FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 13738

FusionGeneSummary for FOSL1_SYT7

check button Fusion gene summary
Fusion gene informationFusion gene name: FOSL1_SYT7
Fusion gene ID: 13738
HgeneTgene
Gene symbol

FOSL1

SYT7

Gene ID

8061

9066

Gene nameFOS like 1, AP-1 transcription factor subunitsynaptotagmin 7
SynonymsFRA|FRA1|fra-1IPCA-7|IPCA7|PCANAP7|SYT-VII|SYTVII
Cytomap

11q13.1

11q12.2

Type of geneprotein-codingprotein-coding
Descriptionfos-related antigen 1FOS like 1, AP-1 trancription factor subunitFOS-like antigen-1synaptotagmin-7prostate cancer-associated protein 7synaptotagmin VII
Modification date2018052320180523
UniProtAcc

P15407

O43581

Ensembl transtripts involved in fusion geneENST00000448083, ENST00000312562, 
ENST00000531493, ENST00000532401, 
ENST00000263846, ENST00000540677, 
ENST00000539008, ENST00000542836, 
ENST00000542670, ENST00000535826, 
ENST00000540831, 
Fusion gene scores* DoF score3 X 2 X 3=186 X 6 X 4=144
# samples 36
** MAII scorelog2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(6/144*10)=-1.26303440583379
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: FOSL1 [Title/Abstract] AND SYT7 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneFOSL1

GO:0061614

pri-miRNA transcription by RNA polymerase II

21673316

HgeneFOSL1

GO:2000144

positive regulation of DNA-templated transcription, initiation

23027619


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDSKCMTCGA-WE-A8ZN-06AFOSL1chr11

65667712

-SYT7chr11

61295657

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000448083ENST00000263846FOSL1chr11

65667712

-SYT7chr11

61295657

-
In-frameENST00000448083ENST00000540677FOSL1chr11

65667712

-SYT7chr11

61295657

-
In-frameENST00000448083ENST00000539008FOSL1chr11

65667712

-SYT7chr11

61295657

-
In-frameENST00000448083ENST00000542836FOSL1chr11

65667712

-SYT7chr11

61295657

-
In-frameENST00000448083ENST00000542670FOSL1chr11

65667712

-SYT7chr11

61295657

-
In-frameENST00000448083ENST00000535826FOSL1chr11

65667712

-SYT7chr11

61295657

-
5CDS-5UTRENST00000448083ENST00000540831FOSL1chr11

65667712

-SYT7chr11

61295657

-
In-frameENST00000312562ENST00000263846FOSL1chr11

65667712

-SYT7chr11

61295657

-
In-frameENST00000312562ENST00000540677FOSL1chr11

65667712

-SYT7chr11

61295657

-
In-frameENST00000312562ENST00000539008FOSL1chr11

65667712

-SYT7chr11

61295657

-
In-frameENST00000312562ENST00000542836FOSL1chr11

65667712

-SYT7chr11

61295657

-
In-frameENST00000312562ENST00000542670FOSL1chr11

65667712

-SYT7chr11

61295657

-
In-frameENST00000312562ENST00000535826FOSL1chr11

65667712

-SYT7chr11

61295657

-
5CDS-5UTRENST00000312562ENST00000540831FOSL1chr11

65667712

-SYT7chr11

61295657

-
In-frameENST00000531493ENST00000263846FOSL1chr11

65667712

-SYT7chr11

61295657

-
In-frameENST00000531493ENST00000540677FOSL1chr11

65667712

-SYT7chr11

61295657

-
In-frameENST00000531493ENST00000539008FOSL1chr11

65667712

-SYT7chr11

61295657

-
In-frameENST00000531493ENST00000542836FOSL1chr11

65667712

-SYT7chr11

61295657

-
In-frameENST00000531493ENST00000542670FOSL1chr11

65667712

-SYT7chr11

61295657

-
In-frameENST00000531493ENST00000535826FOSL1chr11

65667712

-SYT7chr11

61295657

-
5CDS-5UTRENST00000531493ENST00000540831FOSL1chr11

65667712

-SYT7chr11

61295657

-
In-frameENST00000532401ENST00000263846FOSL1chr11

65667712

-SYT7chr11

61295657

-
In-frameENST00000532401ENST00000540677FOSL1chr11

65667712

-SYT7chr11

61295657

-
In-frameENST00000532401ENST00000539008FOSL1chr11

65667712

-SYT7chr11

61295657

-
In-frameENST00000532401ENST00000542836FOSL1chr11

65667712

-SYT7chr11

61295657

-
In-frameENST00000532401ENST00000542670FOSL1chr11

65667712

-SYT7chr11

61295657

-
In-frameENST00000532401ENST00000535826FOSL1chr11

65667712

-SYT7chr11

61295657

-
5CDS-5UTRENST00000532401ENST00000540831FOSL1chr11

65667712

-SYT7chr11

61295657

-

Top

FusionProtFeatures for FOSL1_SYT7


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
FOSL1

P15407

SYT7

O43581

Ca(2+) sensor involved in Ca(2+)-dependent exocytosis ofsecretory and synaptic vesicles through Ca(2+) and phospholipidbinding to the C2 domain (By similarity). Ca(2+) induces bindingof the C2-domains to phospholipid membranes and to assembledSNARE-complexes; both actions contribute to triggering exocytosis(By similarity). SYT7 binds Ca(2+) with high affinity and slowkinetics compared to other synaptotagmins (By similarity).Involved in Ca(2+)-triggered lysosomal exocytosis, a majorcomponent of the plasma membrane repair (PubMed:11342594). Ca(2+)-regulated delivery of lysosomal membranes to the cell surface isalso involved in the phagocytic uptake of particles by macrophages(By similarity). Ca(2+)-triggered lysosomal exocytosis also playsa role in bone remodeling by regulating secretory pathways inosteoclasts and osteoblasts (By similarity). In case of infection,involved in participates cell invasion by Trypanosoma cruzi viaCa(2+)-triggered lysosomal exocytosis (PubMed:11342594,PubMed:15811535). Involved in cholesterol transport from lysosometo peroxisome by promoting membrane contacts between lysosomes andperoxisomes: probably acts by promoting vesicle fusion by bindingphosphatidylinositol-4,5-bisphosphate on peroxisomal membranes (Bysimilarity). Acts as a key mediator of synaptic facilitation, aprocess also named short-term synaptic potentiation: synapticfacilitation takes place at synapses with a low initial releaseprobability and is caused by influx of Ca(2+) into the axonterminal after spike generation, increasing the releaseprobability of neurotransmitters (By similarity). Probablymediates synaptic facilitation by directly increasing theprobability of release (By similarity). May also contribute tosynaptic facilitation by regulating synaptic vesiclereplenishment, a process required to ensure that synaptic vesiclesare ready for the arrival of the next action potential: SYT7 isrequired for synaptic vesicle replenishment by acting as a sensorfor Ca(2+) and by forming a complex with calmodulin (Bysimilarity). Also acts as a regulator of Ca(2+)-dependent insulinand glucagon secretion in beta-cells (By similarity). Triggersexocytosis by promoting fusion pore opening and fusion poreexpansion in chromaffin cells (By similarity). Also regulates thesecretion of some non-synaptic secretory granules of specializedcells (By similarity). {ECO:0000250|UniProtKB:Q62747,ECO:0000250|UniProtKB:Q9R0N7, ECO:0000269|PubMed:11342594,ECO:0000269|PubMed:15811535}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneSYT7chr11:65667712chr11:61295657ENST00000263846-39137_239117404DomainC2 1
TgeneSYT7chr11:65667712chr11:61295657ENST00000263846-39268_371117404DomainC2 2
TgeneSYT7chr11:65667712chr11:61295657ENST00000540677-410268_371192479DomainC2 2

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneFOSL1chr11:65667712chr11:61295657ENST00000312562-14103_10633272Compositional biasNote=Poly-Glu
HgeneFOSL1chr11:65667712chr11:61295657ENST00000312562-14251_25533272Compositional biasNote=Poly-Ser
HgeneFOSL1chr11:65667712chr11:61295657ENST00000312562-14105_16833272DomainbZIP
HgeneFOSL1chr11:65667712chr11:61295657ENST00000312562-14107_12733272RegionBasic motif
HgeneFOSL1chr11:65667712chr11:61295657ENST00000312562-14133_16133272RegionLeucine-zipper
TgeneSYT7chr11:65667712chr11:61295657ENST00000540677-410137_239192479DomainC2 1
TgeneSYT7chr11:65667712chr11:61295657ENST00000263846-391_16117404Topological domainVesicular
TgeneSYT7chr11:65667712chr11:61295657ENST00000263846-3938_403117404Topological domainCytoplasmic
TgeneSYT7chr11:65667712chr11:61295657ENST00000540677-4101_16192479Topological domainVesicular
TgeneSYT7chr11:65667712chr11:61295657ENST00000540677-41038_403192479Topological domainCytoplasmic
TgeneSYT7chr11:65667712chr11:61295657ENST00000263846-3917_37117404TransmembraneHelical
TgeneSYT7chr11:65667712chr11:61295657ENST00000540677-41017_37192479TransmembraneHelical


Top

FusionGeneSequence for FOSL1_SYT7


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_FOSL1_ENST00000448083_chr11_65667712_-_SYT7_ENST00000263846_chr11_61295657_-_320aa
MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQLSPGSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPF
VKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPTEKVVQRILYLQVLDTDRFSRNDPIGEVSIPLNKVDLTQMQTFWKDLKPCSDGS
GSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTMKRNLNPIFNESFAFDIPTEKLRETTIIIT

>In-frame_FOSL1_ENST00000448083_chr11_65667712_-_SYT7_ENST00000540677_chr11_61295657_-_320aa
MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQLSPGSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPF
VKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPTEKVVQRILYLQVLDTDRFSRNDPIGEVSIPLNKVDLTQMQTFWKDLKPCSDGS
GSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTMKRNLNPIFNESFAFDIPTEKLRETTIIIT

>In-frame_FOSL1_ENST00000448083_chr11_65667712_-_SYT7_ENST00000539008_chr11_61295657_-_320aa
MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQLSPGSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPF
VKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPTEKVVQRILYLQVLDTDRFSRNDPIGEVSIPLNKVDLTQMQTFWKDLKPCSDGS
GSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTMKRNLNPIFNESFAFDIPTEKLRETTIIIT

>In-frame_FOSL1_ENST00000448083_chr11_65667712_-_SYT7_ENST00000542836_chr11_61295657_-_320aa
MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQLSPGSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPF
VKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPTEKVVQRILYLQVLDTDRFSRNDPIGEVSIPLNKVDLTQMQTFWKDLKPCSDGS
GSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTMKRNLNPIFNESFAFDIPTEKLRETTIIIT

>In-frame_FOSL1_ENST00000448083_chr11_65667712_-_SYT7_ENST00000542670_chr11_61295657_-_320aa
MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQLSPGSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPF
VKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPTEKVVQRILYLQVLDTDRFSRNDPIGEVSIPLNKVDLTQMQTFWKDLKPCSDGS
GSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTMKRNLNPIFNESFAFDIPTEKLRETTIIIT

>In-frame_FOSL1_ENST00000448083_chr11_65667712_-_SYT7_ENST00000535826_chr11_61295657_-_320aa
MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQLSPGSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPF
VKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPTEKVVQRILYLQVLDTDRFSRNDPIGEVSIPLNKVDLTQMQTFWKDLKPCSDGS
GSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTMKRNLNPIFNESFAFDIPTEKLRETTIIIT

>In-frame_FOSL1_ENST00000312562_chr11_65667712_-_SYT7_ENST00000263846_chr11_61295657_-_320aa
MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQLSPGSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPF
VKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPTEKVVQRILYLQVLDTDRFSRNDPIGEVSIPLNKVDLTQMQTFWKDLKPCSDGS
GSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTMKRNLNPIFNESFAFDIPTEKLRETTIIIT

>In-frame_FOSL1_ENST00000312562_chr11_65667712_-_SYT7_ENST00000540677_chr11_61295657_-_320aa
MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQLSPGSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPF
VKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPTEKVVQRILYLQVLDTDRFSRNDPIGEVSIPLNKVDLTQMQTFWKDLKPCSDGS
GSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTMKRNLNPIFNESFAFDIPTEKLRETTIIIT

>In-frame_FOSL1_ENST00000312562_chr11_65667712_-_SYT7_ENST00000539008_chr11_61295657_-_320aa
MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQLSPGSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPF
VKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPTEKVVQRILYLQVLDTDRFSRNDPIGEVSIPLNKVDLTQMQTFWKDLKPCSDGS
GSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTMKRNLNPIFNESFAFDIPTEKLRETTIIIT

>In-frame_FOSL1_ENST00000312562_chr11_65667712_-_SYT7_ENST00000542836_chr11_61295657_-_320aa
MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQLSPGSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPF
VKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPTEKVVQRILYLQVLDTDRFSRNDPIGEVSIPLNKVDLTQMQTFWKDLKPCSDGS
GSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTMKRNLNPIFNESFAFDIPTEKLRETTIIIT

>In-frame_FOSL1_ENST00000312562_chr11_65667712_-_SYT7_ENST00000542670_chr11_61295657_-_320aa
MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQLSPGSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPF
VKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPTEKVVQRILYLQVLDTDRFSRNDPIGEVSIPLNKVDLTQMQTFWKDLKPCSDGS
GSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTMKRNLNPIFNESFAFDIPTEKLRETTIIIT

>In-frame_FOSL1_ENST00000312562_chr11_65667712_-_SYT7_ENST00000535826_chr11_61295657_-_320aa
MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQLSPGSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPF
VKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPTEKVVQRILYLQVLDTDRFSRNDPIGEVSIPLNKVDLTQMQTFWKDLKPCSDGS
GSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTMKRNLNPIFNESFAFDIPTEKLRETTIIIT

>In-frame_FOSL1_ENST00000531493_chr11_65667712_-_SYT7_ENST00000263846_chr11_61295657_-_320aa
MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQLSPGSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPF
VKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPTEKVVQRILYLQVLDTDRFSRNDPIGEVSIPLNKVDLTQMQTFWKDLKPCSDGS
GSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTMKRNLNPIFNESFAFDIPTEKLRETTIIIT

>In-frame_FOSL1_ENST00000531493_chr11_65667712_-_SYT7_ENST00000540677_chr11_61295657_-_320aa
MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQLSPGSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPF
VKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPTEKVVQRILYLQVLDTDRFSRNDPIGEVSIPLNKVDLTQMQTFWKDLKPCSDGS
GSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTMKRNLNPIFNESFAFDIPTEKLRETTIIIT

>In-frame_FOSL1_ENST00000531493_chr11_65667712_-_SYT7_ENST00000539008_chr11_61295657_-_320aa
MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQLSPGSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPF
VKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPTEKVVQRILYLQVLDTDRFSRNDPIGEVSIPLNKVDLTQMQTFWKDLKPCSDGS
GSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTMKRNLNPIFNESFAFDIPTEKLRETTIIIT

>In-frame_FOSL1_ENST00000531493_chr11_65667712_-_SYT7_ENST00000542836_chr11_61295657_-_320aa
MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQLSPGSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPF
VKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPTEKVVQRILYLQVLDTDRFSRNDPIGEVSIPLNKVDLTQMQTFWKDLKPCSDGS
GSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTMKRNLNPIFNESFAFDIPTEKLRETTIIIT

>In-frame_FOSL1_ENST00000531493_chr11_65667712_-_SYT7_ENST00000542670_chr11_61295657_-_320aa
MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQLSPGSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPF
VKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPTEKVVQRILYLQVLDTDRFSRNDPIGEVSIPLNKVDLTQMQTFWKDLKPCSDGS
GSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTMKRNLNPIFNESFAFDIPTEKLRETTIIIT

>In-frame_FOSL1_ENST00000531493_chr11_65667712_-_SYT7_ENST00000535826_chr11_61295657_-_320aa
MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQLSPGSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPF
VKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPTEKVVQRILYLQVLDTDRFSRNDPIGEVSIPLNKVDLTQMQTFWKDLKPCSDGS
GSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTMKRNLNPIFNESFAFDIPTEKLRETTIIIT

>In-frame_FOSL1_ENST00000532401_chr11_65667712_-_SYT7_ENST00000263846_chr11_61295657_-_320aa
MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQLSPGSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPF
VKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPTEKVVQRILYLQVLDTDRFSRNDPIGEVSIPLNKVDLTQMQTFWKDLKPCSDGS
GSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTMKRNLNPIFNESFAFDIPTEKLRETTIIIT

>In-frame_FOSL1_ENST00000532401_chr11_65667712_-_SYT7_ENST00000540677_chr11_61295657_-_320aa
MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQLSPGSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPF
VKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPTEKVVQRILYLQVLDTDRFSRNDPIGEVSIPLNKVDLTQMQTFWKDLKPCSDGS
GSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTMKRNLNPIFNESFAFDIPTEKLRETTIIIT

>In-frame_FOSL1_ENST00000532401_chr11_65667712_-_SYT7_ENST00000539008_chr11_61295657_-_320aa
MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQLSPGSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPF
VKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPTEKVVQRILYLQVLDTDRFSRNDPIGEVSIPLNKVDLTQMQTFWKDLKPCSDGS
GSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTMKRNLNPIFNESFAFDIPTEKLRETTIIIT

>In-frame_FOSL1_ENST00000532401_chr11_65667712_-_SYT7_ENST00000542836_chr11_61295657_-_320aa
MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQLSPGSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPF
VKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPTEKVVQRILYLQVLDTDRFSRNDPIGEVSIPLNKVDLTQMQTFWKDLKPCSDGS
GSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTMKRNLNPIFNESFAFDIPTEKLRETTIIIT

>In-frame_FOSL1_ENST00000532401_chr11_65667712_-_SYT7_ENST00000542670_chr11_61295657_-_320aa
MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQLSPGSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPF
VKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPTEKVVQRILYLQVLDTDRFSRNDPIGEVSIPLNKVDLTQMQTFWKDLKPCSDGS
GSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTMKRNLNPIFNESFAFDIPTEKLRETTIIIT

>In-frame_FOSL1_ENST00000532401_chr11_65667712_-_SYT7_ENST00000535826_chr11_61295657_-_320aa
MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQLSPGSEEDEAHEGCSRENLGRIQFSVGYNFQESTLTVKIMKAQELPAKDFSGTSDPF
VKIYLLPDKKHKLETKVKRKNLNPHWNETFLFEGFPTEKVVQRILYLQVLDTDRFSRNDPIGEVSIPLNKVDLTQMQTFWKDLKPCSDGS
GSRGELLLSLCYNPSANSIIVNIIKARNLKAMDIGGTSDPYVKVWLMYKDKRVEKKKTVTMKRNLNPIFNESFAFDIPTEKLRETTIIIT


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_FOSL1_ENST00000448083_chr11_65667712_-_SYT7_ENST00000263846_chr11_61295657_-_960nt
ATGTTCCGAGACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGCGCAGGCA
GCCCAGCAGCTCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAGTGTCGGC
TACAACTTCCAGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGACCCCTTC
GTCAAGATCTACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGAGACCTTC
CTCTTTGAAGGTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAACGACCCC
ATTGGGGAGGTGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGATGGGAGT
GGGAGCCGAGGGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAACCTCAAA
GCCATGGACATCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGACGGTGACG
ATGAAGAGGAACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCATCATCACT
GTCATGGACAAGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAAGCACTGG

>In-frame_FOSL1_ENST00000448083_chr11_65667712_-_SYT7_ENST00000540677_chr11_61295657_-_960nt
ATGTTCCGAGACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGCGCAGGCA
GCCCAGCAGCTCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAGTGTCGGC
TACAACTTCCAGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGACCCCTTC
GTCAAGATCTACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGAGACCTTC
CTCTTTGAAGGTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAACGACCCC
ATTGGGGAGGTGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGATGGGAGT
GGGAGCCGAGGGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAACCTCAAA
GCCATGGACATCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGACGGTGACG
ATGAAGAGGAACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCATCATCACT
GTCATGGACAAGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAAGCACTGG

>In-frame_FOSL1_ENST00000448083_chr11_65667712_-_SYT7_ENST00000539008_chr11_61295657_-_960nt
ATGTTCCGAGACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGCGCAGGCA
GCCCAGCAGCTCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAGTGTCGGC
TACAACTTCCAGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGACCCCTTC
GTCAAGATCTACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGAGACCTTC
CTCTTTGAAGGTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAACGACCCC
ATTGGGGAGGTGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGATGGGAGT
GGGAGCCGAGGGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAACCTCAAA
GCCATGGACATCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGACGGTGACG
ATGAAGAGGAACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCATCATCACT
GTCATGGACAAGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAAGCACTGG

>In-frame_FOSL1_ENST00000448083_chr11_65667712_-_SYT7_ENST00000542836_chr11_61295657_-_960nt
ATGTTCCGAGACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGCGCAGGCA
GCCCAGCAGCTCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAGTGTCGGC
TACAACTTCCAGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGACCCCTTC
GTCAAGATCTACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGAGACCTTC
CTCTTTGAAGGTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAACGACCCC
ATTGGGGAGGTGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGATGGGAGT
GGGAGCCGAGGGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAACCTCAAA
GCCATGGACATCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGACGGTGACG
ATGAAGAGGAACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCATCATCACT
GTCATGGACAAGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAAGCACTGG

>In-frame_FOSL1_ENST00000448083_chr11_65667712_-_SYT7_ENST00000542670_chr11_61295657_-_960nt
ATGTTCCGAGACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGCGCAGGCA
GCCCAGCAGCTCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAGTGTCGGC
TACAACTTCCAGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGACCCCTTC
GTCAAGATCTACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGAGACCTTC
CTCTTTGAAGGTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAACGACCCC
ATTGGGGAGGTGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGATGGGAGT
GGGAGCCGAGGGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAACCTCAAA
GCCATGGACATCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGACGGTGACG
ATGAAGAGGAACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCATCATCACT
GTCATGGACAAGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAAGCACTGG

>In-frame_FOSL1_ENST00000448083_chr11_65667712_-_SYT7_ENST00000535826_chr11_61295657_-_960nt
ATGTTCCGAGACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGCGCAGGCA
GCCCAGCAGCTCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAGTGTCGGC
TACAACTTCCAGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGACCCCTTC
GTCAAGATCTACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGAGACCTTC
CTCTTTGAAGGTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAACGACCCC
ATTGGGGAGGTGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGATGGGAGT
GGGAGCCGAGGGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAACCTCAAA
GCCATGGACATCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGACGGTGACG
ATGAAGAGGAACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCATCATCACT
GTCATGGACAAGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAAGCACTGG

>In-frame_FOSL1_ENST00000312562_chr11_65667712_-_SYT7_ENST00000263846_chr11_61295657_-_960nt
ATGTTCCGAGACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGCGCAGGCA
GCCCAGCAGCTCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAGTGTCGGC
TACAACTTCCAGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGACCCCTTC
GTCAAGATCTACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGAGACCTTC
CTCTTTGAAGGTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAACGACCCC
ATTGGGGAGGTGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGATGGGAGT
GGGAGCCGAGGGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAACCTCAAA
GCCATGGACATCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGACGGTGACG
ATGAAGAGGAACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCATCATCACT
GTCATGGACAAGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAAGCACTGG

>In-frame_FOSL1_ENST00000312562_chr11_65667712_-_SYT7_ENST00000540677_chr11_61295657_-_960nt
ATGTTCCGAGACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGCGCAGGCA
GCCCAGCAGCTCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAGTGTCGGC
TACAACTTCCAGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGACCCCTTC
GTCAAGATCTACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGAGACCTTC
CTCTTTGAAGGTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAACGACCCC
ATTGGGGAGGTGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGATGGGAGT
GGGAGCCGAGGGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAACCTCAAA
GCCATGGACATCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGACGGTGACG
ATGAAGAGGAACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCATCATCACT
GTCATGGACAAGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAAGCACTGG

>In-frame_FOSL1_ENST00000312562_chr11_65667712_-_SYT7_ENST00000539008_chr11_61295657_-_960nt
ATGTTCCGAGACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGCGCAGGCA
GCCCAGCAGCTCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAGTGTCGGC
TACAACTTCCAGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGACCCCTTC
GTCAAGATCTACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGAGACCTTC
CTCTTTGAAGGTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAACGACCCC
ATTGGGGAGGTGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGATGGGAGT
GGGAGCCGAGGGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAACCTCAAA
GCCATGGACATCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGACGGTGACG
ATGAAGAGGAACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCATCATCACT
GTCATGGACAAGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAAGCACTGG

>In-frame_FOSL1_ENST00000312562_chr11_65667712_-_SYT7_ENST00000542836_chr11_61295657_-_960nt
ATGTTCCGAGACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGCGCAGGCA
GCCCAGCAGCTCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAGTGTCGGC
TACAACTTCCAGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGACCCCTTC
GTCAAGATCTACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGAGACCTTC
CTCTTTGAAGGTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAACGACCCC
ATTGGGGAGGTGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGATGGGAGT
GGGAGCCGAGGGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAACCTCAAA
GCCATGGACATCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGACGGTGACG
ATGAAGAGGAACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCATCATCACT
GTCATGGACAAGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAAGCACTGG

>In-frame_FOSL1_ENST00000312562_chr11_65667712_-_SYT7_ENST00000542670_chr11_61295657_-_960nt
ATGTTCCGAGACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGCGCAGGCA
GCCCAGCAGCTCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAGTGTCGGC
TACAACTTCCAGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGACCCCTTC
GTCAAGATCTACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGAGACCTTC
CTCTTTGAAGGTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAACGACCCC
ATTGGGGAGGTGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGATGGGAGT
GGGAGCCGAGGGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAACCTCAAA
GCCATGGACATCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGACGGTGACG
ATGAAGAGGAACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCATCATCACT
GTCATGGACAAGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAAGCACTGG

>In-frame_FOSL1_ENST00000312562_chr11_65667712_-_SYT7_ENST00000535826_chr11_61295657_-_960nt
ATGTTCCGAGACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGCGCAGGCA
GCCCAGCAGCTCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAGTGTCGGC
TACAACTTCCAGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGACCCCTTC
GTCAAGATCTACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGAGACCTTC
CTCTTTGAAGGTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAACGACCCC
ATTGGGGAGGTGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGATGGGAGT
GGGAGCCGAGGGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAACCTCAAA
GCCATGGACATCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGACGGTGACG
ATGAAGAGGAACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCATCATCACT
GTCATGGACAAGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAAGCACTGG

>In-frame_FOSL1_ENST00000531493_chr11_65667712_-_SYT7_ENST00000263846_chr11_61295657_-_960nt
ATGTTCCGAGACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGCGCAGGCA
GCCCAGCAGCTCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAGTGTCGGC
TACAACTTCCAGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGACCCCTTC
GTCAAGATCTACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGAGACCTTC
CTCTTTGAAGGTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAACGACCCC
ATTGGGGAGGTGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGATGGGAGT
GGGAGCCGAGGGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAACCTCAAA
GCCATGGACATCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGACGGTGACG
ATGAAGAGGAACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCATCATCACT
GTCATGGACAAGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAAGCACTGG

>In-frame_FOSL1_ENST00000531493_chr11_65667712_-_SYT7_ENST00000540677_chr11_61295657_-_960nt
ATGTTCCGAGACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGCGCAGGCA
GCCCAGCAGCTCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAGTGTCGGC
TACAACTTCCAGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGACCCCTTC
GTCAAGATCTACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGAGACCTTC
CTCTTTGAAGGTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAACGACCCC
ATTGGGGAGGTGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGATGGGAGT
GGGAGCCGAGGGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAACCTCAAA
GCCATGGACATCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGACGGTGACG
ATGAAGAGGAACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCATCATCACT
GTCATGGACAAGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAAGCACTGG

>In-frame_FOSL1_ENST00000531493_chr11_65667712_-_SYT7_ENST00000539008_chr11_61295657_-_960nt
ATGTTCCGAGACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGCGCAGGCA
GCCCAGCAGCTCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAGTGTCGGC
TACAACTTCCAGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGACCCCTTC
GTCAAGATCTACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGAGACCTTC
CTCTTTGAAGGTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAACGACCCC
ATTGGGGAGGTGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGATGGGAGT
GGGAGCCGAGGGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAACCTCAAA
GCCATGGACATCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGACGGTGACG
ATGAAGAGGAACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCATCATCACT
GTCATGGACAAGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAAGCACTGG

>In-frame_FOSL1_ENST00000531493_chr11_65667712_-_SYT7_ENST00000542836_chr11_61295657_-_960nt
ATGTTCCGAGACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGCGCAGGCA
GCCCAGCAGCTCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAGTGTCGGC
TACAACTTCCAGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGACCCCTTC
GTCAAGATCTACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGAGACCTTC
CTCTTTGAAGGTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAACGACCCC
ATTGGGGAGGTGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGATGGGAGT
GGGAGCCGAGGGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAACCTCAAA
GCCATGGACATCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGACGGTGACG
ATGAAGAGGAACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCATCATCACT
GTCATGGACAAGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAAGCACTGG

>In-frame_FOSL1_ENST00000531493_chr11_65667712_-_SYT7_ENST00000542670_chr11_61295657_-_960nt
ATGTTCCGAGACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGCGCAGGCA
GCCCAGCAGCTCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAGTGTCGGC
TACAACTTCCAGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGACCCCTTC
GTCAAGATCTACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGAGACCTTC
CTCTTTGAAGGTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAACGACCCC
ATTGGGGAGGTGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGATGGGAGT
GGGAGCCGAGGGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAACCTCAAA
GCCATGGACATCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGACGGTGACG
ATGAAGAGGAACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCATCATCACT
GTCATGGACAAGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAAGCACTGG

>In-frame_FOSL1_ENST00000531493_chr11_65667712_-_SYT7_ENST00000535826_chr11_61295657_-_960nt
ATGTTCCGAGACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGCGCAGGCA
GCCCAGCAGCTCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAGTGTCGGC
TACAACTTCCAGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGACCCCTTC
GTCAAGATCTACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGAGACCTTC
CTCTTTGAAGGTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAACGACCCC
ATTGGGGAGGTGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGATGGGAGT
GGGAGCCGAGGGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAACCTCAAA
GCCATGGACATCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGACGGTGACG
ATGAAGAGGAACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCATCATCACT
GTCATGGACAAGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAAGCACTGG

>In-frame_FOSL1_ENST00000532401_chr11_65667712_-_SYT7_ENST00000263846_chr11_61295657_-_960nt
ATGTTCCGAGACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGCGCAGGCA
GCCCAGCAGCTCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAGTGTCGGC
TACAACTTCCAGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGACCCCTTC
GTCAAGATCTACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGAGACCTTC
CTCTTTGAAGGTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAACGACCCC
ATTGGGGAGGTGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGATGGGAGT
GGGAGCCGAGGGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAACCTCAAA
GCCATGGACATCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGACGGTGACG
ATGAAGAGGAACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCATCATCACT
GTCATGGACAAGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAAGCACTGG

>In-frame_FOSL1_ENST00000532401_chr11_65667712_-_SYT7_ENST00000540677_chr11_61295657_-_960nt
ATGTTCCGAGACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGCGCAGGCA
GCCCAGCAGCTCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAGTGTCGGC
TACAACTTCCAGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGACCCCTTC
GTCAAGATCTACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGAGACCTTC
CTCTTTGAAGGTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAACGACCCC
ATTGGGGAGGTGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGATGGGAGT
GGGAGCCGAGGGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAACCTCAAA
GCCATGGACATCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGACGGTGACG
ATGAAGAGGAACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCATCATCACT
GTCATGGACAAGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAAGCACTGG

>In-frame_FOSL1_ENST00000532401_chr11_65667712_-_SYT7_ENST00000539008_chr11_61295657_-_960nt
ATGTTCCGAGACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGCGCAGGCA
GCCCAGCAGCTCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAGTGTCGGC
TACAACTTCCAGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGACCCCTTC
GTCAAGATCTACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGAGACCTTC
CTCTTTGAAGGTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAACGACCCC
ATTGGGGAGGTGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGATGGGAGT
GGGAGCCGAGGGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAACCTCAAA
GCCATGGACATCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGACGGTGACG
ATGAAGAGGAACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCATCATCACT
GTCATGGACAAGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAAGCACTGG

>In-frame_FOSL1_ENST00000532401_chr11_65667712_-_SYT7_ENST00000542836_chr11_61295657_-_960nt
ATGTTCCGAGACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGCGCAGGCA
GCCCAGCAGCTCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAGTGTCGGC
TACAACTTCCAGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGACCCCTTC
GTCAAGATCTACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGAGACCTTC
CTCTTTGAAGGTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAACGACCCC
ATTGGGGAGGTGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGATGGGAGT
GGGAGCCGAGGGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAACCTCAAA
GCCATGGACATCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGACGGTGACG
ATGAAGAGGAACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCATCATCACT
GTCATGGACAAGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAAGCACTGG

>In-frame_FOSL1_ENST00000532401_chr11_65667712_-_SYT7_ENST00000542670_chr11_61295657_-_960nt
ATGTTCCGAGACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGCGCAGGCA
GCCCAGCAGCTCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAGTGTCGGC
TACAACTTCCAGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGACCCCTTC
GTCAAGATCTACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGAGACCTTC
CTCTTTGAAGGTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAACGACCCC
ATTGGGGAGGTGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGATGGGAGT
GGGAGCCGAGGGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAACCTCAAA
GCCATGGACATCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGACGGTGACG
ATGAAGAGGAACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCATCATCACT
GTCATGGACAAGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAAGCACTGG

>In-frame_FOSL1_ENST00000532401_chr11_65667712_-_SYT7_ENST00000535826_chr11_61295657_-_960nt
ATGTTCCGAGACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGCGCAGGCA
GCCCAGCAGCTCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAGTGTCGGC
TACAACTTCCAGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGACCCCTTC
GTCAAGATCTACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGAGACCTTC
CTCTTTGAAGGTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAACGACCCC
ATTGGGGAGGTGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGATGGGAGT
GGGAGCCGAGGGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAACCTCAAA
GCCATGGACATCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGACGGTGACG
ATGAAGAGGAACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCATCATCACT
GTCATGGACAAGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAAGCACTGG


* Fusion transcript sequences (Full-length transcript).
>In-frame_FOSL1_ENST00000448083_chr11_65667712_-_SYT7_ENST00000263846_chr11_61295657_-_4354nt
ATAAAAAGAAAAGACTCCGCACGGCGCGGGTGAGTCAGAACCCAGCAGCCGTGTACCCCGCAGAGCCGCCAGCCCCGGGCATGTTCCGAG
ACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGCGCAGGCAGCCCAGCAGC
TCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAGTGTCGGCTACAACTTCC
AGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGACCCCTTCGTCAAGATCT
ACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGAGACCTTCCTCTTTGAAG
GTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAACGACCCCATTGGGGAGG
TGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGATGGGAGTGGGAGCCGAG
GGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAACCTCAAAGCCATGGACA
TCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGACGGTGACGATGAAGAGGA
ACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCATCATCACTGTCATGGACA
AGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAAGCACTGGAAGGACATGA
TTGCCCGTCCCCGGCAGCCCGTGGCCCAGTGGCACCAGCTGAAGGCCTGAGTGGGGCCAAGGGAGGCCCAGGGGGCCGAGGGCCCAGGTC
CCCATCATGCCCTCACCACTTTATGCACAACGCCCGGCCTGAGCCCCCTGCCATAGGGAGGGGAGGACCCTGAGGGCTCAGCCAGGGAGG
GGTCCCAGGACTCAACTGGGCCCCGTTTCTAGGAAGTACCAGCCCCATCCCCCACAGTCCAGCTCCGGGGAAGGGGCTCTGGGAGGCATT
TTCCTGCTTTGCCCCTTTTCTTCCTGACTTACTAATACTAAAGAAGTTGGGGGAGCTCGAGAGCCAGACGGCCAGACAGGCAGACCCCTC
CAGAGGCCCGCCAGGTGGGCATGGTCCCCCATTTTCTTTAAGGCAGCACCTGGAGTGGAGAGAGGCCACTCCCTCTCCAGCCCCCGATGT
GGACCCGGGGAGGGGAGGCTGAGGCGTTTGGCCCCGGCCTGGCCAGGAGAGGCCCATCCCCAGGGCAGTTTCAGGTGCCGGCTGGGCCCT
GAATGTCGAGGATAGTATATAGCCCGCTCCTGGGTCCTGGAGCTGTGGCCCTTTGTACTCGTGTTGTGTCCATTGTGTGTGTGCGTGGGG
ACAGAGGCCTGGAAATGCGGAGGACTATACAGAGAAGGCAGGTTTTGTGAAGGCCAGGCAGGGTTGGAGGCCGGGGGTGTGAGAGGAGAG
GCCCATAGGGCTGAGTGGGGTCGGGTGAGGCAGAGGTCAGAAACAGAAGAGCTGCAGTTGCTGGAGCTGGGCTGAGAACTGGGCTGCCTC
CTGCCATCCCCCCGTCTCCTCCCCTTCTCCCCTTGGTGCCCCCCTCTGCTCAGAATCTGAAGTAGTTCCCTCCTCAGCAATTTCATCTCT
TGAACACTGACTCACACCTTTTAGGCACCTACTGTGTGCATAGCATTCCACCAGGACTCATCTCCCTTCCTTCTCAGGGGGTCCCGAGCC
CCGACTAGCTTTGCCCTAACTCCTTCATCAAAAGACCCCCCGCCAGCTTCCCACACCTCATACGCAGCCACATCTGCCCTATTCTCCATG
CTTTCCAGCTTGCCTGCCCTTCCTCATCTCTCCCTGCCTGTGCAGACCTCCACCCTTCTTTCCTCCACCCCTCCATCCCCCAATGCTTGT
AGACCTTCCATTCATTCCGTCTCATCGTGCGTGGTCTCTGATCGTCCATCACCTGACCTTCTCCAGGACTGTCTTCTCACCCTTCCCCAC
TCCCTGGTCCCCGGGAGCAGCTCCTTCTGCCCGACTCACTCACAGTGCAGGGAAAGGAGGCAGGGAAAAGACCAGGATTCTGTGAGTTCT
GAGGTTGCCACACACAAAGAAGCTGTGGTTTCTCTGCCTCGGCCACTGATGAGACTAAAACTGGCTTCCCCTTGGAGACGGCAGATTTCA
GGCTGATCCCTGCTTAAGCCCTCTCATCCCCACGCTGGTCCTGGTATTGATACAAGACCCAGCTGGTGACAAAGCCTCCAATCCTGGGGG
TCCACGAGCCTGGGCCTGACATTCCCAGAACTACCGCCAGGTGGCGCCAGGCCCCCACAGTCTGTGGCCGTGGTCTTAGCCCCCAGTTCC
ACTCTGGATGGGCCTGTGACACCCCAAAGAGAAGAAGGGGACTCTGGATAGGGTCCCCACATCCAGGGCGTGGGGAGACCATTGGCATTT
GGGAACCATTTTCCTTCGAACGGCTTCCCCTTGAGCTGAGCATTCTGCTTGCTGCAGTAGACGGGTCGCCTTTTGCCCATACCGAAATTT
TCTGAAATTAAATCGCACACCCCCACCATTTCCTCTCCCTGGGATCTGGAGGAACATCATACATAGTAGGTGAATCGTTTTGTAGAGTGA
AGAATGCTAATGTAAAGCAAATAGTCACCCACGTTCCTTGTAAATCCAAATGTTTCTATATTGTAGCTTTGCTTAAAATGGGGTCGGCCC
CAACTGCATCCTCCTCTTTGGCGGGCTGGGGAGCGGCCCCCAGCCGGGACGGGAGGGCAGCGACCCCGAGGCCTCGTGGACGTGGGAGAG
AGTGTGGTGGGAAGTCTTGAGCGGAGGAGGGGATCTGCCCTTCTCCACTCCTCTCTTGGATCCGCCTCGGTTTCCTGTCCCCCCACCACC
CGCCTGCCCCGCGGAAGACCGCCCAGTGAGCCAGCCCCCACCTTCCAGGCGCCTTCGCCCTGGGGATCCAACCAACTTGTATCGAGTGGG
CGGGGCAACGGCTCCCCATTTTTCCCGAGCCCCGCCCACAGAGCTCTTAGCCAATCCTATGCAGAGAGCATCTCCTGGCAGGGGTCTCTT
CCCAACCAGACCCCACCCAGGCACATTAGCGACCAGGCTTGGGCTTCCCCAGCGCCCCACCACCACCACGTGCAGGTGGAGCTCTGGGAT
GCTATGTTGGGGCGGCAAGCGGTGGGCCGAGGGCCGGGTAGGCTAGCACGGGAGGTAAGGGTGGTATGGGATGGGGCGGGGGCGGTCTAG
GGCAATAGGAGAGCAGAGAATGGGGGAACTTGAGGGTGGGGGGAGGGCACCGGAGCCTTGCCACCATCCCAGGACTTTGGGCAAGTCACC
CGCACTCCCTGGGCCTCGGTTTCCCCATCTGTAAAATGATGGTAATAATACTTCACCTACCTCATAGGGGAGGTTGTGAGGCCACCATCA
CCTGACCTGGGGGTCAAGGCAGGAGGACTCCGAAGGTGCTACCCGTGAGCAAAGTGTAATTACCGAATCCTGACTGCAAGGCCCACCTGC
CCCTCCCCCACAGAGCCTCCAGAGCTAGCTGAGGCCAACGCAGGCCCATCCGTCTCTTCACTCTGTCGCAGGCCCTTTCATGGGCTTCGT
CTGCCATCTTTGTGGGTGCCCTAGACTTAGTCCTTATCTTGTCCTGGTTTCCTTTCTTGTGACCATCTCCCCATGAAAGTGCTGTACAAA
TTCCACCCGCCCCAGGACCCCCGCACCTGCCCTCTGGCACCAGATGCCAGGGAAGGGACAGAGGAAAACAGCCACAAACAAGCCAGGGGG
GCTCCCCGGAGCCCCAGGGGTGGGGATTGGTGGCCACTGTTTGTATGTTCTTGAGTGCAAGTGTTTTATAAAAAATAAAACAAAAACCCA
CCATCACAAAAAAAAAAATTTTGCAGCGAAGAGAAATGAAGAAAAACTGAAGAAAAAAAAAAAACAGGAAAAAAAGAACCATACAAAATT
TTTCCACCACACATACCCTCTAAGCCAGCAAGATTTCCTCTTTGCAAAATCATATTTTTGTGGGAATGGGCCCTGCTTTTTGTGGCAAGG

>In-frame_FOSL1_ENST00000448083_chr11_65667712_-_SYT7_ENST00000540677_chr11_61295657_-_1610nt
ATAAAAAGAAAAGACTCCGCACGGCGCGGGTGAGTCAGAACCCAGCAGCCGTGTACCCCGCAGAGCCGCCAGCCCCGGGCATGTTCCGAG
ACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGCGCAGGCAGCCCAGCAGC
TCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAGTGTCGGCTACAACTTCC
AGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGACCCCTTCGTCAAGATCT
ACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGAGACCTTCCTCTTTGAAG
GTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAACGACCCCATTGGGGAGG
TGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGATGGGAGTGGGAGCCGAG
GGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAACCTCAAAGCCATGGACA
TCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGACGGTGACGATGAAGAGGA
ACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCATCATCACTGTCATGGACA
AGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAAGCACTGGAAGGACATGA
TTGCCCGTCCCCGGCAGCCCGTGGCCCAGTGGCACCAGCTGAAGGCCTGAGTGGGGCCAAGGGAGGCCCAGGGGGCCGAGGGCCCAGGTC
CCCATCATGCCCTCACCACTTTATGCACAACGCCCGGCCTGAGCCCCCTGCCATAGGGAGGGGAGGACCCTGAGGGCTCAGCCAGGGAGG
GGTCCCAGGACTCAACTGGGCCCCGTTTCTAGGAAGTACCAGCCCCATCCCCCACAGTCCAGCTCCGGGGAAGGGGCTCTGGGAGGCATT
TTCCTGCTTTGCCCCTTTTCTTCCTGACTTACTAATACTAAAGAAGTTGGGGGAGCTCGAGAGCCAGACGGCCAGACAGGCAGACCCCTC
CAGAGGCCCGCCAGGTGGGCATGGTCCCCCATTTTCTTTAAGGCAGCACCTGGAGTGGAGAGAGGCCACTCCCTCTCCAGCCCCCGATGT
GGACCCGGGGAGGGGAGGCTGAGGCGTTTGGCCCCGGCCTGGCCAGGAGAGGCCCATCCCCAGGGCAGTTTCAGGTGCCGGCTGGGCCCT

>In-frame_FOSL1_ENST00000448083_chr11_65667712_-_SYT7_ENST00000539008_chr11_61295657_-_1040nt
ATAAAAAGAAAAGACTCCGCACGGCGCGGGTGAGTCAGAACCCAGCAGCCGTGTACCCCGCAGAGCCGCCAGCCCCGGGCATGTTCCGAG
ACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGCGCAGGCAGCCCAGCAGC
TCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAGTGTCGGCTACAACTTCC
AGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGACCCCTTCGTCAAGATCT
ACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGAGACCTTCCTCTTTGAAG
GTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAACGACCCCATTGGGGAGG
TGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGATGGGAGTGGGAGCCGAG
GGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAACCTCAAAGCCATGGACA
TCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGACGGTGACGATGAAGAGGA
ACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCATCATCACTGTCATGGACA
AGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAAGCACTGGAAGGACATGA

>In-frame_FOSL1_ENST00000448083_chr11_65667712_-_SYT7_ENST00000542836_chr11_61295657_-_1040nt
ATAAAAAGAAAAGACTCCGCACGGCGCGGGTGAGTCAGAACCCAGCAGCCGTGTACCCCGCAGAGCCGCCAGCCCCGGGCATGTTCCGAG
ACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGCGCAGGCAGCCCAGCAGC
TCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAGTGTCGGCTACAACTTCC
AGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGACCCCTTCGTCAAGATCT
ACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGAGACCTTCCTCTTTGAAG
GTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAACGACCCCATTGGGGAGG
TGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGATGGGAGTGGGAGCCGAG
GGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAACCTCAAAGCCATGGACA
TCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGACGGTGACGATGAAGAGGA
ACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCATCATCACTGTCATGGACA
AGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAAGCACTGGAAGGACATGA

>In-frame_FOSL1_ENST00000448083_chr11_65667712_-_SYT7_ENST00000542670_chr11_61295657_-_1040nt
ATAAAAAGAAAAGACTCCGCACGGCGCGGGTGAGTCAGAACCCAGCAGCCGTGTACCCCGCAGAGCCGCCAGCCCCGGGCATGTTCCGAG
ACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGCGCAGGCAGCCCAGCAGC
TCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAGTGTCGGCTACAACTTCC
AGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGACCCCTTCGTCAAGATCT
ACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGAGACCTTCCTCTTTGAAG
GTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAACGACCCCATTGGGGAGG
TGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGATGGGAGTGGGAGCCGAG
GGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAACCTCAAAGCCATGGACA
TCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGACGGTGACGATGAAGAGGA
ACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCATCATCACTGTCATGGACA
AGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAAGCACTGGAAGGACATGA

>In-frame_FOSL1_ENST00000448083_chr11_65667712_-_SYT7_ENST00000535826_chr11_61295657_-_1040nt
ATAAAAAGAAAAGACTCCGCACGGCGCGGGTGAGTCAGAACCCAGCAGCCGTGTACCCCGCAGAGCCGCCAGCCCCGGGCATGTTCCGAG
ACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGCGCAGGCAGCCCAGCAGC
TCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAGTGTCGGCTACAACTTCC
AGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGACCCCTTCGTCAAGATCT
ACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGAGACCTTCCTCTTTGAAG
GTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAACGACCCCATTGGGGAGG
TGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGATGGGAGTGGGAGCCGAG
GGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAACCTCAAAGCCATGGACA
TCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGACGGTGACGATGAAGAGGA
ACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCATCATCACTGTCATGGACA
AGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAAGCACTGGAAGGACATGA

>In-frame_FOSL1_ENST00000312562_chr11_65667712_-_SYT7_ENST00000263846_chr11_61295657_-_4461nt
ACGGGCCAAGGCGGCGCGTCTCGGGGGTGGAGCCTGGAGGTGACCGCGCCGCTGCAACGCCCCCACCCCCCGCGGTCGCAGTGGTTCAGC
CCGAGAACTTTTCATTCATAAAAAGAAAAGACTCCGCACGGCGCGGGTGAGTCAGAACCCAGCAGCCGTGTACCCCGCAGAGCCGCCAGC
CCCGGGCATGTTCCGAGACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGC
GCAGGCAGCCCAGCAGCTCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAG
TGTCGGCTACAACTTCCAGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGA
CCCCTTCGTCAAGATCTACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGA
GACCTTCCTCTTTGAAGGTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAA
CGACCCCATTGGGGAGGTGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGA
TGGGAGTGGGAGCCGAGGGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAA
CCTCAAAGCCATGGACATCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGAC
GGTGACGATGAAGAGGAACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCAT
CATCACTGTCATGGACAAGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAA
GCACTGGAAGGACATGATTGCCCGTCCCCGGCAGCCCGTGGCCCAGTGGCACCAGCTGAAGGCCTGAGTGGGGCCAAGGGAGGCCCAGGG
GGCCGAGGGCCCAGGTCCCCATCATGCCCTCACCACTTTATGCACAACGCCCGGCCTGAGCCCCCTGCCATAGGGAGGGGAGGACCCTGA
GGGCTCAGCCAGGGAGGGGTCCCAGGACTCAACTGGGCCCCGTTTCTAGGAAGTACCAGCCCCATCCCCCACAGTCCAGCTCCGGGGAAG
GGGCTCTGGGAGGCATTTTCCTGCTTTGCCCCTTTTCTTCCTGACTTACTAATACTAAAGAAGTTGGGGGAGCTCGAGAGCCAGACGGCC
AGACAGGCAGACCCCTCCAGAGGCCCGCCAGGTGGGCATGGTCCCCCATTTTCTTTAAGGCAGCACCTGGAGTGGAGAGAGGCCACTCCC
TCTCCAGCCCCCGATGTGGACCCGGGGAGGGGAGGCTGAGGCGTTTGGCCCCGGCCTGGCCAGGAGAGGCCCATCCCCAGGGCAGTTTCA
GGTGCCGGCTGGGCCCTGAATGTCGAGGATAGTATATAGCCCGCTCCTGGGTCCTGGAGCTGTGGCCCTTTGTACTCGTGTTGTGTCCAT
TGTGTGTGTGCGTGGGGACAGAGGCCTGGAAATGCGGAGGACTATACAGAGAAGGCAGGTTTTGTGAAGGCCAGGCAGGGTTGGAGGCCG
GGGGTGTGAGAGGAGAGGCCCATAGGGCTGAGTGGGGTCGGGTGAGGCAGAGGTCAGAAACAGAAGAGCTGCAGTTGCTGGAGCTGGGCT
GAGAACTGGGCTGCCTCCTGCCATCCCCCCGTCTCCTCCCCTTCTCCCCTTGGTGCCCCCCTCTGCTCAGAATCTGAAGTAGTTCCCTCC
TCAGCAATTTCATCTCTTGAACACTGACTCACACCTTTTAGGCACCTACTGTGTGCATAGCATTCCACCAGGACTCATCTCCCTTCCTTC
TCAGGGGGTCCCGAGCCCCGACTAGCTTTGCCCTAACTCCTTCATCAAAAGACCCCCCGCCAGCTTCCCACACCTCATACGCAGCCACAT
CTGCCCTATTCTCCATGCTTTCCAGCTTGCCTGCCCTTCCTCATCTCTCCCTGCCTGTGCAGACCTCCACCCTTCTTTCCTCCACCCCTC
CATCCCCCAATGCTTGTAGACCTTCCATTCATTCCGTCTCATCGTGCGTGGTCTCTGATCGTCCATCACCTGACCTTCTCCAGGACTGTC
TTCTCACCCTTCCCCACTCCCTGGTCCCCGGGAGCAGCTCCTTCTGCCCGACTCACTCACAGTGCAGGGAAAGGAGGCAGGGAAAAGACC
AGGATTCTGTGAGTTCTGAGGTTGCCACACACAAAGAAGCTGTGGTTTCTCTGCCTCGGCCACTGATGAGACTAAAACTGGCTTCCCCTT
GGAGACGGCAGATTTCAGGCTGATCCCTGCTTAAGCCCTCTCATCCCCACGCTGGTCCTGGTATTGATACAAGACCCAGCTGGTGACAAA
GCCTCCAATCCTGGGGGTCCACGAGCCTGGGCCTGACATTCCCAGAACTACCGCCAGGTGGCGCCAGGCCCCCACAGTCTGTGGCCGTGG
TCTTAGCCCCCAGTTCCACTCTGGATGGGCCTGTGACACCCCAAAGAGAAGAAGGGGACTCTGGATAGGGTCCCCACATCCAGGGCGTGG
GGAGACCATTGGCATTTGGGAACCATTTTCCTTCGAACGGCTTCCCCTTGAGCTGAGCATTCTGCTTGCTGCAGTAGACGGGTCGCCTTT
TGCCCATACCGAAATTTTCTGAAATTAAATCGCACACCCCCACCATTTCCTCTCCCTGGGATCTGGAGGAACATCATACATAGTAGGTGA
ATCGTTTTGTAGAGTGAAGAATGCTAATGTAAAGCAAATAGTCACCCACGTTCCTTGTAAATCCAAATGTTTCTATATTGTAGCTTTGCT
TAAAATGGGGTCGGCCCCAACTGCATCCTCCTCTTTGGCGGGCTGGGGAGCGGCCCCCAGCCGGGACGGGAGGGCAGCGACCCCGAGGCC
TCGTGGACGTGGGAGAGAGTGTGGTGGGAAGTCTTGAGCGGAGGAGGGGATCTGCCCTTCTCCACTCCTCTCTTGGATCCGCCTCGGTTT
CCTGTCCCCCCACCACCCGCCTGCCCCGCGGAAGACCGCCCAGTGAGCCAGCCCCCACCTTCCAGGCGCCTTCGCCCTGGGGATCCAACC
AACTTGTATCGAGTGGGCGGGGCAACGGCTCCCCATTTTTCCCGAGCCCCGCCCACAGAGCTCTTAGCCAATCCTATGCAGAGAGCATCT
CCTGGCAGGGGTCTCTTCCCAACCAGACCCCACCCAGGCACATTAGCGACCAGGCTTGGGCTTCCCCAGCGCCCCACCACCACCACGTGC
AGGTGGAGCTCTGGGATGCTATGTTGGGGCGGCAAGCGGTGGGCCGAGGGCCGGGTAGGCTAGCACGGGAGGTAAGGGTGGTATGGGATG
GGGCGGGGGCGGTCTAGGGCAATAGGAGAGCAGAGAATGGGGGAACTTGAGGGTGGGGGGAGGGCACCGGAGCCTTGCCACCATCCCAGG
ACTTTGGGCAAGTCACCCGCACTCCCTGGGCCTCGGTTTCCCCATCTGTAAAATGATGGTAATAATACTTCACCTACCTCATAGGGGAGG
TTGTGAGGCCACCATCACCTGACCTGGGGGTCAAGGCAGGAGGACTCCGAAGGTGCTACCCGTGAGCAAAGTGTAATTACCGAATCCTGA
CTGCAAGGCCCACCTGCCCCTCCCCCACAGAGCCTCCAGAGCTAGCTGAGGCCAACGCAGGCCCATCCGTCTCTTCACTCTGTCGCAGGC
CCTTTCATGGGCTTCGTCTGCCATCTTTGTGGGTGCCCTAGACTTAGTCCTTATCTTGTCCTGGTTTCCTTTCTTGTGACCATCTCCCCA
TGAAAGTGCTGTACAAATTCCACCCGCCCCAGGACCCCCGCACCTGCCCTCTGGCACCAGATGCCAGGGAAGGGACAGAGGAAAACAGCC
ACAAACAAGCCAGGGGGGCTCCCCGGAGCCCCAGGGGTGGGGATTGGTGGCCACTGTTTGTATGTTCTTGAGTGCAAGTGTTTTATAAAA
AATAAAACAAAAACCCACCATCACAAAAAAAAAAATTTTGCAGCGAAGAGAAATGAAGAAAAACTGAAGAAAAAAAAAAAACAGGAAAAA
AAGAACCATACAAAATTTTTCCACCACACATACCCTCTAAGCCAGCAAGATTTCCTCTTTGCAAAATCATATTTTTGTGGGAATGGGCCC

>In-frame_FOSL1_ENST00000312562_chr11_65667712_-_SYT7_ENST00000540677_chr11_61295657_-_1717nt
ACGGGCCAAGGCGGCGCGTCTCGGGGGTGGAGCCTGGAGGTGACCGCGCCGCTGCAACGCCCCCACCCCCCGCGGTCGCAGTGGTTCAGC
CCGAGAACTTTTCATTCATAAAAAGAAAAGACTCCGCACGGCGCGGGTGAGTCAGAACCCAGCAGCCGTGTACCCCGCAGAGCCGCCAGC
CCCGGGCATGTTCCGAGACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGC
GCAGGCAGCCCAGCAGCTCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAG
TGTCGGCTACAACTTCCAGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGA
CCCCTTCGTCAAGATCTACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGA
GACCTTCCTCTTTGAAGGTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAA
CGACCCCATTGGGGAGGTGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGA
TGGGAGTGGGAGCCGAGGGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAA
CCTCAAAGCCATGGACATCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGAC
GGTGACGATGAAGAGGAACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCAT
CATCACTGTCATGGACAAGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAA
GCACTGGAAGGACATGATTGCCCGTCCCCGGCAGCCCGTGGCCCAGTGGCACCAGCTGAAGGCCTGAGTGGGGCCAAGGGAGGCCCAGGG
GGCCGAGGGCCCAGGTCCCCATCATGCCCTCACCACTTTATGCACAACGCCCGGCCTGAGCCCCCTGCCATAGGGAGGGGAGGACCCTGA
GGGCTCAGCCAGGGAGGGGTCCCAGGACTCAACTGGGCCCCGTTTCTAGGAAGTACCAGCCCCATCCCCCACAGTCCAGCTCCGGGGAAG
GGGCTCTGGGAGGCATTTTCCTGCTTTGCCCCTTTTCTTCCTGACTTACTAATACTAAAGAAGTTGGGGGAGCTCGAGAGCCAGACGGCC
AGACAGGCAGACCCCTCCAGAGGCCCGCCAGGTGGGCATGGTCCCCCATTTTCTTTAAGGCAGCACCTGGAGTGGAGAGAGGCCACTCCC
TCTCCAGCCCCCGATGTGGACCCGGGGAGGGGAGGCTGAGGCGTTTGGCCCCGGCCTGGCCAGGAGAGGCCCATCCCCAGGGCAGTTTCA
GGTGCCGGCTGGGCCCTGAATGTCGAGGATAGTATATAGCCCGCTCCTGGGTCCTGGAGCTGTGGCCCTTTGTACTCGTGTTGTGTCCAT

>In-frame_FOSL1_ENST00000312562_chr11_65667712_-_SYT7_ENST00000539008_chr11_61295657_-_1147nt
ACGGGCCAAGGCGGCGCGTCTCGGGGGTGGAGCCTGGAGGTGACCGCGCCGCTGCAACGCCCCCACCCCCCGCGGTCGCAGTGGTTCAGC
CCGAGAACTTTTCATTCATAAAAAGAAAAGACTCCGCACGGCGCGGGTGAGTCAGAACCCAGCAGCCGTGTACCCCGCAGAGCCGCCAGC
CCCGGGCATGTTCCGAGACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGC
GCAGGCAGCCCAGCAGCTCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAG
TGTCGGCTACAACTTCCAGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGA
CCCCTTCGTCAAGATCTACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGA
GACCTTCCTCTTTGAAGGTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAA
CGACCCCATTGGGGAGGTGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGA
TGGGAGTGGGAGCCGAGGGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAA
CCTCAAAGCCATGGACATCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGAC
GGTGACGATGAAGAGGAACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCAT
CATCACTGTCATGGACAAGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAA

>In-frame_FOSL1_ENST00000312562_chr11_65667712_-_SYT7_ENST00000542836_chr11_61295657_-_1147nt
ACGGGCCAAGGCGGCGCGTCTCGGGGGTGGAGCCTGGAGGTGACCGCGCCGCTGCAACGCCCCCACCCCCCGCGGTCGCAGTGGTTCAGC
CCGAGAACTTTTCATTCATAAAAAGAAAAGACTCCGCACGGCGCGGGTGAGTCAGAACCCAGCAGCCGTGTACCCCGCAGAGCCGCCAGC
CCCGGGCATGTTCCGAGACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGC
GCAGGCAGCCCAGCAGCTCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAG
TGTCGGCTACAACTTCCAGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGA
CCCCTTCGTCAAGATCTACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGA
GACCTTCCTCTTTGAAGGTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAA
CGACCCCATTGGGGAGGTGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGA
TGGGAGTGGGAGCCGAGGGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAA
CCTCAAAGCCATGGACATCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGAC
GGTGACGATGAAGAGGAACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCAT
CATCACTGTCATGGACAAGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAA

>In-frame_FOSL1_ENST00000312562_chr11_65667712_-_SYT7_ENST00000542670_chr11_61295657_-_1147nt
ACGGGCCAAGGCGGCGCGTCTCGGGGGTGGAGCCTGGAGGTGACCGCGCCGCTGCAACGCCCCCACCCCCCGCGGTCGCAGTGGTTCAGC
CCGAGAACTTTTCATTCATAAAAAGAAAAGACTCCGCACGGCGCGGGTGAGTCAGAACCCAGCAGCCGTGTACCCCGCAGAGCCGCCAGC
CCCGGGCATGTTCCGAGACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGC
GCAGGCAGCCCAGCAGCTCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAG
TGTCGGCTACAACTTCCAGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGA
CCCCTTCGTCAAGATCTACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGA
GACCTTCCTCTTTGAAGGTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAA
CGACCCCATTGGGGAGGTGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGA
TGGGAGTGGGAGCCGAGGGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAA
CCTCAAAGCCATGGACATCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGAC
GGTGACGATGAAGAGGAACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCAT
CATCACTGTCATGGACAAGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAA

>In-frame_FOSL1_ENST00000312562_chr11_65667712_-_SYT7_ENST00000535826_chr11_61295657_-_1147nt
ACGGGCCAAGGCGGCGCGTCTCGGGGGTGGAGCCTGGAGGTGACCGCGCCGCTGCAACGCCCCCACCCCCCGCGGTCGCAGTGGTTCAGC
CCGAGAACTTTTCATTCATAAAAAGAAAAGACTCCGCACGGCGCGGGTGAGTCAGAACCCAGCAGCCGTGTACCCCGCAGAGCCGCCAGC
CCCGGGCATGTTCCGAGACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGC
GCAGGCAGCCCAGCAGCTCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAG
TGTCGGCTACAACTTCCAGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGA
CCCCTTCGTCAAGATCTACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGA
GACCTTCCTCTTTGAAGGTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAA
CGACCCCATTGGGGAGGTGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGA
TGGGAGTGGGAGCCGAGGGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAA
CCTCAAAGCCATGGACATCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGAC
GGTGACGATGAAGAGGAACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCAT
CATCACTGTCATGGACAAGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAA

>In-frame_FOSL1_ENST00000531493_chr11_65667712_-_SYT7_ENST00000263846_chr11_61295657_-_4354nt
ATAAAAAGAAAAGACTCCGCACGGCGCGGGTGAGTCAGAACCCAGCAGCCGTGTACCCCGCAGAGCCGCCAGCCCCGGGCATGTTCCGAG
ACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGCGCAGGCAGCCCAGCAGC
TCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAGTGTCGGCTACAACTTCC
AGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGACCCCTTCGTCAAGATCT
ACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGAGACCTTCCTCTTTGAAG
GTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAACGACCCCATTGGGGAGG
TGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGATGGGAGTGGGAGCCGAG
GGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAACCTCAAAGCCATGGACA
TCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGACGGTGACGATGAAGAGGA
ACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCATCATCACTGTCATGGACA
AGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAAGCACTGGAAGGACATGA
TTGCCCGTCCCCGGCAGCCCGTGGCCCAGTGGCACCAGCTGAAGGCCTGAGTGGGGCCAAGGGAGGCCCAGGGGGCCGAGGGCCCAGGTC
CCCATCATGCCCTCACCACTTTATGCACAACGCCCGGCCTGAGCCCCCTGCCATAGGGAGGGGAGGACCCTGAGGGCTCAGCCAGGGAGG
GGTCCCAGGACTCAACTGGGCCCCGTTTCTAGGAAGTACCAGCCCCATCCCCCACAGTCCAGCTCCGGGGAAGGGGCTCTGGGAGGCATT
TTCCTGCTTTGCCCCTTTTCTTCCTGACTTACTAATACTAAAGAAGTTGGGGGAGCTCGAGAGCCAGACGGCCAGACAGGCAGACCCCTC
CAGAGGCCCGCCAGGTGGGCATGGTCCCCCATTTTCTTTAAGGCAGCACCTGGAGTGGAGAGAGGCCACTCCCTCTCCAGCCCCCGATGT
GGACCCGGGGAGGGGAGGCTGAGGCGTTTGGCCCCGGCCTGGCCAGGAGAGGCCCATCCCCAGGGCAGTTTCAGGTGCCGGCTGGGCCCT
GAATGTCGAGGATAGTATATAGCCCGCTCCTGGGTCCTGGAGCTGTGGCCCTTTGTACTCGTGTTGTGTCCATTGTGTGTGTGCGTGGGG
ACAGAGGCCTGGAAATGCGGAGGACTATACAGAGAAGGCAGGTTTTGTGAAGGCCAGGCAGGGTTGGAGGCCGGGGGTGTGAGAGGAGAG
GCCCATAGGGCTGAGTGGGGTCGGGTGAGGCAGAGGTCAGAAACAGAAGAGCTGCAGTTGCTGGAGCTGGGCTGAGAACTGGGCTGCCTC
CTGCCATCCCCCCGTCTCCTCCCCTTCTCCCCTTGGTGCCCCCCTCTGCTCAGAATCTGAAGTAGTTCCCTCCTCAGCAATTTCATCTCT
TGAACACTGACTCACACCTTTTAGGCACCTACTGTGTGCATAGCATTCCACCAGGACTCATCTCCCTTCCTTCTCAGGGGGTCCCGAGCC
CCGACTAGCTTTGCCCTAACTCCTTCATCAAAAGACCCCCCGCCAGCTTCCCACACCTCATACGCAGCCACATCTGCCCTATTCTCCATG
CTTTCCAGCTTGCCTGCCCTTCCTCATCTCTCCCTGCCTGTGCAGACCTCCACCCTTCTTTCCTCCACCCCTCCATCCCCCAATGCTTGT
AGACCTTCCATTCATTCCGTCTCATCGTGCGTGGTCTCTGATCGTCCATCACCTGACCTTCTCCAGGACTGTCTTCTCACCCTTCCCCAC
TCCCTGGTCCCCGGGAGCAGCTCCTTCTGCCCGACTCACTCACAGTGCAGGGAAAGGAGGCAGGGAAAAGACCAGGATTCTGTGAGTTCT
GAGGTTGCCACACACAAAGAAGCTGTGGTTTCTCTGCCTCGGCCACTGATGAGACTAAAACTGGCTTCCCCTTGGAGACGGCAGATTTCA
GGCTGATCCCTGCTTAAGCCCTCTCATCCCCACGCTGGTCCTGGTATTGATACAAGACCCAGCTGGTGACAAAGCCTCCAATCCTGGGGG
TCCACGAGCCTGGGCCTGACATTCCCAGAACTACCGCCAGGTGGCGCCAGGCCCCCACAGTCTGTGGCCGTGGTCTTAGCCCCCAGTTCC
ACTCTGGATGGGCCTGTGACACCCCAAAGAGAAGAAGGGGACTCTGGATAGGGTCCCCACATCCAGGGCGTGGGGAGACCATTGGCATTT
GGGAACCATTTTCCTTCGAACGGCTTCCCCTTGAGCTGAGCATTCTGCTTGCTGCAGTAGACGGGTCGCCTTTTGCCCATACCGAAATTT
TCTGAAATTAAATCGCACACCCCCACCATTTCCTCTCCCTGGGATCTGGAGGAACATCATACATAGTAGGTGAATCGTTTTGTAGAGTGA
AGAATGCTAATGTAAAGCAAATAGTCACCCACGTTCCTTGTAAATCCAAATGTTTCTATATTGTAGCTTTGCTTAAAATGGGGTCGGCCC
CAACTGCATCCTCCTCTTTGGCGGGCTGGGGAGCGGCCCCCAGCCGGGACGGGAGGGCAGCGACCCCGAGGCCTCGTGGACGTGGGAGAG
AGTGTGGTGGGAAGTCTTGAGCGGAGGAGGGGATCTGCCCTTCTCCACTCCTCTCTTGGATCCGCCTCGGTTTCCTGTCCCCCCACCACC
CGCCTGCCCCGCGGAAGACCGCCCAGTGAGCCAGCCCCCACCTTCCAGGCGCCTTCGCCCTGGGGATCCAACCAACTTGTATCGAGTGGG
CGGGGCAACGGCTCCCCATTTTTCCCGAGCCCCGCCCACAGAGCTCTTAGCCAATCCTATGCAGAGAGCATCTCCTGGCAGGGGTCTCTT
CCCAACCAGACCCCACCCAGGCACATTAGCGACCAGGCTTGGGCTTCCCCAGCGCCCCACCACCACCACGTGCAGGTGGAGCTCTGGGAT
GCTATGTTGGGGCGGCAAGCGGTGGGCCGAGGGCCGGGTAGGCTAGCACGGGAGGTAAGGGTGGTATGGGATGGGGCGGGGGCGGTCTAG
GGCAATAGGAGAGCAGAGAATGGGGGAACTTGAGGGTGGGGGGAGGGCACCGGAGCCTTGCCACCATCCCAGGACTTTGGGCAAGTCACC
CGCACTCCCTGGGCCTCGGTTTCCCCATCTGTAAAATGATGGTAATAATACTTCACCTACCTCATAGGGGAGGTTGTGAGGCCACCATCA
CCTGACCTGGGGGTCAAGGCAGGAGGACTCCGAAGGTGCTACCCGTGAGCAAAGTGTAATTACCGAATCCTGACTGCAAGGCCCACCTGC
CCCTCCCCCACAGAGCCTCCAGAGCTAGCTGAGGCCAACGCAGGCCCATCCGTCTCTTCACTCTGTCGCAGGCCCTTTCATGGGCTTCGT
CTGCCATCTTTGTGGGTGCCCTAGACTTAGTCCTTATCTTGTCCTGGTTTCCTTTCTTGTGACCATCTCCCCATGAAAGTGCTGTACAAA
TTCCACCCGCCCCAGGACCCCCGCACCTGCCCTCTGGCACCAGATGCCAGGGAAGGGACAGAGGAAAACAGCCACAAACAAGCCAGGGGG
GCTCCCCGGAGCCCCAGGGGTGGGGATTGGTGGCCACTGTTTGTATGTTCTTGAGTGCAAGTGTTTTATAAAAAATAAAACAAAAACCCA
CCATCACAAAAAAAAAAATTTTGCAGCGAAGAGAAATGAAGAAAAACTGAAGAAAAAAAAAAAACAGGAAAAAAAGAACCATACAAAATT
TTTCCACCACACATACCCTCTAAGCCAGCAAGATTTCCTCTTTGCAAAATCATATTTTTGTGGGAATGGGCCCTGCTTTTTGTGGCAAGG

>In-frame_FOSL1_ENST00000531493_chr11_65667712_-_SYT7_ENST00000540677_chr11_61295657_-_1610nt
ATAAAAAGAAAAGACTCCGCACGGCGCGGGTGAGTCAGAACCCAGCAGCCGTGTACCCCGCAGAGCCGCCAGCCCCGGGCATGTTCCGAG
ACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGCGCAGGCAGCCCAGCAGC
TCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAGTGTCGGCTACAACTTCC
AGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGACCCCTTCGTCAAGATCT
ACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGAGACCTTCCTCTTTGAAG
GTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAACGACCCCATTGGGGAGG
TGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGATGGGAGTGGGAGCCGAG
GGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAACCTCAAAGCCATGGACA
TCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGACGGTGACGATGAAGAGGA
ACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCATCATCACTGTCATGGACA
AGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAAGCACTGGAAGGACATGA
TTGCCCGTCCCCGGCAGCCCGTGGCCCAGTGGCACCAGCTGAAGGCCTGAGTGGGGCCAAGGGAGGCCCAGGGGGCCGAGGGCCCAGGTC
CCCATCATGCCCTCACCACTTTATGCACAACGCCCGGCCTGAGCCCCCTGCCATAGGGAGGGGAGGACCCTGAGGGCTCAGCCAGGGAGG
GGTCCCAGGACTCAACTGGGCCCCGTTTCTAGGAAGTACCAGCCCCATCCCCCACAGTCCAGCTCCGGGGAAGGGGCTCTGGGAGGCATT
TTCCTGCTTTGCCCCTTTTCTTCCTGACTTACTAATACTAAAGAAGTTGGGGGAGCTCGAGAGCCAGACGGCCAGACAGGCAGACCCCTC
CAGAGGCCCGCCAGGTGGGCATGGTCCCCCATTTTCTTTAAGGCAGCACCTGGAGTGGAGAGAGGCCACTCCCTCTCCAGCCCCCGATGT
GGACCCGGGGAGGGGAGGCTGAGGCGTTTGGCCCCGGCCTGGCCAGGAGAGGCCCATCCCCAGGGCAGTTTCAGGTGCCGGCTGGGCCCT

>In-frame_FOSL1_ENST00000531493_chr11_65667712_-_SYT7_ENST00000539008_chr11_61295657_-_1040nt
ATAAAAAGAAAAGACTCCGCACGGCGCGGGTGAGTCAGAACCCAGCAGCCGTGTACCCCGCAGAGCCGCCAGCCCCGGGCATGTTCCGAG
ACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGCGCAGGCAGCCCAGCAGC
TCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAGTGTCGGCTACAACTTCC
AGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGACCCCTTCGTCAAGATCT
ACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGAGACCTTCCTCTTTGAAG
GTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAACGACCCCATTGGGGAGG
TGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGATGGGAGTGGGAGCCGAG
GGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAACCTCAAAGCCATGGACA
TCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGACGGTGACGATGAAGAGGA
ACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCATCATCACTGTCATGGACA
AGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAAGCACTGGAAGGACATGA

>In-frame_FOSL1_ENST00000531493_chr11_65667712_-_SYT7_ENST00000542836_chr11_61295657_-_1040nt
ATAAAAAGAAAAGACTCCGCACGGCGCGGGTGAGTCAGAACCCAGCAGCCGTGTACCCCGCAGAGCCGCCAGCCCCGGGCATGTTCCGAG
ACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGCGCAGGCAGCCCAGCAGC
TCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAGTGTCGGCTACAACTTCC
AGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGACCCCTTCGTCAAGATCT
ACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGAGACCTTCCTCTTTGAAG
GTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAACGACCCCATTGGGGAGG
TGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGATGGGAGTGGGAGCCGAG
GGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAACCTCAAAGCCATGGACA
TCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGACGGTGACGATGAAGAGGA
ACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCATCATCACTGTCATGGACA
AGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAAGCACTGGAAGGACATGA

>In-frame_FOSL1_ENST00000531493_chr11_65667712_-_SYT7_ENST00000542670_chr11_61295657_-_1040nt
ATAAAAAGAAAAGACTCCGCACGGCGCGGGTGAGTCAGAACCCAGCAGCCGTGTACCCCGCAGAGCCGCCAGCCCCGGGCATGTTCCGAG
ACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGCGCAGGCAGCCCAGCAGC
TCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAGTGTCGGCTACAACTTCC
AGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGACCCCTTCGTCAAGATCT
ACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGAGACCTTCCTCTTTGAAG
GTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAACGACCCCATTGGGGAGG
TGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGATGGGAGTGGGAGCCGAG
GGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAACCTCAAAGCCATGGACA
TCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGACGGTGACGATGAAGAGGA
ACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCATCATCACTGTCATGGACA
AGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAAGCACTGGAAGGACATGA

>In-frame_FOSL1_ENST00000531493_chr11_65667712_-_SYT7_ENST00000535826_chr11_61295657_-_1040nt
ATAAAAAGAAAAGACTCCGCACGGCGCGGGTGAGTCAGAACCCAGCAGCCGTGTACCCCGCAGAGCCGCCAGCCCCGGGCATGTTCCGAG
ACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGCGCAGGCAGCCCAGCAGC
TCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAGTGTCGGCTACAACTTCC
AGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGACCCCTTCGTCAAGATCT
ACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGAGACCTTCCTCTTTGAAG
GTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAACGACCCCATTGGGGAGG
TGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGATGGGAGTGGGAGCCGAG
GGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAACCTCAAAGCCATGGACA
TCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGACGGTGACGATGAAGAGGA
ACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCATCATCACTGTCATGGACA
AGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAAGCACTGGAAGGACATGA

>In-frame_FOSL1_ENST00000532401_chr11_65667712_-_SYT7_ENST00000263846_chr11_61295657_-_4354nt
ATAAAAAGAAAAGACTCCGCACGGCGCGGGTGAGTCAGAACCCAGCAGCCGTGTACCCCGCAGAGCCGCCAGCCCCGGGCATGTTCCGAG
ACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGCGCAGGCAGCCCAGCAGC
TCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAGTGTCGGCTACAACTTCC
AGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGACCCCTTCGTCAAGATCT
ACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGAGACCTTCCTCTTTGAAG
GTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAACGACCCCATTGGGGAGG
TGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGATGGGAGTGGGAGCCGAG
GGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAACCTCAAAGCCATGGACA
TCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGACGGTGACGATGAAGAGGA
ACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCATCATCACTGTCATGGACA
AGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAAGCACTGGAAGGACATGA
TTGCCCGTCCCCGGCAGCCCGTGGCCCAGTGGCACCAGCTGAAGGCCTGAGTGGGGCCAAGGGAGGCCCAGGGGGCCGAGGGCCCAGGTC
CCCATCATGCCCTCACCACTTTATGCACAACGCCCGGCCTGAGCCCCCTGCCATAGGGAGGGGAGGACCCTGAGGGCTCAGCCAGGGAGG
GGTCCCAGGACTCAACTGGGCCCCGTTTCTAGGAAGTACCAGCCCCATCCCCCACAGTCCAGCTCCGGGGAAGGGGCTCTGGGAGGCATT
TTCCTGCTTTGCCCCTTTTCTTCCTGACTTACTAATACTAAAGAAGTTGGGGGAGCTCGAGAGCCAGACGGCCAGACAGGCAGACCCCTC
CAGAGGCCCGCCAGGTGGGCATGGTCCCCCATTTTCTTTAAGGCAGCACCTGGAGTGGAGAGAGGCCACTCCCTCTCCAGCCCCCGATGT
GGACCCGGGGAGGGGAGGCTGAGGCGTTTGGCCCCGGCCTGGCCAGGAGAGGCCCATCCCCAGGGCAGTTTCAGGTGCCGGCTGGGCCCT
GAATGTCGAGGATAGTATATAGCCCGCTCCTGGGTCCTGGAGCTGTGGCCCTTTGTACTCGTGTTGTGTCCATTGTGTGTGTGCGTGGGG
ACAGAGGCCTGGAAATGCGGAGGACTATACAGAGAAGGCAGGTTTTGTGAAGGCCAGGCAGGGTTGGAGGCCGGGGGTGTGAGAGGAGAG
GCCCATAGGGCTGAGTGGGGTCGGGTGAGGCAGAGGTCAGAAACAGAAGAGCTGCAGTTGCTGGAGCTGGGCTGAGAACTGGGCTGCCTC
CTGCCATCCCCCCGTCTCCTCCCCTTCTCCCCTTGGTGCCCCCCTCTGCTCAGAATCTGAAGTAGTTCCCTCCTCAGCAATTTCATCTCT
TGAACACTGACTCACACCTTTTAGGCACCTACTGTGTGCATAGCATTCCACCAGGACTCATCTCCCTTCCTTCTCAGGGGGTCCCGAGCC
CCGACTAGCTTTGCCCTAACTCCTTCATCAAAAGACCCCCCGCCAGCTTCCCACACCTCATACGCAGCCACATCTGCCCTATTCTCCATG
CTTTCCAGCTTGCCTGCCCTTCCTCATCTCTCCCTGCCTGTGCAGACCTCCACCCTTCTTTCCTCCACCCCTCCATCCCCCAATGCTTGT
AGACCTTCCATTCATTCCGTCTCATCGTGCGTGGTCTCTGATCGTCCATCACCTGACCTTCTCCAGGACTGTCTTCTCACCCTTCCCCAC
TCCCTGGTCCCCGGGAGCAGCTCCTTCTGCCCGACTCACTCACAGTGCAGGGAAAGGAGGCAGGGAAAAGACCAGGATTCTGTGAGTTCT
GAGGTTGCCACACACAAAGAAGCTGTGGTTTCTCTGCCTCGGCCACTGATGAGACTAAAACTGGCTTCCCCTTGGAGACGGCAGATTTCA
GGCTGATCCCTGCTTAAGCCCTCTCATCCCCACGCTGGTCCTGGTATTGATACAAGACCCAGCTGGTGACAAAGCCTCCAATCCTGGGGG
TCCACGAGCCTGGGCCTGACATTCCCAGAACTACCGCCAGGTGGCGCCAGGCCCCCACAGTCTGTGGCCGTGGTCTTAGCCCCCAGTTCC
ACTCTGGATGGGCCTGTGACACCCCAAAGAGAAGAAGGGGACTCTGGATAGGGTCCCCACATCCAGGGCGTGGGGAGACCATTGGCATTT
GGGAACCATTTTCCTTCGAACGGCTTCCCCTTGAGCTGAGCATTCTGCTTGCTGCAGTAGACGGGTCGCCTTTTGCCCATACCGAAATTT
TCTGAAATTAAATCGCACACCCCCACCATTTCCTCTCCCTGGGATCTGGAGGAACATCATACATAGTAGGTGAATCGTTTTGTAGAGTGA
AGAATGCTAATGTAAAGCAAATAGTCACCCACGTTCCTTGTAAATCCAAATGTTTCTATATTGTAGCTTTGCTTAAAATGGGGTCGGCCC
CAACTGCATCCTCCTCTTTGGCGGGCTGGGGAGCGGCCCCCAGCCGGGACGGGAGGGCAGCGACCCCGAGGCCTCGTGGACGTGGGAGAG
AGTGTGGTGGGAAGTCTTGAGCGGAGGAGGGGATCTGCCCTTCTCCACTCCTCTCTTGGATCCGCCTCGGTTTCCTGTCCCCCCACCACC
CGCCTGCCCCGCGGAAGACCGCCCAGTGAGCCAGCCCCCACCTTCCAGGCGCCTTCGCCCTGGGGATCCAACCAACTTGTATCGAGTGGG
CGGGGCAACGGCTCCCCATTTTTCCCGAGCCCCGCCCACAGAGCTCTTAGCCAATCCTATGCAGAGAGCATCTCCTGGCAGGGGTCTCTT
CCCAACCAGACCCCACCCAGGCACATTAGCGACCAGGCTTGGGCTTCCCCAGCGCCCCACCACCACCACGTGCAGGTGGAGCTCTGGGAT
GCTATGTTGGGGCGGCAAGCGGTGGGCCGAGGGCCGGGTAGGCTAGCACGGGAGGTAAGGGTGGTATGGGATGGGGCGGGGGCGGTCTAG
GGCAATAGGAGAGCAGAGAATGGGGGAACTTGAGGGTGGGGGGAGGGCACCGGAGCCTTGCCACCATCCCAGGACTTTGGGCAAGTCACC
CGCACTCCCTGGGCCTCGGTTTCCCCATCTGTAAAATGATGGTAATAATACTTCACCTACCTCATAGGGGAGGTTGTGAGGCCACCATCA
CCTGACCTGGGGGTCAAGGCAGGAGGACTCCGAAGGTGCTACCCGTGAGCAAAGTGTAATTACCGAATCCTGACTGCAAGGCCCACCTGC
CCCTCCCCCACAGAGCCTCCAGAGCTAGCTGAGGCCAACGCAGGCCCATCCGTCTCTTCACTCTGTCGCAGGCCCTTTCATGGGCTTCGT
CTGCCATCTTTGTGGGTGCCCTAGACTTAGTCCTTATCTTGTCCTGGTTTCCTTTCTTGTGACCATCTCCCCATGAAAGTGCTGTACAAA
TTCCACCCGCCCCAGGACCCCCGCACCTGCCCTCTGGCACCAGATGCCAGGGAAGGGACAGAGGAAAACAGCCACAAACAAGCCAGGGGG
GCTCCCCGGAGCCCCAGGGGTGGGGATTGGTGGCCACTGTTTGTATGTTCTTGAGTGCAAGTGTTTTATAAAAAATAAAACAAAAACCCA
CCATCACAAAAAAAAAAATTTTGCAGCGAAGAGAAATGAAGAAAAACTGAAGAAAAAAAAAAAACAGGAAAAAAAGAACCATACAAAATT
TTTCCACCACACATACCCTCTAAGCCAGCAAGATTTCCTCTTTGCAAAATCATATTTTTGTGGGAATGGGCCCTGCTTTTTGTGGCAAGG

>In-frame_FOSL1_ENST00000532401_chr11_65667712_-_SYT7_ENST00000540677_chr11_61295657_-_1610nt
ATAAAAAGAAAAGACTCCGCACGGCGCGGGTGAGTCAGAACCCAGCAGCCGTGTACCCCGCAGAGCCGCCAGCCCCGGGCATGTTCCGAG
ACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGCGCAGGCAGCCCAGCAGC
TCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAGTGTCGGCTACAACTTCC
AGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGACCCCTTCGTCAAGATCT
ACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGAGACCTTCCTCTTTGAAG
GTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAACGACCCCATTGGGGAGG
TGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGATGGGAGTGGGAGCCGAG
GGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAACCTCAAAGCCATGGACA
TCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGACGGTGACGATGAAGAGGA
ACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCATCATCACTGTCATGGACA
AGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAAGCACTGGAAGGACATGA
TTGCCCGTCCCCGGCAGCCCGTGGCCCAGTGGCACCAGCTGAAGGCCTGAGTGGGGCCAAGGGAGGCCCAGGGGGCCGAGGGCCCAGGTC
CCCATCATGCCCTCACCACTTTATGCACAACGCCCGGCCTGAGCCCCCTGCCATAGGGAGGGGAGGACCCTGAGGGCTCAGCCAGGGAGG
GGTCCCAGGACTCAACTGGGCCCCGTTTCTAGGAAGTACCAGCCCCATCCCCCACAGTCCAGCTCCGGGGAAGGGGCTCTGGGAGGCATT
TTCCTGCTTTGCCCCTTTTCTTCCTGACTTACTAATACTAAAGAAGTTGGGGGAGCTCGAGAGCCAGACGGCCAGACAGGCAGACCCCTC
CAGAGGCCCGCCAGGTGGGCATGGTCCCCCATTTTCTTTAAGGCAGCACCTGGAGTGGAGAGAGGCCACTCCCTCTCCAGCCCCCGATGT
GGACCCGGGGAGGGGAGGCTGAGGCGTTTGGCCCCGGCCTGGCCAGGAGAGGCCCATCCCCAGGGCAGTTTCAGGTGCCGGCTGGGCCCT

>In-frame_FOSL1_ENST00000532401_chr11_65667712_-_SYT7_ENST00000539008_chr11_61295657_-_1040nt
ATAAAAAGAAAAGACTCCGCACGGCGCGGGTGAGTCAGAACCCAGCAGCCGTGTACCCCGCAGAGCCGCCAGCCCCGGGCATGTTCCGAG
ACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGCGCAGGCAGCCCAGCAGC
TCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAGTGTCGGCTACAACTTCC
AGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGACCCCTTCGTCAAGATCT
ACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGAGACCTTCCTCTTTGAAG
GTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAACGACCCCATTGGGGAGG
TGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGATGGGAGTGGGAGCCGAG
GGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAACCTCAAAGCCATGGACA
TCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGACGGTGACGATGAAGAGGA
ACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCATCATCACTGTCATGGACA
AGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAAGCACTGGAAGGACATGA

>In-frame_FOSL1_ENST00000532401_chr11_65667712_-_SYT7_ENST00000542836_chr11_61295657_-_1040nt
ATAAAAAGAAAAGACTCCGCACGGCGCGGGTGAGTCAGAACCCAGCAGCCGTGTACCCCGCAGAGCCGCCAGCCCCGGGCATGTTCCGAG
ACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGCGCAGGCAGCCCAGCAGC
TCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAGTGTCGGCTACAACTTCC
AGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGACCCCTTCGTCAAGATCT
ACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGAGACCTTCCTCTTTGAAG
GTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAACGACCCCATTGGGGAGG
TGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGATGGGAGTGGGAGCCGAG
GGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAACCTCAAAGCCATGGACA
TCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGACGGTGACGATGAAGAGGA
ACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCATCATCACTGTCATGGACA
AGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAAGCACTGGAAGGACATGA

>In-frame_FOSL1_ENST00000532401_chr11_65667712_-_SYT7_ENST00000542670_chr11_61295657_-_1040nt
ATAAAAAGAAAAGACTCCGCACGGCGCGGGTGAGTCAGAACCCAGCAGCCGTGTACCCCGCAGAGCCGCCAGCCCCGGGCATGTTCCGAG
ACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGCGCAGGCAGCCCAGCAGC
TCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAGTGTCGGCTACAACTTCC
AGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGACCCCTTCGTCAAGATCT
ACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGAGACCTTCCTCTTTGAAG
GTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAACGACCCCATTGGGGAGG
TGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGATGGGAGTGGGAGCCGAG
GGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAACCTCAAAGCCATGGACA
TCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGACGGTGACGATGAAGAGGA
ACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCATCATCACTGTCATGGACA
AGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAAGCACTGGAAGGACATGA

>In-frame_FOSL1_ENST00000532401_chr11_65667712_-_SYT7_ENST00000535826_chr11_61295657_-_1040nt
ATAAAAAGAAAAGACTCCGCACGGCGCGGGTGAGTCAGAACCCAGCAGCCGTGTACCCCGCAGAGCCGCCAGCCCCGGGCATGTTCCGAG
ACTTCGGGGAACCCGGCCCGAGCTCCGGGAACGGCGGCGGGTACGGCGGCCCCGCGCAGCCCCCGGCCGCAGCGCAGGCAGCCCAGCAGC
TCTCCCCAGGCTCCGAGGAGGATGAGGCCCACGAGGGTTGCAGCCGAGAGAACCTGGGCCGGATCCAGTTCAGTGTCGGCTACAACTTCC
AGGAGTCCACGCTCACCGTGAAGATCATGAAGGCCCAGGAGCTGCCGGCCAAGGACTTCAGCGGCACCAGCGACCCCTTCGTCAAGATCT
ACCTGCTGCCCGACAAGAAGCACAAGCTGGAGACCAAGGTGAAGCGGAAGAACCTGAACCCCCACTGGAACGAGACCTTCCTCTTTGAAG
GTTTTCCCTATGAGAAGGTGGTGCAGAGGATCCTCTACCTCCAAGTCCTGGACTATGACCGCTTCAGCCGCAACGACCCCATTGGGGAGG
TGTCCATCCCCCTTAACAAGGTGGACCTGACCCAGATGCAGACCTTCTGGAAGGATCTGAAGCCATGCAGCGATGGGAGTGGGAGCCGAG
GGGAGCTGCTCTTGTCTCTCTGCTACAACCCCTCTGCCAACTCCATCATCGTGAACATCATCAAAGCCCGGAACCTCAAAGCCATGGACA
TCGGGGGCACATCAGACCCCTACGTGAAGGTATGGCTGATGTACAAGGACAAGCGGGTGGAGAAGAAGAAGACGGTGACGATGAAGAGGA
ACCTGAACCCCATCTTCAATGAGTCCTTCGCCTTCGATATCCCCACGGAGAAGCTGAGGGAGACGACCATCATCATCACTGTCATGGACA
AGGACAAGCTCAGCCGCAATGACGTCATCGGCAAGATCTACCTGTCCTGGAAGAGCGGGCCAGGGGAGGTGAAGCACTGGAAGGACATGA


Top

FusionGenePPI for FOSL1_SYT7


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
FOSL1LDOC1, CALCOCO1, JUNB, USF1, JUN, TRIM24, HDAC1, CREBBP, EP300, PSMC3, ATXN1, MYC, MAFB, MAF, ATF3, ATF4, ATF2, CEBPE, CEBPA, CEBPG, DDIT3, PARVG, KPNA1, TAB2, WFDC1, CREB5, NME7, DNMT3L, TICAM1, TRAF3SYT7SYNCRIP, SIAH1, MOV10, CDH1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for FOSL1_SYT7


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for FOSL1_SYT7


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource