATTAACTCAGAGTGAAAATCCTGCTTTACGAGTGAATGGAATTTGGGCTTTAATGAATATG
GCATTTCAGGCTGAACAAAAAATAAAAGCAGATATTTTACGAAGCTTGAGTACTGAACAGCTATTCCGGTTATTATCAGATTCAGATTTG
AATGTGCTGATGAAGACATTGGGACTTCTTAGAAATCTCCTCTCCACTCGTCCTCATATAGATAAAATAATGAGTACTCATGGAAAGCAA
ATTATGCAAGCCGTCACTCTTATTCTAGAAGGGGAACATAACATTGAGGTCAAAGAGCAGACACTGTGCATCTTAGCCAACATAGCGGAT
GGGACAACAGCAAAAGATCTTATTATGACCAATGATGATATCCTACAGAAAATCAAGTATTACATGGGCCATTCACATGTTAAACTGCAG
CTTGCAGCCATGTTTTGTATATCAAACCTCATATGGAATGAAGAGGAAGGTTCACAAGAACGCCAGGATAAATTACGAGACATGGGCATC

>In-frame_FOXP1_ENST00000468577_chr3_71247353_-_ARMC8_ENST00000481646_chr3_137928659_+_2157nt
ATGATGCAAGAATCTGGGACTGAGACAAAAAGTAACGGTTCAGCCATCCAGAATGGGTCGGGCGGCAGCAACCACTTACTAGAGTGCGGC
GGTCTTCGGGAGGGGCGGTCCAACGGAGAGACGCCGGCCGTGGACATCGGGGCAGCTGACCTCGCCCACGCCCAGCAGCAGCAGCAACAG
GAAGTAACAGCTAGCAGTCGCCACTATGTTGACAGGCTATTTGACCCTGATCCCCAGAAAGTTCTACAAGGTGTCATAGACATGAAAAAT
GCTGTAATTGGAAACAACAAGCAGAAAGCCAATCTCATTGTTTTAGGAGCTGTTCCAAGATTGTTGTACTTGCTTCAGCAAGAAACCTCA
AGCACAGAGCTGAAAACTGAATGTGCAGTGGTGTTGGGAAGTCTTGCTATGGGTACTGAAAACAATGTCAAGTCTCTACTGGACTGCCAT
ATTATCCCTGCCTTATTGCAAGGACTACTGTCCCCAGACCTGAAGTTTATTGAAGCTTGCCTCCGATGCCTGCGTACCATCTTCACCAGT
CCTGTCACTCCAGAGGAGCTACTGTATACAGATGCCACAGTGATACCACACCTCATGGCACTGCTTAGCAGGTCCCGCTATACCCAGGAG
TACATCTGTCAGATCTTCTCACACTGCTGTAAAGGGCCAGATCATCAAACAATTTTATTTAACCACGGTGCAGTTCAGAATATTGCTCAC
CTACTAACCTCACTGTCCTACAAAGTTCGAATGCAAGCACTGAAATGTTTCTCAGTTTTAGCTTTTGAAAACCCCCAGGTATCGATGACC
CTGGTAAATGTTTTGGTTGATGGAGAATTGTTACCACAGATTTTTGTGAAGATGTTACAGAGGGATAAGCCTATTGAGATGCAGCTCACA
TCAGCAAAATGTTTAACTTACATGTGTAGAGCTGGAGCAATTCGGACAGATGATAACTGTATTGTATTAAAGACATTACCTTGTTTGGTT
CGAATGTGCAGTAAGGAGAGATTACTAGAGGAGAGAGTTGAAGGAGCTGAGACACTTGCCTATCTGATTGAACCAGATGTTGAGCTACAG
AGAATCGCTAGCATAACTGATCACCTCATTGCCATGCTTGCTGATTATTTCAAGTATCCCAGCTCAGTGAGTGCCATCACTGATATTAAA
AGGCTTGATCATGATTTAAAACATGCTCACGAACTCCGCCAGGCTGCATTCAAGCTCTATGCCTCTCTTGGAGCAAATGATGAAGACATC
CGGAAGAAGATCATTGAGACTGAAAATATGATGGACCGAATTGTGACTGGCTTGTCTGAGTCTAGTGTCAAGGTGCGGTTAGCTGCCGTC
AGATGTTTGCACAGTTTATCCAGATCTGTGCAGCAGCTTCGAACCAGTTTCCAGGATCATGCTGTTTGGAAACCTTTAATGAAGGTTTTA
CAAAATGCACCAGATGAAATCCTAGTGGTAGCATCTTCCATGCTGTGTAATCTTCTTCTTGAATTTTCTCCAAGCAAAGAGCCAATTTTG
GAATCAGGAGCCGTAGAGCTACTTTGTGGATTAACTCAGAGTGAAAATCCTGCTTTACGAGTGAATGGAATTTGGGCTTTAATGAATATG
GCATTTCAGGCTGAACAAAAAATAAAAGCAGATATTTTACGAAGCTTGAGTACTGAACAGCTATTCCGGTTATTATCAGATTCAGATTTG
AATGTGCTGATGAAGACATTGGGACTTCTTAGAAATCTCCTCTCCACTCGTCCTCATATAGATAAAATAATGAGTACTCATGGAAAGCAA
ATTATGCAAGCCGTCACTCTTATTCTAGAAGGGGAACATAACATTGAGGTCAAAGAGCAGACACTGTGCATCTTAGCCAACATAGCGGAT
GGGACAACAGCAAAAGATCTTATTATGACCAATGATGATATCCTACAGAAAATCAAGTATTACATGGGCCATTCACATGTTAAACTGCAG
CTTGCAGCCATGTTTTGTATATCAAACCTCATATGGAATGAAGAGGAAGGTTCACAAGAACGCCAGGATAAATTACGAGACATGGGCATC

>In-frame_FOXP1_ENST00000468577_chr3_71247353_-_ARMC8_ENST00000469044_chr3_137928659_+_2157nt
ATGATGCAAGAATCTGGGACTGAGACAAAAAGTAACGGTTCAGCCATCCAGAATGGGTCGGGCGGCAGCAACCACTTACTAGAGTGCGGC
GGTCTTCGGGAGGGGCGGTCCAACGGAGAGACGCCGGCCGTGGACATCGGGGCAGCTGACCTCGCCCACGCCCAGCAGCAGCAGCAACAG
GAAGTAACAGCTAGCAGTCGCCACTATGTTGACAGGCTATTTGACCCTGATCCCCAGAAAGTTCTACAAGGTGTCATAGACATGAAAAAT
GCTGTAATTGGAAACAACAAGCAGAAAGCCAATCTCATTGTTTTAGGAGCTGTTCCAAGATTGTTGTACTTGCTTCAGCAAGAAACCTCA
AGCACAGAGCTGAAAACTGAATGTGCAGTGGTGTTGGGAAGTCTTGCTATGGGTACTGAAAACAATGTCAAGTCTCTACTGGACTGCCAT
ATTATCCCTGCCTTATTGCAAGGACTACTGTCCCCAGACCTGAAGTTTATTGAAGCTTGCCTCCGATGCCTGCGTACCATCTTCACCAGT
CCTGTCACTCCAGAGGAGCTACTGTATACAGATGCCACAGTGATACCACACCTCATGGCACTGCTTAGCAGGTCCCGCTATACCCAGGAG
TACATCTGTCAGATCTTCTCACACTGCTGTAAAGGGCCAGATCATCAAACAATTTTATTTAACCACGGTGCAGTTCAGAATATTGCTCAC
CTACTAACCTCACTGTCCTACAAAGTTCGAATGCAAGCACTGAAATGTTTCTCAGTTTTAGCTTTTGAAAACCCCCAGGTATCGATGACC
CTGGTAAATGTTTTGGTTGATGGAGAATTGTTACCACAGATTTTTGTGAAGATGTTACAGAGGGATAAGCCTATTGAGATGCAGCTCACA
TCAGCAAAATGTTTAACTTACATGTGTAGAGCTGGAGCAATTCGGACAGATGATAACTGTATTGTATTAAAGACATTACCTTGTTTGGTT
CGAATGTGCAGTAAGGAGAGATTACTAGAGGAGAGAGTTGAAGGAGCTGAGACACTTGCCTATCTGATTGAACCAGATGTTGAGCTACAG
AGAATCGCTAGCATAACTGATCACCTCATTGCCATGCTTGCTGATTATTTCAAGTATCCCAGCTCAGTGAGTGCCATCACTGATATTAAA
AGGCTTGATCATGATTTAAAACATGCTCACGAACTCCGCCAGGCTGCATTCAAGCTCTATGCCTCTCTTGGAGCAAATGATGAAGACATC
CGGAAGAAGATCATTGAGACTGAAAATATGATGGACCGAATTGTGACTGGCTTGTCTGAGTCTAGTGTCAAGGTGCGGTTAGCTGCCGTC
AGATGTTTGCACAGTTTATCCAGATCTGTGCAGCAGCTTCGAACCAGTTTCCAGGATCATGCTGTTTGGAAACCTTTAATGAAGGTTTTA
CAAAATGCACCAGATGAAATCCTAGTGGTAGCATCTTCCATGCTGTGTAATCTTCTTCTTGAATTTTCTCCAAGCAAAGAGCCAATTTTG
GAATCAGGAGCCGTAGAGCTACTTTGTGGATTAACTCAGAGTGAAAATCCTGCTTTACGAGTGAATGGAATTTGGGCTTTAATGAATATG
GCATTTCAGGCTGAACAAAAAATAAAAGCAGATATTTTACGAAGCTTGAGTACTGAACAGCTATTCCGGTTATTATCAGATTCAGATTTG
AATGTGCTGATGAAGACATTGGGACTTCTTAGAAATCTCCTCTCCACTCGTCCTCATATAGATAAAATAATGAGTACTCATGGAAAGCAA
ATTATGCAAGCCGTCACTCTTATTCTAGAAGGGGAACATAACATTGAGGTCAAAGAGCAGACACTGTGCATCTTAGCCAACATAGCGGAT
GGGACAACAGCAAAAGATCTTATTATGACCAATGATGATATCCTACAGAAAATCAAGTATTACATGGGCCATTCACATGTTAAACTGCAG
CTTGCAGCCATGTTTTGTATATCAAACCTCATATGGAATGAAGAGGAAGGTTCACAAGAACGCCAGGATAAATTACGAGACATGGGCATC


* Fusion transcript sequences (Full-length transcript).
>In-frame_FOXP1_ENST00000475937_chr3_71247353_-_ARMC8_ENST00000481646_chr3_137928659_+_3245nt
ATCACAGCTTGGTGCTGGGGCTCAGCATGGCCAGGTGGCTAACCAGGGCTTGGTGTCAACTACATTTGGGATGATGACACTTGGAGGACA
CAGAGCCACTGTGCAGCAGGAGTCGCCACTGCTAACAGCCAGAGTGTCCCAGAAGCTTTTGTTGACAATTCCAGTTTCCGAACAAAACAT
TTCGGCAATGGTGAGGGCTTCGATCCCTTCTCTGATTTGCTGTCAGCCATGAACGGATGGATGTGATGCCTGCTAGCCAAAAGGCTTCCC
TCTGTGTGTTGCAGTCCTGTGGCATTATGCATGCCCCCTCCCAGTGACCCCAGGCTTTTTATGGCTGTGAGACACGTTAAAATTTCAGGG
GTAAGACGTGACCTTTTGAGGTGACTATAACTGAAGATTGCTTTACAGAAGCCAAAAAAGGTTTTTGAGTCATGATGCAAGAATCTGGGA
CTGAGACAAAAAGTAACGGTTCAGCCATCCAGAATGGGTCGGGCGGCAGCAACCACTTACTAGAGTGCGGCGGTCTTCGGGAGGGGCGGT
CCAACGGAGAGACGCCGGCCGTGGACATCGGGGCAGCTGACCTCGCCCACGCCCAGCAGCAGCAGCAACAGGAAGTAACAGCTAGCAGTC
GCCACTATGTTGACAGGCTATTTGACCCTGATCCCCAGAAAGTTCTACAAGGTGTCATAGACATGAAAAATGCTGTAATTGGAAACAACA
AGCAGAAAGCCAATCTCATTGTTTTAGGAGCTGTTCCAAGATTGTTGTACTTGCTTCAGCAAGAAACCTCAAGCACAGAGCTGAAAACTG
AATGTGCAGTGGTGTTGGGAAGTCTTGCTATGGGTACTGAAAACAATGTCAAGTCTCTACTGGACTGCCATATTATCCCTGCCTTATTGC
AAGGACTACTGTCCCCAGACCTGAAGTTTATTGAAGCTTGCCTCCGATGCCTGCGTACCATCTTCACCAGTCCTGTCACTCCAGAGGAGC
TACTGTATACAGATGCCACAGTGATACCACACCTCATGGCACTGCTTAGCAGGTCCCGCTATACCCAGGAGTACATCTGTCAGATCTTCT
CACACTGCTGTAAAGGGCCAGATCATCAAACAATTTTATTTAACCACGGTGCAGTTCAGAATATTGCTCACCTACTAACCTCACTGTCCT
ACAAAGTTCGAATGCAAGCACTGAAATGTTTCTCAGTTTTAGCTTTTGAAAACCCCCAGGTATCGATGACCCTGGTAAATGTTTTGGTTG
ATGGAGAATTGTTACCACAGATTTTTGTGAAGATGTTACAGAGGGATAAGCCTATTGAGATGCAGCTCACATCAGCAAAATGTTTAACTT
ACATGTGTAGAGCTGGAGCAATTCGGACAGATGATAACTGTATTGTATTAAAGACATTACCTTGTTTGGTTCGAATGTGCAGTAAGGAGA
GATTACTAGAGGAGAGAGTTGAAGGAGCTGAGACACTTGCCTATCTGATTGAACCAGATGTTGAGCTACAGAGAATCGCTAGCATAACTG
ATCACCTCATTGCCATGCTTGCTGATTATTTCAAGTATCCCAGCTCAGTGAGTGCCATCACTGATATTAAAAGGCTTGATCATGATTTAA
AACATGCTCACGAACTCCGCCAGGCTGCATTCAAGCTCTATGCCTCTCTTGGAGCAAATGATGAAGACATCCGGAAGAAGATCATTGAGA
CTGAAAATATGATGGACCGAATTGTGACTGGCTTGTCTGAGTCTAGTGTCAAGGTGCGGTTAGCTGCCGTCAGATGTTTGCACAGTTTAT
CCAGATCTGTGCAGCAGCTTCGAACCAGTTTCCAGGATCATGCTGTTTGGAAACCTTTAATGAAGGTTTTACAAAATGCACCAGATGAAA
TCCTAGTGGTAGCATCTTCCATGCTGTGTAATCTTCTTCTTGAATTTTCTCCAAGCAAAGAGCCAATTTTGGAATCAGGAGCCGTAGAGC
TACTTTGTGGATTAACTCAGAGTGAAAATCCTGCTTTACGAGTGAATGGAATTTGGGCTTTAATGAATATGGCATTTCAGGCTGAACAAA
AAATAAAAGCAGATATTTTACGAAGCTTGAGTACTGAACAGCTATTCCGGTTATTATCAGATTCAGATTTGAATGTGCTGATGAAGACAT
TGGGACTTCTTAGAAATCTCCTCTCCACTCGTCCTCATATAGATAAAATAATGAGTACTCATGGAAAGCAAATTATGCAAGCCGTCACTC
TTATTCTAGAAGGGGAACATAACATTGAGGTCAAAGAGCAGACACTGTGCATCTTAGCCAACATAGCGGATGGGACAACAGCAAAAGATC
TTATTATGACCAATGATGATATCCTACAGAAAATCAAGTATTACATGGGCCATTCACATGTTAAACTGCAGCTTGCAGCCATGTTTTGTA
TATCAAACCTCATATGGAATGAAGAGGAAGGTTCACAAGAACGCCAGGATAAATTACGAGACATGGGCATCGTAGATATTCTACACAAAC
TGAGTCAGTCACCAGATTCAAACCTTTGTGACAAGGCAAAGATGGCACTGCAGCAGTACCTGGCATGATGGGAGTGCCCCTGGGCACCTG
CGAGCATCCCACCTCCTTGTTTAAGGAAGTACAGGAACCAGCCTCATTTGATTCCTTCTATTTGCACAAGTCACCTTGGACTGCAGGGAG
CTGTTTTGCAAAAGCAGTTTAGTAGGCTTAGATCTCAAATTCATCTTGAGAACATTTTTTTGAGGTAGTAATTTCCTCAGAAGACTCTTG
TGTTTTGTTTTGGTTTTTTTTTCTGAGCTACTCGGACTCTTTATTAGAACAATCAATCATTTTCCTTTGGACCTACAATTTTTGCCTATG
CTGCAGCCACTTTGTGAGTGAGAATGAATATGTCTGTGTGAACACACAGGCATGCGTGTGTATGTGCACGTACATGGGCCAGAATGAATG
GATGTGTGTGTGTGAGGGATACCTCAGATTTTTCTTTTCTTATTTTGTGTGAAAATCTCTTTTCTACAGATTTTCCAGGGTTTAAGCATT
GCTTGCTGTATAAAAAACTTTACTGAATTATATACAGTTTGAATGAAATGTTATTTTAAAAACAAAACAATTGTTAAGTGTTCCATAAAG
GTTATGTTGAATTTTGGTCAGATGAATATTTGTAAGTAAAAAATATATGCATTTCTGAACCTCAACTTACATAGATTTTCTTTATATAAA

>In-frame_FOXP1_ENST00000475937_chr3_71247353_-_ARMC8_ENST00000469044_chr3_137928659_+_5085nt
ATCACAGCTTGGTGCTGGGGCTCAGCATGGCCAGGTGGCTAACCAGGGCTTGGTGTCAACTACATTTGGGATGATGACACTTGGAGGACA
CAGAGCCACTGTGCAGCAGGAGTCGCCACTGCTAACAGCCAGAGTGTCCCAGAAGCTTTTGTTGACAATTCCAGTTTCCGAACAAAACAT
TTCGGCAATGGTGAGGGCTTCGATCCCTTCTCTGATTTGCTGTCAGCCATGAACGGATGGATGTGATGCCTGCTAGCCAAAAGGCTTCCC
TCTGTGTGTTGCAGTCCTGTGGCATTATGCATGCCCCCTCCCAGTGACCCCAGGCTTTTTATGGCTGTGAGACACGTTAAAATTTCAGGG
GTAAGACGTGACCTTTTGAGGTGACTATAACTGAAGATTGCTTTACAGAAGCCAAAAAAGGTTTTTGAGTCATGATGCAAGAATCTGGGA
CTGAGACAAAAAGTAACGGTTCAGCCATCCAGAATGGGTCGGGCGGCAGCAACCACTTACTAGAGTGCGGCGGTCTTCGGGAGGGGCGGT
CCAACGGAGAGACGCCGGCCGTGGACATCGGGGCAGCTGACCTCGCCCACGCCCAGCAGCAGCAGCAACAGGAAGTAACAGCTAGCAGTC
GCCACTATGTTGACAGGCTATTTGACCCTGATCCCCAGAAAGTTCTACAAGGTGTCATAGACATGAAAAATGCTGTAATTGGAAACAACA
AGCAGAAAGCCAATCTCATTGTTTTAGGAGCTGTTCCAAGATTGTTGTACTTGCTTCAGCAAGAAACCTCAAGCACAGAGCTGAAAACTG
AATGTGCAGTGGTGTTGGGAAGTCTTGCTATGGGTACTGAAAACAATGTCAAGTCTCTACTGGACTGCCATATTATCCCTGCCTTATTGC
AAGGACTACTGTCCCCAGACCTGAAGTTTATTGAAGCTTGCCTCCGATGCCTGCGTACCATCTTCACCAGTCCTGTCACTCCAGAGGAGC
TACTGTATACAGATGCCACAGTGATACCACACCTCATGGCACTGCTTAGCAGGTCCCGCTATACCCAGGAGTACATCTGTCAGATCTTCT
CACACTGCTGTAAAGGGCCAGATCATCAAACAATTTTATTTAACCACGGTGCAGTTCAGAATATTGCTCACCTACTAACCTCACTGTCCT
ACAAAGTTCGAATGCAAGCACTGAAATGTTTCTCAGTTTTAGCTTTTGAAAACCCCCAGGTATCGATGACCCTGGTAAATGTTTTGGTTG
ATGGAGAATTGTTACCACAGATTTTTGTGAAGATGTTACAGAGGGATAAGCCTATTGAGATGCAGCTCACATCAGCAAAATGTTTAACTT
ACATGTGTAGAGCTGGAGCAATTCGGACAGATGATAACTGTATTGTATTAAAGACATTACCTTGTTTGGTTCGAATGTGCAGTAAGGAGA
GATTACTAGAGGAGAGAGTTGAAGGAGCTGAGACACTTGCCTATCTGATTGAACCAGATGTTGAGCTACAGAGAATCGCTAGCATAACTG
ATCACCTCATTGCCATGCTTGCTGATTATTTCAAGTATCCCAGCTCAGTGAGTGCCATCACTGATATTAAAAGGCTTGATCATGATTTAA
AACATGCTCACGAACTCCGCCAGGCTGCATTCAAGCTCTATGCCTCTCTTGGAGCAAATGATGAAGACATCCGGAAGAAGATCATTGAGA
CTGAAAATATGATGGACCGAATTGTGACTGGCTTGTCTGAGTCTAGTGTCAAGGTGCGGTTAGCTGCCGTCAGATGTTTGCACAGTTTAT
CCAGATCTGTGCAGCAGCTTCGAACCAGTTTCCAGGATCATGCTGTTTGGAAACCTTTAATGAAGGTTTTACAAAATGCACCAGATGAAA
TCCTAGTGGTAGCATCTTCCATGCTGTGTAATCTTCTTCTTGAATTTTCTCCAAGCAAAGAGCCAATTTTGGAATCAGGAGCCGTAGAGC
TACTTTGTGGATTAACTCAGAGTGAAAATCCTGCTTTACGAGTGAATGGAATTTGGGCTTTAATGAATATGGCATTTCAGGCTGAACAAA
AAATAAAAGCAGATATTTTACGAAGCTTGAGTACTGAACAGCTATTCCGGTTATTATCAGATTCAGATTTGAATGTGCTGATGAAGACAT
TGGGACTTCTTAGAAATCTCCTCTCCACTCGTCCTCATATAGATAAAATAATGAGTACTCATGGAAAGCAAATTATGCAAGCCGTCACTC
TTATTCTAGAAGGGGAACATAACATTGAGGTCAAAGAGCAGACACTGTGCATCTTAGCCAACATAGCGGATGGGACAACAGCAAAAGATC
TTATTATGACCAATGATGATATCCTACAGAAAATCAAGTATTACATGGGCCATTCACATGTTAAACTGCAGCTTGCAGCCATGTTTTGTA
TATCAAACCTCATATGGAATGAAGAGGAAGGTTCACAAGAACGCCAGGATAAATTACGAGACATGGGCATCGTAGATATTCTACACAAAC
TGAGTCAGTCACCAGATTCAAACCTTTGTGACAAGGCAAAGATGGCACTGCAGCAGTACCTGGCATGATGGGAGTGCCCCTGGGCACCTG
CGAGCATCCCACCTCCTTGTTTAAGGAAGTACAGGAACCAGCCTCATTTGATTCCTTCTATTTGCACAAGTCACCTTGGACTGCAGGGAG
CTGTTTTGCAAAAGCAGTTTAGTAGGCTTAGATCTCAAATTCATCTTGAGAACATTTTTTTGAGGTAGTAATTTCCTCAGAAGACTCTTG
TGTTTTGTTTTGGTTTTTTTTTCTGAGCTACTCGGACTCTTTATTAGAACAATCAATCATTTTCCTTTGGACCTACAATTTTTGCCTATG
CTGCAGCCACTTTGTGAGTGAGAATGAATATGTCTGTGTGAACACACAGGCATGCGTGTGTATGTGCACGTACATGGGCCAGAATGAATG
GATGTGTGTGTGTGAGGGATACCTCAGATTTTTCTTTTCTTATTTTGTGTGAAAATCTCTTTTCTACAGATTTTCCAGGGTTTAAGCATT
GCTTGCTGTATAAAAAACTTTACTGAATTATATACAGTTTGAATGAAATGTTATTTTAAAAACAAAACAATTGTTAAGTGTTCCATAAAG
GTTATGTTGAATTTTGGTCAGATGAATATTTGTAAGTAAAAAATATATGCATTTCTGAACCTCAACTTACATAGATTTTCTTTATATAAA
AAAAAAGAAAAAAAAAGAAAAAGTTGGCTATAGTTGGCCTGATTAACAGGCACTATACATGGTGCTGTGCAAAATAGTAAGCTAGCATCT
TACTGCCGTCAATATTAGCAGGTACAGAGCCTTTTTTCATCCTAATTCAGTAAGTTCTCAGGCTTCCAAGTCAAATGGAGAAGTAAAGTG
AGGCAACAGATTCACCATAGGCTTTTTGAAGCATCAAAGGGAAATATAACTACTGATAGTGAAAGCCCAGCCATGACCCAGATGGGCTTA
CCCTTGACAGGAACTGGGGACCAAGAGCCTCCCAATTGCCCTAACTCCTGTCATTGGTATTAGCAATATCTGGCCAGATTTAGAACCAGT
CATGGAAACTTGTGCTCAAACTAAAAGTAGGTCATCACTTCCCAGAAACAGAATACCTTGTGCTTCCTGAAACAGCATATATCACTGTGA
AACTAAAGAATATTCTACAGACACCCCTGTAGAAAGAAACAAAGAACAGGATAGTTTAGAAAGCTTTCTGTTAGCTGTATTCAGCAAATT
TCATACTAGTTGCTCAGGACTGCTAGTTGGTATGCTTTTGTAAAACGAGATTGAAATTTAATAAAAGATGCAACTAAAATCTTTCCTGCA
TGAAGCTAAAAGCACTCAAGTTGAGAGAGGGGCAAGGGAATCTCCCCAGGATGACTGAAGATGACTTCTTTTTACAGCAAGTACTGTTAG
CCTTTCTGCACCCCTTAGCTTGGCCCCTGCTCCAACTTCTGGGTCAGCAGCAAGGTGAACTCAACAGAAGTTGCTCTTGACTGTTTGAAG
GTAGAAGCAGCCTACCTTTTCTCTTTGCTAAAAGAAGGTCAAAGGCTTCGCAACCAGGATGCAAGGTCTGCGGTCCAGAAGCTTGCGGTG
AGTGTGTGCCACTGATGGAGCTCCAAGCCCACCCACCAGCCACTCCTGATGGGGTTGCTCACACTGCAGCTGCCCTATCACCACCCTGCA
CGTTCCTTGGAAGATTTAAATGTTTGGTTGCAAATGAATGTTTTAAAAATGTATTTAATGCAATTTTTCCTGCTCTCAACATGACCACCC
AAGATTCAAACACAGAGACTTCCAAGTTACTATTTTTTCAGAACATCACCGATTTTAAAATCTGTCACAACAGGACTTGGTTTTGTGCAG
ATATCAGAGTGCTAATGTGAGAAACCCAGTTAAAAGAAAACTTAGTTTATTGGGAAGAAAGCCTCAGGCCCACTCGTTTCTAGAACTGTG
AAAATATCCTTGGTTGGCATTTTTAACACAAAACACTATAGTGTTGGTATTAAATAGTACTAGGTAAATATAAAGAAACCAATAATGAAT
TGCTGAGACAATCTTGAACCCAAATAGCATTAGAAAGCTGAAGGCCCAATGAAATAACACTTTCACACTTAAACTCTGTGGATAAATTTT
GCCTGTGGGTATAAACAGATGGTCAAATTAAAAATGCTTTACTATAATTAACTTTTCTGATTTGAATGAAGGGAAATGTATTTATTGAAA
CAAAGCTGTTTGCTGCTTTATGCAGGTGCAGTGTTCAGTCAGCAAGGAAGTGGGAAGAGTGGACATGGTATTGTGTCTACACCCAAGTTC
TTAACTAAGCTTCTCGCTCTAATACTGCATTCTGTTTCTCCTTTTGTGCCCTGATTGTAATCCAAAATTTATGAACTAGAAAAGAATGTC
CAATTTAATAAGTTGCATTTTTTTTTCTTTAAGCACTTTATTCAGAACAATACATGTTCTTCTGGTAGTGTTTGGATAATATGATTTTAA

>In-frame_FOXP1_ENST00000498215_chr3_71247353_-_ARMC8_ENST00000481646_chr3_137928659_+_3137nt
AGACAATAAGAAACAAACGGTACAACTCCACAAAAGGCTTCCCGGAAAATAAGTGTCAAATAAATCCTACGGAACTCTCGCTTCTGCCAC
TGAGCTCTGTATATGCAAACCTGTTTTTATGCCATCGCTTCCCCAGGCTGAGCTGCGTTTGTTTGGAAATGTAAGCCACTGCCTTTTCTT
TTTTTCTTTTTTCCTTTTTTTTTTTTCCCCCCTCACTTCATCTGAGGGCTCTGGATTAATTCCTTGAGACATATCTTTGCATACATATCT
CATGAGTTATGTTTCCTGGAGCCTTTTACTAGGAACATTAAGGTTTTTGAGTCATGATGCAAGAATCTGGGACTGAGACAAAAAGTAACG
GTTCAGCCATCCAGAATGGGTCGGGCGGCAGCAACCACTTACTAGAGTGCGGCGGTCTTCGGGAGGGGCGGTCCAACGGAGAGACGCCGG
CCGTGGACATCGGGGCAGCTGACCTCGCCCACGCCCAGCAGCAGCAGCAACAGGAAGTAACAGCTAGCAGTCGCCACTATGTTGACAGGC
TATTTGACCCTGATCCCCAGAAAGTTCTACAAGGTGTCATAGACATGAAAAATGCTGTAATTGGAAACAACAAGCAGAAAGCCAATCTCA
TTGTTTTAGGAGCTGTTCCAAGATTGTTGTACTTGCTTCAGCAAGAAACCTCAAGCACAGAGCTGAAAACTGAATGTGCAGTGGTGTTGG
GAAGTCTTGCTATGGGTACTGAAAACAATGTCAAGTCTCTACTGGACTGCCATATTATCCCTGCCTTATTGCAAGGACTACTGTCCCCAG
ACCTGAAGTTTATTGAAGCTTGCCTCCGATGCCTGCGTACCATCTTCACCAGTCCTGTCACTCCAGAGGAGCTACTGTATACAGATGCCA
CAGTGATACCACACCTCATGGCACTGCTTAGCAGGTCCCGCTATACCCAGGAGTACATCTGTCAGATCTTCTCACACTGCTGTAAAGGGC
CAGATCATCAAACAATTTTATTTAACCACGGTGCAGTTCAGAATATTGCTCACCTACTAACCTCACTGTCCTACAAAGTTCGAATGCAAG
CACTGAAATGTTTCTCAGTTTTAGCTTTTGAAAACCCCCAGGTATCGATGACCCTGGTAAATGTTTTGGTTGATGGAGAATTGTTACCAC
AGATTTTTGTGAAGATGTTACAGAGGGATAAGCCTATTGAGATGCAGCTCACATCAGCAAAATGTTTAACTTACATGTGTAGAGCTGGAG
CAATTCGGACAGATGATAACTGTATTGTATTAAAGACATTACCTTGTTTGGTTCGAATGTGCAGTAAGGAGAGATTACTAGAGGAGAGAG
TTGAAGGAGCTGAGACACTTGCCTATCTGATTGAACCAGATGTTGAGCTACAGAGAATCGCTAGCATAACTGATCACCTCATTGCCATGC
TTGCTGATTATTTCAAGTATCCCAGCTCAGTGAGTGCCATCACTGATATTAAAAGGCTTGATCATGATTTAAAACATGCTCACGAACTCC
GCCAGGCTGCATTCAAGCTCTATGCCTCTCTTGGAGCAAATGATGAAGACATCCGGAAGAAGATCATTGAGACTGAAAATATGATGGACC
GAATTGTGACTGGCTTGTCTGAGTCTAGTGTCAAGGTGCGGTTAGCTGCCGTCAGATGTTTGCACAGTTTATCCAGATCTGTGCAGCAGC
TTCGAACCAGTTTCCAGGATCATGCTGTTTGGAAACCTTTAATGAAGGTTTTACAAAATGCACCAGATGAAATCCTAGTGGTAGCATCTT
CCATGCTGTGTAATCTTCTTCTTGAATTTTCTCCAAGCAAAGAGCCAATTTTGGAATCAGGAGCCGTAGAGCTACTTTGTGGATTAACTC
AGAGTGAAAATCCTGCTTTACGAGTGAATGGAATTTGGGCTTTAATGAATATGGCATTTCAGGCTGAACAAAAAATAAAAGCAGATATTT
TACGAAGCTTGAGTACTGAACAGCTATTCCGGTTATTATCAGATTCAGATTTGAATGTGCTGATGAAGACATTGGGACTTCTTAGAAATC
TCCTCTCCACTCGTCCTCATATAGATAAAATAATGAGTACTCATGGAAAGCAAATTATGCAAGCCGTCACTCTTATTCTAGAAGGGGAAC
ATAACATTGAGGTCAAAGAGCAGACACTGTGCATCTTAGCCAACATAGCGGATGGGACAACAGCAAAAGATCTTATTATGACCAATGATG
ATATCCTACAGAAAATCAAGTATTACATGGGCCATTCACATGTTAAACTGCAGCTTGCAGCCATGTTTTGTATATCAAACCTCATATGGA
ATGAAGAGGAAGGTTCACAAGAACGCCAGGATAAATTACGAGACATGGGCATCGTAGATATTCTACACAAACTGAGTCAGTCACCAGATT
CAAACCTTTGTGACAAGGCAAAGATGGCACTGCAGCAGTACCTGGCATGATGGGAGTGCCCCTGGGCACCTGCGAGCATCCCACCTCCTT
GTTTAAGGAAGTACAGGAACCAGCCTCATTTGATTCCTTCTATTTGCACAAGTCACCTTGGACTGCAGGGAGCTGTTTTGCAAAAGCAGT
TTAGTAGGCTTAGATCTCAAATTCATCTTGAGAACATTTTTTTGAGGTAGTAATTTCCTCAGAAGACTCTTGTGTTTTGTTTTGGTTTTT
TTTTCTGAGCTACTCGGACTCTTTATTAGAACAATCAATCATTTTCCTTTGGACCTACAATTTTTGCCTATGCTGCAGCCACTTTGTGAG
TGAGAATGAATATGTCTGTGTGAACACACAGGCATGCGTGTGTATGTGCACGTACATGGGCCAGAATGAATGGATGTGTGTGTGTGAGGG
ATACCTCAGATTTTTCTTTTCTTATTTTGTGTGAAAATCTCTTTTCTACAGATTTTCCAGGGTTTAAGCATTGCTTGCTGTATAAAAAAC
TTTACTGAATTATATACAGTTTGAATGAAATGTTATTTTAAAAACAAAACAATTGTTAAGTGTTCCATAAAGGTTATGTTGAATTTTGGT

>In-frame_FOXP1_ENST00000498215_chr3_71247353_-_ARMC8_ENST00000469044_chr3_137928659_+_4977nt
AGACAATAAGAAACAAACGGTACAACTCCACAAAAGGCTTCCCGGAAAATAAGTGTCAAATAAATCCTACGGAACTCTCGCTTCTGCCAC
TGAGCTCTGTATATGCAAACCTGTTTTTATGCCATCGCTTCCCCAGGCTGAGCTGCGTTTGTTTGGAAATGTAAGCCACTGCCTTTTCTT
TTTTTCTTTTTTCCTTTTTTTTTTTTCCCCCCTCACTTCATCTGAGGGCTCTGGATTAATTCCTTGAGACATATCTTTGCATACATATCT
CATGAGTTATGTTTCCTGGAGCCTTTTACTAGGAACATTAAGGTTTTTGAGTCATGATGCAAGAATCTGGGACTGAGACAAAAAGTAACG
GTTCAGCCATCCAGAATGGGTCGGGCGGCAGCAACCACTTACTAGAGTGCGGCGGTCTTCGGGAGGGGCGGTCCAACGGAGAGACGCCGG
CCGTGGACATCGGGGCAGCTGACCTCGCCCACGCCCAGCAGCAGCAGCAACAGGAAGTAACAGCTAGCAGTCGCCACTATGTTGACAGGC
TATTTGACCCTGATCCCCAGAAAGTTCTACAAGGTGTCATAGACATGAAAAATGCTGTAATTGGAAACAACAAGCAGAAAGCCAATCTCA
TTGTTTTAGGAGCTGTTCCAAGATTGTTGTACTTGCTTCAGCAAGAAACCTCAAGCACAGAGCTGAAAACTGAATGTGCAGTGGTGTTGG
GAAGTCTTGCTATGGGTACTGAAAACAATGTCAAGTCTCTACTGGACTGCCATATTATCCCTGCCTTATTGCAAGGACTACTGTCCCCAG
ACCTGAAGTTTATTGAAGCTTGCCTCCGATGCCTGCGTACCATCTTCACCAGTCCTGTCACTCCAGAGGAGCTACTGTATACAGATGCCA
CAGTGATACCACACCTCATGGCACTGCTTAGCAGGTCCCGCTATACCCAGGAGTACATCTGTCAGATCTTCTCACACTGCTGTAAAGGGC
CAGATCATCAAACAATTTTATTTAACCACGGTGCAGTTCAGAATATTGCTCACCTACTAACCTCACTGTCCTACAAAGTTCGAATGCAAG
CACTGAAATGTTTCTCAGTTTTAGCTTTTGAAAACCCCCAGGTATCGATGACCCTGGTAAATGTTTTGGTTGATGGAGAATTGTTACCAC
AGATTTTTGTGAAGATGTTACAGAGGGATAAGCCTATTGAGATGCAGCTCACATCAGCAAAATGTTTAACTTACATGTGTAGAGCTGGAG
CAATTCGGACAGATGATAACTGTATTGTATTAAAGACATTACCTTGTTTGGTTCGAATGTGCAGTAAGGAGAGATTACTAGAGGAGAGAG
TTGAAGGAGCTGAGACACTTGCCTATCTGATTGAACCAGATGTTGAGCTACAGAGAATCGCTAGCATAACTGATCACCTCATTGCCATGC
TTGCTGATTATTTCAAGTATCCCAGCTCAGTGAGTGCCATCACTGATATTAAAAGGCTTGATCATGATTTAAAACATGCTCACGAACTCC
GCCAGGCTGCATTCAAGCTCTATGCCTCTCTTGGAGCAAATGATGAAGACATCCGGAAGAAGATCATTGAGACTGAAAATATGATGGACC
GAATTGTGACTGGCTTGTCTGAGTCTAGTGTCAAGGTGCGGTTAGCTGCCGTCAGATGTTTGCACAGTTTATCCAGATCTGTGCAGCAGC
TTCGAACCAGTTTCCAGGATCATGCTGTTTGGAAACCTTTAATGAAGGTTTTACAAAATGCACCAGATGAAATCCTAGTGGTAGCATCTT
CCATGCTGTGTAATCTTCTTCTTGAATTTTCTCCAAGCAAAGAGCCAATTTTGGAATCAGGAGCCGTAGAGCTACTTTGTGGATTAACTC
AGAGTGAAAATCCTGCTTTACGAGTGAATGGAATTTGGGCTTTAATGAATATGGCATTTCAGGCTGAACAAAAAATAAAAGCAGATATTT
TACGAAGCTTGAGTACTGAACAGCTATTCCGGTTATTATCAGATTCAGATTTGAATGTGCTGATGAAGACATTGGGACTTCTTAGAAATC
TCCTCTCCACTCGTCCTCATATAGATAAAATAATGAGTACTCATGGAAAGCAAATTATGCAAGCCGTCACTCTTATTCTAGAAGGGGAAC
ATAACATTGAGGTCAAAGAGCAGACACTGTGCATCTTAGCCAACATAGCGGATGGGACAACAGCAAAAGATCTTATTATGACCAATGATG
ATATCCTACAGAAAATCAAGTATTACATGGGCCATTCACATGTTAAACTGCAGCTTGCAGCCATGTTTTGTATATCAAACCTCATATGGA
ATGAAGAGGAAGGTTCACAAGAACGCCAGGATAAATTACGAGACATGGGCATCGTAGATATTCTACACAAACTGAGTCAGTCACCAGATT
CAAACCTTTGTGACAAGGCAAAGATGGCACTGCAGCAGTACCTGGCATGATGGGAGTGCCCCTGGGCACCTGCGAGCATCCCACCTCCTT
GTTTAAGGAAGTACAGGAACCAGCCTCATTTGATTCCTTCTATTTGCACAAGTCACCTTGGACTGCAGGGAGCTGTTTTGCAAAAGCAGT
TTAGTAGGCTTAGATCTCAAATTCATCTTGAGAACATTTTTTTGAGGTAGTAATTTCCTCAGAAGACTCTTGTGTTTTGTTTTGGTTTTT
TTTTCTGAGCTACTCGGACTCTTTATTAGAACAATCAATCATTTTCCTTTGGACCTACAATTTTTGCCTATGCTGCAGCCACTTTGTGAG
TGAGAATGAATATGTCTGTGTGAACACACAGGCATGCGTGTGTATGTGCACGTACATGGGCCAGAATGAATGGATGTGTGTGTGTGAGGG
ATACCTCAGATTTTTCTTTTCTTATTTTGTGTGAAAATCTCTTTTCTACAGATTTTCCAGGGTTTAAGCATTGCTTGCTGTATAAAAAAC
TTTACTGAATTATATACAGTTTGAATGAAATGTTATTTTAAAAACAAAACAATTGTTAAGTGTTCCATAAAGGTTATGTTGAATTTTGGT
CAGATGAATATTTGTAAGTAAAAAATATATGCATTTCTGAACCTCAACTTACATAGATTTTCTTTATATAAAAAAAAAGAAAAAAAAAGA
AAAAGTTGGCTATAGTTGGCCTGATTAACAGGCACTATACATGGTGCTGTGCAAAATAGTAAGCTAGCATCTTACTGCCGTCAATATTAG
CAGGTACAGAGCCTTTTTTCATCCTAATTCAGTAAGTTCTCAGGCTTCCAAGTCAAATGGAGAAGTAAAGTGAGGCAACAGATTCACCAT
AGGCTTTTTGAAGCATCAAAGGGAAATATAACTACTGATAGTGAAAGCCCAGCCATGACCCAGATGGGCTTACCCTTGACAGGAACTGGG
GACCAAGAGCCTCCCAATTGCCCTAACTCCTGTCATTGGTATTAGCAATATCTGGCCAGATTTAGAACCAGTCATGGAAACTTGTGCTCA
AACTAAAAGTAGGTCATCACTTCCCAGAAACAGAATACCTTGTGCTTCCTGAAACAGCATATATCACTGTGAAACTAAAGAATATTCTAC
AGACACCCCTGTAGAAAGAAACAAAGAACAGGATAGTTTAGAAAGCTTTCTGTTAGCTGTATTCAGCAAATTTCATACTAGTTGCTCAGG
ACTGCTAGTTGGTATGCTTTTGTAAAACGAGATTGAAATTTAATAAAAGATGCAACTAAAATCTTTCCTGCATGAAGCTAAAAGCACTCA
AGTTGAGAGAGGGGCAAGGGAATCTCCCCAGGATGACTGAAGATGACTTCTTTTTACAGCAAGTACTGTTAGCCTTTCTGCACCCCTTAG
CTTGGCCCCTGCTCCAACTTCTGGGTCAGCAGCAAGGTGAACTCAACAGAAGTTGCTCTTGACTGTTTGAAGGTAGAAGCAGCCTACCTT
TTCTCTTTGCTAAAAGAAGGTCAAAGGCTTCGCAACCAGGATGCAAGGTCTGCGGTCCAGAAGCTTGCGGTGAGTGTGTGCCACTGATGG
AGCTCCAAGCCCACCCACCAGCCACTCCTGATGGGGTTGCTCACACTGCAGCTGCCCTATCACCACCCTGCACGTTCCTTGGAAGATTTA
AATGTTTGGTTGCAAATGAATGTTTTAAAAATGTATTTAATGCAATTTTTCCTGCTCTCAACATGACCACCCAAGATTCAAACACAGAGA
CTTCCAAGTTACTATTTTTTCAGAACATCACCGATTTTAAAATCTGTCACAACAGGACTTGGTTTTGTGCAGATATCAGAGTGCTAATGT
GAGAAACCCAGTTAAAAGAAAACTTAGTTTATTGGGAAGAAAGCCTCAGGCCCACTCGTTTCTAGAACTGTGAAAATATCCTTGGTTGGC
ATTTTTAACACAAAACACTATAGTGTTGGTATTAAATAGTACTAGGTAAATATAAAGAAACCAATAATGAATTGCTGAGACAATCTTGAA
CCCAAATAGCATTAGAAAGCTGAAGGCCCAATGAAATAACACTTTCACACTTAAACTCTGTGGATAAATTTTGCCTGTGGGTATAAACAG
ATGGTCAAATTAAAAATGCTTTACTATAATTAACTTTTCTGATTTGAATGAAGGGAAATGTATTTATTGAAACAAAGCTGTTTGCTGCTT
TATGCAGGTGCAGTGTTCAGTCAGCAAGGAAGTGGGAAGAGTGGACATGGTATTGTGTCTACACCCAAGTTCTTAACTAAGCTTCTCGCT
CTAATACTGCATTCTGTTTCTCCTTTTGTGCCCTGATTGTAATCCAAAATTTATGAACTAGAAAAGAATGTCCAATTTAATAAGTTGCAT
TTTTTTTTCTTTAAGCACTTTATTCAGAACAATACATGTTCTTCTGGTAGTGTTTGGATAATATGATTTTAACACATGCTAATAAAAGCC

>In-frame_FOXP1_ENST00000468577_chr3_71247353_-_ARMC8_ENST00000481646_chr3_137928659_+_2814nt
ATGATGCAAGAATCTGGGACTGAGACAAAAAGTAACGGTTCAGCCATCCAGAATGGGTCGGGCGGCAGCAACCACTTACTAGAGTGCGGC
GGTCTTCGGGAGGGGCGGTCCAACGGAGAGACGCCGGCCGTGGACATCGGGGCAGCTGACCTCGCCCACGCCCAGCAGCAGCAGCAACAG
GAAGTAACAGCTAGCAGTCGCCACTATGTTGACAGGCTATTTGACCCTGATCCCCAGAAAGTTCTACAAGGTGTCATAGACATGAAAAAT
GCTGTAATTGGAAACAACAAGCAGAAAGCCAATCTCATTGTTTTAGGAGCTGTTCCAAGATTGTTGTACTTGCTTCAGCAAGAAACCTCA
AGCACAGAGCTGAAAACTGAATGTGCAGTGGTGTTGGGAAGTCTTGCTATGGGTACTGAAAACAATGTCAAGTCTCTACTGGACTGCCAT
ATTATCCCTGCCTTATTGCAAGGACTACTGTCCCCAGACCTGAAGTTTATTGAAGCTTGCCTCCGATGCCTGCGTACCATCTTCACCAGT
CCTGTCACTCCAGAGGAGCTACTGTATACAGATGCCACAGTGATACCACACCTCATGGCACTGCTTAGCAGGTCCCGCTATACCCAGGAG
TACATCTGTCAGATCTTCTCACACTGCTGTAAAGGGCCAGATCATCAAACAATTTTATTTAACCACGGTGCAGTTCAGAATATTGCTCAC
CTACTAACCTCACTGTCCTACAAAGTTCGAATGCAAGCACTGAAATGTTTCTCAGTTTTAGCTTTTGAAAACCCCCAGGTATCGATGACC
CTGGTAAATGTTTTGGTTGATGGAGAATTGTTACCACAGATTTTTGTGAAGATGTTACAGAGGGATAAGCCTATTGAGATGCAGCTCACA
TCAGCAAAATGTTTAACTTACATGTGTAGAGCTGGAGCAATTCGGACAGATGATAACTGTATTGTATTAAAGACATTACCTTGTTTGGTT
CGAATGTGCAGTAAGGAGAGATTACTAGAGGAGAGAGTTGAAGGAGCTGAGACACTTGCCTATCTGATTGAACCAGATGTTGAGCTACAG
AGAATCGCTAGCATAACTGATCACCTCATTGCCATGCTTGCTGATTATTTCAAGTATCCCAGCTCAGTGAGTGCCATCACTGATATTAAA
AGGCTTGATCATGATTTAAAACATGCTCACGAACTCCGCCAGGCTGCATTCAAGCTCTATGCCTCTCTTGGAGCAAATGATGAAGACATC
CGGAAGAAGATCATTGAGACTGAAAATATGATGGACCGAATTGTGACTGGCTTGTCTGAGTCTAGTGTCAAGGTGCGGTTAGCTGCCGTC
AGATGTTTGCACAGTTTATCCAGATCTGTGCAGCAGCTTCGAACCAGTTTCCAGGATCATGCTGTTTGGAAACCTTTAATGAAGGTTTTA
CAAAATGCACCAGATGAAATCCTAGTGGTAGCATCTTCCATGCTGTGTAATCTTCTTCTTGAATTTTCTCCAAGCAAAGAGCCAATTTTG
GAATCAGGAGCCGTAGAGCTACTTTGTGGATTAACTCAGAGTGAAAATCCTGCTTTACGAGTGAATGGAATTTGGGCTTTAATGAATATG
GCATTTCAGGCTGAACAAAAAATAAAAGCAGATATTTTACGAAGCTTGAGTACTGAACAGCTATTCCGGTTATTATCAGATTCAGATTTG
AATGTGCTGATGAAGACATTGGGACTTCTTAGAAATCTCCTCTCCACTCGTCCTCATATAGATAAAATAATGAGTACTCATGGAAAGCAA
ATTATGCAAGCCGTCACTCTTATTCTAGAAGGGGAACATAACATTGAGGTCAAAGAGCAGACACTGTGCATCTTAGCCAACATAGCGGAT
GGGACAACAGCAAAAGATCTTATTATGACCAATGATGATATCCTACAGAAAATCAAGTATTACATGGGCCATTCACATGTTAAACTGCAG
CTTGCAGCCATGTTTTGTATATCAAACCTCATATGGAATGAAGAGGAAGGTTCACAAGAACGCCAGGATAAATTACGAGACATGGGCATC
GTAGATATTCTACACAAACTGAGTCAGTCACCAGATTCAAACCTTTGTGACAAGGCAAAGATGGCACTGCAGCAGTACCTGGCATGATGG
GAGTGCCCCTGGGCACCTGCGAGCATCCCACCTCCTTGTTTAAGGAAGTACAGGAACCAGCCTCATTTGATTCCTTCTATTTGCACAAGT
CACCTTGGACTGCAGGGAGCTGTTTTGCAAAAGCAGTTTAGTAGGCTTAGATCTCAAATTCATCTTGAGAACATTTTTTTGAGGTAGTAA
TTTCCTCAGAAGACTCTTGTGTTTTGTTTTGGTTTTTTTTTCTGAGCTACTCGGACTCTTTATTAGAACAATCAATCATTTTCCTTTGGA
CCTACAATTTTTGCCTATGCTGCAGCCACTTTGTGAGTGAGAATGAATATGTCTGTGTGAACACACAGGCATGCGTGTGTATGTGCACGT
ACATGGGCCAGAATGAATGGATGTGTGTGTGTGAGGGATACCTCAGATTTTTCTTTTCTTATTTTGTGTGAAAATCTCTTTTCTACAGAT
TTTCCAGGGTTTAAGCATTGCTTGCTGTATAAAAAACTTTACTGAATTATATACAGTTTGAATGAAATGTTATTTTAAAAACAAAACAAT
TGTTAAGTGTTCCATAAAGGTTATGTTGAATTTTGGTCAGATGAATATTTGTAAGTAAAAAATATATGCATTTCTGAACCTCAACTTACA

>In-frame_FOXP1_ENST00000468577_chr3_71247353_-_ARMC8_ENST00000469044_chr3_137928659_+_4654nt
ATGATGCAAGAATCTGGGACTGAGACAAAAAGTAACGGTTCAGCCATCCAGAATGGGTCGGGCGGCAGCAACCACTTACTAGAGTGCGGC
GGTCTTCGGGAGGGGCGGTCCAACGGAGAGACGCCGGCCGTGGACATCGGGGCAGCTGACCTCGCCCACGCCCAGCAGCAGCAGCAACAG
GAAGTAACAGCTAGCAGTCGCCACTATGTTGACAGGCTATTTGACCCTGATCCCCAGAAAGTTCTACAAGGTGTCATAGACATGAAAAAT
GCTGTAATTGGAAACAACAAGCAGAAAGCCAATCTCATTGTTTTAGGAGCTGTTCCAAGATTGTTGTACTTGCTTCAGCAAGAAACCTCA
AGCACAGAGCTGAAAACTGAATGTGCAGTGGTGTTGGGAAGTCTTGCTATGGGTACTGAAAACAATGTCAAGTCTCTACTGGACTGCCAT
ATTATCCCTGCCTTATTGCAAGGACTACTGTCCCCAGACCTGAAGTTTATTGAAGCTTGCCTCCGATGCCTGCGTACCATCTTCACCAGT
CCTGTCACTCCAGAGGAGCTACTGTATACAGATGCCACAGTGATACCACACCTCATGGCACTGCTTAGCAGGTCCCGCTATACCCAGGAG
TACATCTGTCAGATCTTCTCACACTGCTGTAAAGGGCCAGATCATCAAACAATTTTATTTAACCACGGTGCAGTTCAGAATATTGCTCAC
CTACTAACCTCACTGTCCTACAAAGTTCGAATGCAAGCACTGAAATGTTTCTCAGTTTTAGCTTTTGAAAACCCCCAGGTATCGATGACC
CTGGTAAATGTTTTGGTTGATGGAGAATTGTTACCACAGATTTTTGTGAAGATGTTACAGAGGGATAAGCCTATTGAGATGCAGCTCACA
TCAGCAAAATGTTTAACTTACATGTGTAGAGCTGGAGCAATTCGGACAGATGATAACTGTATTGTATTAAAGACATTACCTTGTTTGGTT
CGAATGTGCAGTAAGGAGAGATTACTAGAGGAGAGAGTTGAAGGAGCTGAGACACTTGCCTATCTGATTGAACCAGATGTTGAGCTACAG
AGAATCGCTAGCATAACTGATCACCTCATTGCCATGCTTGCTGATTATTTCAAGTATCCCAGCTCAGTGAGTGCCATCACTGATATTAAA
AGGCTTGATCATGATTTAAAACATGCTCACGAACTCCGCCAGGCTGCATTCAAGCTCTATGCCTCTCTTGGAGCAAATGATGAAGACATC
CGGAAGAAGATCATTGAGACTGAAAATATGATGGACCGAATTGTGACTGGCTTGTCTGAGTCTAGTGTCAAGGTGCGGTTAGCTGCCGTC
AGATGTTTGCACAGTTTATCCAGATCTGTGCAGCAGCTTCGAACCAGTTTCCAGGATCATGCTGTTTGGAAACCTTTAATGAAGGTTTTA
CAAAATGCACCAGATGAAATCCTAGTGGTAGCATCTTCCATGCTGTGTAATCTTCTTCTTGAATTTTCTCCAAGCAAAGAGCCAATTTTG
GAATCAGGAGCCGTAGAGCTACTTTGTGGATTAACTCAGAGTGAAAATCCTGCTTTACGAGTGAATGGAATTTGGGCTTTAATGAATATG
GCATTTCAGGCTGAACAAAAAATAAAAGCAGATATTTTACGAAGCTTGAGTACTGAACAGCTATTCCGGTTATTATCAGATTCAGATTTG
AATGTGCTGATGAAGACATTGGGACTTCTTAGAAATCTCCTCTCCACTCGTCCTCATATAGATAAAATAATGAGTACTCATGGAAAGCAA
ATTATGCAAGCCGTCACTCTTATTCTAGAAGGGGAACATAACATTGAGGTCAAAGAGCAGACACTGTGCATCTTAGCCAACATAGCGGAT
GGGACAACAGCAAAAGATCTTATTATGACCAATGATGATATCCTACAGAAAATCAAGTATTACATGGGCCATTCACATGTTAAACTGCAG
CTTGCAGCCATGTTTTGTATATCAAACCTCATATGGAATGAAGAGGAAGGTTCACAAGAACGCCAGGATAAATTACGAGACATGGGCATC
GTAGATATTCTACACAAACTGAGTCAGTCACCAGATTCAAACCTTTGTGACAAGGCAAAGATGGCACTGCAGCAGTACCTGGCATGATGG
GAGTGCCCCTGGGCACCTGCGAGCATCCCACCTCCTTGTTTAAGGAAGTACAGGAACCAGCCTCATTTGATTCCTTCTATTTGCACAAGT
CACCTTGGACTGCAGGGAGCTGTTTTGCAAAAGCAGTTTAGTAGGCTTAGATCTCAAATTCATCTTGAGAACATTTTTTTGAGGTAGTAA
TTTCCTCAGAAGACTCTTGTGTTTTGTTTTGGTTTTTTTTTCTGAGCTACTCGGACTCTTTATTAGAACAATCAATCATTTTCCTTTGGA
CCTACAATTTTTGCCTATGCTGCAGCCACTTTGTGAGTGAGAATGAATATGTCTGTGTGAACACACAGGCATGCGTGTGTATGTGCACGT
ACATGGGCCAGAATGAATGGATGTGTGTGTGTGAGGGATACCTCAGATTTTTCTTTTCTTATTTTGTGTGAAAATCTCTTTTCTACAGAT
TTTCCAGGGTTTAAGCATTGCTTGCTGTATAAAAAACTTTACTGAATTATATACAGTTTGAATGAAATGTTATTTTAAAAACAAAACAAT
TGTTAAGTGTTCCATAAAGGTTATGTTGAATTTTGGTCAGATGAATATTTGTAAGTAAAAAATATATGCATTTCTGAACCTCAACTTACA
TAGATTTTCTTTATATAAAAAAAAAGAAAAAAAAAGAAAAAGTTGGCTATAGTTGGCCTGATTAACAGGCACTATACATGGTGCTGTGCA
AAATAGTAAGCTAGCATCTTACTGCCGTCAATATTAGCAGGTACAGAGCCTTTTTTCATCCTAATTCAGTAAGTTCTCAGGCTTCCAAGT
CAAATGGAGAAGTAAAGTGAGGCAACAGATTCACCATAGGCTTTTTGAAGCATCAAAGGGAAATATAACTACTGATAGTGAAAGCCCAGC
CATGACCCAGATGGGCTTACCCTTGACAGGAACTGGGGACCAAGAGCCTCCCAATTGCCCTAACTCCTGTCATTGGTATTAGCAATATCT
GGCCAGATTTAGAACCAGTCATGGAAACTTGTGCTCAAACTAAAAGTAGGTCATCACTTCCCAGAAACAGAATACCTTGTGCTTCCTGAA
ACAGCATATATCACTGTGAAACTAAAGAATATTCTACAGACACCCCTGTAGAAAGAAACAAAGAACAGGATAGTTTAGAAAGCTTTCTGT
TAGCTGTATTCAGCAAATTTCATACTAGTTGCTCAGGACTGCTAGTTGGTATGCTTTTGTAAAACGAGATTGAAATTTAATAAAAGATGC
AACTAAAATCTTTCCTGCATGAAGCTAAAAGCACTCAAGTTGAGAGAGGGGCAAGGGAATCTCCCCAGGATGACTGAAGATGACTTCTTT
TTACAGCAAGTACTGTTAGCCTTTCTGCACCCCTTAGCTTGGCCCCTGCTCCAACTTCTGGGTCAGCAGCAAGGTGAACTCAACAGAAGT
TGCTCTTGACTGTTTGAAGGTAGAAGCAGCCTACCTTTTCTCTTTGCTAAAAGAAGGTCAAAGGCTTCGCAACCAGGATGCAAGGTCTGC
GGTCCAGAAGCTTGCGGTGAGTGTGTGCCACTGATGGAGCTCCAAGCCCACCCACCAGCCACTCCTGATGGGGTTGCTCACACTGCAGCT
GCCCTATCACCACCCTGCACGTTCCTTGGAAGATTTAAATGTTTGGTTGCAAATGAATGTTTTAAAAATGTATTTAATGCAATTTTTCCT
GCTCTCAACATGACCACCCAAGATTCAAACACAGAGACTTCCAAGTTACTATTTTTTCAGAACATCACCGATTTTAAAATCTGTCACAAC
AGGACTTGGTTTTGTGCAGATATCAGAGTGCTAATGTGAGAAACCCAGTTAAAAGAAAACTTAGTTTATTGGGAAGAAAGCCTCAGGCCC
ACTCGTTTCTAGAACTGTGAAAATATCCTTGGTTGGCATTTTTAACACAAAACACTATAGTGTTGGTATTAAATAGTACTAGGTAAATAT
AAAGAAACCAATAATGAATTGCTGAGACAATCTTGAACCCAAATAGCATTAGAAAGCTGAAGGCCCAATGAAATAACACTTTCACACTTA
AACTCTGTGGATAAATTTTGCCTGTGGGTATAAACAGATGGTCAAATTAAAAATGCTTTACTATAATTAACTTTTCTGATTTGAATGAAG
GGAAATGTATTTATTGAAACAAAGCTGTTTGCTGCTTTATGCAGGTGCAGTGTTCAGTCAGCAAGGAAGTGGGAAGAGTGGACATGGTAT
TGTGTCTACACCCAAGTTCTTAACTAAGCTTCTCGCTCTAATACTGCATTCTGTTTCTCCTTTTGTGCCCTGATTGTAATCCAAAATTTA
TGAACTAGAAAAGAATGTCCAATTTAATAAGTTGCATTTTTTTTTCTTTAAGCACTTTATTCAGAACAATACATGTTCTTCTGGTAGTGT


Top

FusionGenePPI for FOXP1_ARMC8


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
FOXP1CTBP1, FOXP1, FOXP2, FOXP4, GATAD2B, MTA1, NCOR2, ELAVL1, MYC, IL3RA, CCDC183, UNK, RCC1, HOXD13, QSER1, SATB1, SATB2, CTBP2, MYH10, LIG3, C10orf2, CUX1, VRK3, XRCC1, CHD1L, RPA2, BLM, MRE11A, MYL12B, TBP, TP53, TTF2, ZBTB10, MYL9, RPA3, TFCP2, TOP2A, UBP1, FOXP3, AURKA, SNRNP70ARMC8RAE1, TNNT1, CTNNB1, CTNNA1, HGS, CUL3, NOTCH1, SOX2, EGFR, TCF12, GDNF, GLIPR1L2, MMP7, SFRP2, TDGF1, MRPL4, GPS2, MRPL39, PDHB, HLA-DPB1, RMND5A, MRPS30, IKZF3, PRG2, TCF4, TIGD5, BMP1, PRG3, PIGT, PRICKLE3, CCDC120, MRPS24, CUTA, MPP2, INSL6, MRPL38, NDUFS6, LILRB4, NKAP, SPINK7, JPH4, NFATC1, TLE4, LCA5, ADCYAP1, NCKIPSD, IKZF1, CDK5RAP1, ANGPTL4, ARHGAP22, HAPLN3, PTPN14, PTPN21, MKLN1, RANBP10, MAEA, WDR26, RANBP9, YPEL5, RMND5B, GID4, UBE2H, ZMYND19, HTRA2, GID8, DDX5, EFHC2, RAB8A, WWC1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for FOXP1_ARMC8


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for FOXP1_ARMC8


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneFOXP1C0024232Lymphatic Metastasis1CTD_human
HgeneFOXP1C0027626Neoplasm Invasiveness1CTD_human
HgeneFOXP1C0030297Pancreatic Neoplasm1CTD_human
HgeneFOXP1C0042900Vitiligo1CTD_human
HgeneFOXP1C0279628Adenocarcinoma Of Esophagus1CTD_human
HgeneFOXP1C1510586Autism Spectrum Disorders1CTD_human
HgeneFOXP1C3495559Juvenile arthritis1CTD_human
HgeneFOXP1C4013764MENTAL RETARDATION WITH LANGUAGE IMPAIRMENT AND WITH OR WITHOUT AUTISTIC FEATURES1CTD_human;ORPHANET;UNIPROT