FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 13713

FusionGeneSummary for FNIP2_RXFP1

check button Fusion gene summary
Fusion gene informationFusion gene name: FNIP2_RXFP1
Fusion gene ID: 13713
HgeneTgene
Gene symbol

FNIP2

RXFP1

Gene ID

57600

59350

Gene namefolliculin interacting protein 2relaxin family peptide receptor 1
SynonymsFNIPL|MAPO1LGR7|RXFPR1
Cytomap

4q32.1

4q32.1

Type of geneprotein-codingprotein-coding
Descriptionfolliculin-interacting protein 2FNIP1-like proteinO6-methylguanine-induced apoptosis 1 proteinrelaxin receptor 1leucine-rich repeat-containing G protein-coupled receptor 7relaxin/insulin like family peptide receptor 1
Modification date2018051920180523
UniProtAcc

Q9P278

Q9HBX9

Ensembl transtripts involved in fusion geneENST00000264433, ENST00000379346, 
ENST00000505445, 
ENST00000460056, 
ENST00000307765, ENST00000423548, 
ENST00000448688, ENST00000343542, 
ENST00000470033, ENST00000472969, 
Fusion gene scores* DoF score9 X 5 X 6=2702 X 2 X 2=8
# samples 92
** MAII scorelog2(9/270*10)=-1.58496250072116
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/8*10)=1.32192809488736
Context

PubMed: FNIP2 [Title/Abstract] AND RXFP1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneFNIP2

GO:0000122

negative regulation of transcription by RNA polymerase II

21209915

HgeneFNIP2

GO:0001932

regulation of protein phosphorylation

18663353

HgeneFNIP2

GO:0006468

protein phosphorylation

18663353

HgeneFNIP2

GO:0031334

positive regulation of protein complex assembly

25126726

HgeneFNIP2

GO:0033138

positive regulation of peptidyl-serine phosphorylation

19914239


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVUCSTCGA-NA-A4QY-01AFNIP2chr4

159690471

+RXFP1chr4

159559160

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000264433ENST00000460056FNIP2chr4

159690471

+RXFP1chr4

159559160

+
In-frameENST00000264433ENST00000307765FNIP2chr4

159690471

+RXFP1chr4

159559160

+
5CDS-intronENST00000264433ENST00000423548FNIP2chr4

159690471

+RXFP1chr4

159559160

+
5CDS-intronENST00000264433ENST00000448688FNIP2chr4

159690471

+RXFP1chr4

159559160

+
5CDS-intronENST00000264433ENST00000343542FNIP2chr4

159690471

+RXFP1chr4

159559160

+
5CDS-intronENST00000264433ENST00000470033FNIP2chr4

159690471

+RXFP1chr4

159559160

+
5CDS-intronENST00000264433ENST00000472969FNIP2chr4

159690471

+RXFP1chr4

159559160

+
intron-3CDSENST00000379346ENST00000460056FNIP2chr4

159690471

+RXFP1chr4

159559160

+
intron-3CDSENST00000379346ENST00000307765FNIP2chr4

159690471

+RXFP1chr4

159559160

+
intron-intronENST00000379346ENST00000423548FNIP2chr4

159690471

+RXFP1chr4

159559160

+
intron-intronENST00000379346ENST00000448688FNIP2chr4

159690471

+RXFP1chr4

159559160

+
intron-intronENST00000379346ENST00000343542FNIP2chr4

159690471

+RXFP1chr4

159559160

+
intron-intronENST00000379346ENST00000470033FNIP2chr4

159690471

+RXFP1chr4

159559160

+
intron-intronENST00000379346ENST00000472969FNIP2chr4

159690471

+RXFP1chr4

159559160

+
intron-3CDSENST00000505445ENST00000460056FNIP2chr4

159690471

+RXFP1chr4

159559160

+
intron-3CDSENST00000505445ENST00000307765FNIP2chr4

159690471

+RXFP1chr4

159559160

+
intron-intronENST00000505445ENST00000423548FNIP2chr4

159690471

+RXFP1chr4

159559160

+
intron-intronENST00000505445ENST00000448688FNIP2chr4

159690471

+RXFP1chr4

159559160

+
intron-intronENST00000505445ENST00000343542FNIP2chr4

159690471

+RXFP1chr4

159559160

+
intron-intronENST00000505445ENST00000470033FNIP2chr4

159690471

+RXFP1chr4

159559160

+
intron-intronENST00000505445ENST00000472969FNIP2chr4

159690471

+RXFP1chr4

159559160

+

Top

FusionProtFeatures for FNIP2_RXFP1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
FNIP2

Q9P278

RXFP1

Q9HBX9

Acts as a co-chaperone of HSP90AA1. Inhibits the ATPaseactivity of HSP90AA1 leading to reduction in its chaperoneactivity. Facilitates the binding of client protein FLCN toHSP90AA1 (PubMed:27353360). May play a role in the signaltransduction pathway of apoptosis induced by O6-methylguanine-mispaired lesions (By similarity). May be involved in energyand/or nutrient sensing through the AMPK and mTOR signalingpathways (PubMed:18403135). May regulate phosphorylation ofRPS6KB1 (PubMed:18663353). {ECO:0000250|UniProtKB:Q80TD3,ECO:0000269|PubMed:18403135, ECO:0000269|PubMed:18663353,ECO:0000269|PubMed:27353360}. Receptor for relaxins. The activity of this receptor ismediated by G proteins leading to stimulation of adenylate cyclaseand an increase of cAMP. Binding of the ligand may also activate atyrosine kinase pathway that inhibits the activity of aphosphodiesterase that degrades cAMP.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneRXFP1chr4:159690471chr4:159559160ENST00000343542+01626_630710DomainLDL-receptor class A
TgeneRXFP1chr4:159690471chr4:159559160ENST00000343542+01691_1270710DomainNote=LRRNT
TgeneRXFP1chr4:159690471chr4:159559160ENST00000423548+0726_63-67190DomainLDL-receptor class A
TgeneRXFP1chr4:159690471chr4:159559160ENST00000423548+0791_127-67190DomainNote=LRRNT
TgeneRXFP1chr4:159690471chr4:159559160ENST00000307765+1118320_341323758RepeatNote=LRR 8
TgeneRXFP1chr4:159690471chr4:159559160ENST00000307765+1118344_365323758RepeatNote=LRR 9
TgeneRXFP1chr4:159690471chr4:159559160ENST00000343542+016151_1720710RepeatNote=LRR 1
TgeneRXFP1chr4:159690471chr4:159559160ENST00000343542+016175_1960710RepeatNote=LRR 2
TgeneRXFP1chr4:159690471chr4:159559160ENST00000343542+016199_2200710RepeatNote=LRR 3
TgeneRXFP1chr4:159690471chr4:159559160ENST00000343542+016223_2440710RepeatNote=LRR 4
TgeneRXFP1chr4:159690471chr4:159559160ENST00000343542+016248_2690710RepeatNote=LRR 5
TgeneRXFP1chr4:159690471chr4:159559160ENST00000343542+016272_2930710RepeatNote=LRR 6
TgeneRXFP1chr4:159690471chr4:159559160ENST00000343542+016296_3170710RepeatNote=LRR 7
TgeneRXFP1chr4:159690471chr4:159559160ENST00000343542+016320_3410710RepeatNote=LRR 8
TgeneRXFP1chr4:159690471chr4:159559160ENST00000343542+016344_3650710RepeatNote=LRR 9
TgeneRXFP1chr4:159690471chr4:159559160ENST00000423548+07151_172-67190RepeatNote=LRR 1
TgeneRXFP1chr4:159690471chr4:159559160ENST00000423548+07175_196-67190RepeatNote=LRR 2
TgeneRXFP1chr4:159690471chr4:159559160ENST00000423548+07199_220-67190RepeatNote=LRR 3
TgeneRXFP1chr4:159690471chr4:159559160ENST00000423548+07223_244-67190RepeatNote=LRR 4
TgeneRXFP1chr4:159690471chr4:159559160ENST00000423548+07248_269-67190RepeatNote=LRR 5
TgeneRXFP1chr4:159690471chr4:159559160ENST00000423548+07272_293-67190RepeatNote=LRR 6
TgeneRXFP1chr4:159690471chr4:159559160ENST00000423548+07296_317-67190RepeatNote=LRR 7
TgeneRXFP1chr4:159690471chr4:159559160ENST00000423548+07320_341-67190RepeatNote=LRR 8
TgeneRXFP1chr4:159690471chr4:159559160ENST00000423548+07344_365-67190RepeatNote=LRR 9
TgeneRXFP1chr4:159690471chr4:159559160ENST00000470033+1017296_317290725RepeatNote=LRR 7
TgeneRXFP1chr4:159690471chr4:159559160ENST00000470033+1017320_341290725RepeatNote=LRR 8
TgeneRXFP1chr4:159690471chr4:159559160ENST00000470033+1017344_365290725RepeatNote=LRR 9
TgeneRXFP1chr4:159690471chr4:159559160ENST00000307765+1118431_443323758Topological domainCytoplasmic
TgeneRXFP1chr4:159690471chr4:159559160ENST00000307765+1118465_486323758Topological domainExtracellular
TgeneRXFP1chr4:159690471chr4:159559160ENST00000307765+1118508_527323758Topological domainCytoplasmic
TgeneRXFP1chr4:159690471chr4:159559160ENST00000307765+1118549_577323758Topological domainExtracellular
TgeneRXFP1chr4:159690471chr4:159559160ENST00000307765+1118599_629323758Topological domainCytoplasmic
TgeneRXFP1chr4:159690471chr4:159559160ENST00000307765+1118651_651323758Topological domainExtracellular
TgeneRXFP1chr4:159690471chr4:159559160ENST00000307765+1118673_757323758Topological domainCytoplasmic
TgeneRXFP1chr4:159690471chr4:159559160ENST00000343542+0161_4090710Topological domainExtracellular
TgeneRXFP1chr4:159690471chr4:159559160ENST00000343542+016431_4430710Topological domainCytoplasmic
TgeneRXFP1chr4:159690471chr4:159559160ENST00000343542+016465_4860710Topological domainExtracellular
TgeneRXFP1chr4:159690471chr4:159559160ENST00000343542+016508_5270710Topological domainCytoplasmic
TgeneRXFP1chr4:159690471chr4:159559160ENST00000343542+016549_5770710Topological domainExtracellular
TgeneRXFP1chr4:159690471chr4:159559160ENST00000343542+016599_6290710Topological domainCytoplasmic
TgeneRXFP1chr4:159690471chr4:159559160ENST00000343542+016651_6510710Topological domainExtracellular
TgeneRXFP1chr4:159690471chr4:159559160ENST00000343542+016673_7570710Topological domainCytoplasmic
TgeneRXFP1chr4:159690471chr4:159559160ENST00000423548+071_409-67190Topological domainExtracellular
TgeneRXFP1chr4:159690471chr4:159559160ENST00000423548+07431_443-67190Topological domainCytoplasmic
TgeneRXFP1chr4:159690471chr4:159559160ENST00000423548+07465_486-67190Topological domainExtracellular
TgeneRXFP1chr4:159690471chr4:159559160ENST00000423548+07508_527-67190Topological domainCytoplasmic
TgeneRXFP1chr4:159690471chr4:159559160ENST00000423548+07549_577-67190Topological domainExtracellular
TgeneRXFP1chr4:159690471chr4:159559160ENST00000423548+07599_629-67190Topological domainCytoplasmic
TgeneRXFP1chr4:159690471chr4:159559160ENST00000423548+07651_651-67190Topological domainExtracellular
TgeneRXFP1chr4:159690471chr4:159559160ENST00000423548+07673_757-67190Topological domainCytoplasmic
TgeneRXFP1chr4:159690471chr4:159559160ENST00000470033+1017431_443290725Topological domainCytoplasmic
TgeneRXFP1chr4:159690471chr4:159559160ENST00000470033+1017465_486290725Topological domainExtracellular
TgeneRXFP1chr4:159690471chr4:159559160ENST00000470033+1017508_527290725Topological domainCytoplasmic
TgeneRXFP1chr4:159690471chr4:159559160ENST00000470033+1017549_577290725Topological domainExtracellular
TgeneRXFP1chr4:159690471chr4:159559160ENST00000470033+1017599_629290725Topological domainCytoplasmic
TgeneRXFP1chr4:159690471chr4:159559160ENST00000470033+1017651_651290725Topological domainExtracellular
TgeneRXFP1chr4:159690471chr4:159559160ENST00000470033+1017673_757290725Topological domainCytoplasmic
TgeneRXFP1chr4:159690471chr4:159559160ENST00000307765+1118410_430323758TransmembraneHelical%3B Name%3D1
TgeneRXFP1chr4:159690471chr4:159559160ENST00000307765+1118444_464323758TransmembraneHelical%3B Name%3D2
TgeneRXFP1chr4:159690471chr4:159559160ENST00000307765+1118487_507323758TransmembraneHelical%3B Name%3D3
TgeneRXFP1chr4:159690471chr4:159559160ENST00000307765+1118528_548323758TransmembraneHelical%3B Name%3D4
TgeneRXFP1chr4:159690471chr4:159559160ENST00000307765+1118578_598323758TransmembraneHelical%3B Name%3D5
TgeneRXFP1chr4:159690471chr4:159559160ENST00000307765+1118630_650323758TransmembraneHelical%3B Name%3D6
TgeneRXFP1chr4:159690471chr4:159559160ENST00000307765+1118652_672323758TransmembraneHelical%3B Name%3D7
TgeneRXFP1chr4:159690471chr4:159559160ENST00000343542+016410_4300710TransmembraneHelical%3B Name%3D1
TgeneRXFP1chr4:159690471chr4:159559160ENST00000343542+016444_4640710TransmembraneHelical%3B Name%3D2
TgeneRXFP1chr4:159690471chr4:159559160ENST00000343542+016487_5070710TransmembraneHelical%3B Name%3D3
TgeneRXFP1chr4:159690471chr4:159559160ENST00000343542+016528_5480710TransmembraneHelical%3B Name%3D4
TgeneRXFP1chr4:159690471chr4:159559160ENST00000343542+016578_5980710TransmembraneHelical%3B Name%3D5
TgeneRXFP1chr4:159690471chr4:159559160ENST00000343542+016630_6500710TransmembraneHelical%3B Name%3D6
TgeneRXFP1chr4:159690471chr4:159559160ENST00000343542+016652_6720710TransmembraneHelical%3B Name%3D7
TgeneRXFP1chr4:159690471chr4:159559160ENST00000423548+07410_430-67190TransmembraneHelical%3B Name%3D1
TgeneRXFP1chr4:159690471chr4:159559160ENST00000423548+07444_464-67190TransmembraneHelical%3B Name%3D2
TgeneRXFP1chr4:159690471chr4:159559160ENST00000423548+07487_507-67190TransmembraneHelical%3B Name%3D3
TgeneRXFP1chr4:159690471chr4:159559160ENST00000423548+07528_548-67190TransmembraneHelical%3B Name%3D4
TgeneRXFP1chr4:159690471chr4:159559160ENST00000423548+07578_598-67190TransmembraneHelical%3B Name%3D5
TgeneRXFP1chr4:159690471chr4:159559160ENST00000423548+07630_650-67190TransmembraneHelical%3B Name%3D6
TgeneRXFP1chr4:159690471chr4:159559160ENST00000423548+07652_672-67190TransmembraneHelical%3B Name%3D7
TgeneRXFP1chr4:159690471chr4:159559160ENST00000470033+1017410_430290725TransmembraneHelical%3B Name%3D1
TgeneRXFP1chr4:159690471chr4:159559160ENST00000470033+1017444_464290725TransmembraneHelical%3B Name%3D2
TgeneRXFP1chr4:159690471chr4:159559160ENST00000470033+1017487_507290725TransmembraneHelical%3B Name%3D3
TgeneRXFP1chr4:159690471chr4:159559160ENST00000470033+1017528_548290725TransmembraneHelical%3B Name%3D4
TgeneRXFP1chr4:159690471chr4:159559160ENST00000470033+1017578_598290725TransmembraneHelical%3B Name%3D5
TgeneRXFP1chr4:159690471chr4:159559160ENST00000470033+1017630_650290725TransmembraneHelical%3B Name%3D6
TgeneRXFP1chr4:159690471chr4:159559160ENST00000470033+1017652_672290725TransmembraneHelical%3B Name%3D7

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneFNIP2chr4:159690471chr4:159559160ENST00000264433+117242_265351115Compositional biasNote=Ser-rich
HgeneFNIP2chr4:159690471chr4:159559160ENST00000264433+11795_116351115Compositional biasNote=Ser-rich
HgeneFNIP2chr4:159690471chr4:159559160ENST00000379346+117242_26501138Compositional biasNote=Ser-rich
HgeneFNIP2chr4:159690471chr4:159559160ENST00000379346+11795_11601138Compositional biasNote=Ser-rich
HgeneFNIP2chr4:159690471chr4:159559160ENST00000264433+1171050_1105351115DomaindDENN FNIP1/2-type
HgeneFNIP2chr4:159690471chr4:159559160ENST00000264433+11742_460351115DomainuDENN FNIP1/2-type
HgeneFNIP2chr4:159690471chr4:159559160ENST00000264433+117468_1040351115DomaincDENN FNIP1/2-type
HgeneFNIP2chr4:159690471chr4:159559160ENST00000379346+1171050_110501138DomaindDENN FNIP1/2-type
HgeneFNIP2chr4:159690471chr4:159559160ENST00000379346+11742_46001138DomainuDENN FNIP1/2-type
HgeneFNIP2chr4:159690471chr4:159559160ENST00000379346+117468_104001138DomaincDENN FNIP1/2-type
TgeneRXFP1chr4:159690471chr4:159559160ENST00000307765+111826_63323758DomainLDL-receptor class A
TgeneRXFP1chr4:159690471chr4:159559160ENST00000307765+111891_127323758DomainNote=LRRNT
TgeneRXFP1chr4:159690471chr4:159559160ENST00000470033+101726_63290725DomainLDL-receptor class A
TgeneRXFP1chr4:159690471chr4:159559160ENST00000470033+101791_127290725DomainNote=LRRNT
TgeneRXFP1chr4:159690471chr4:159559160ENST00000307765+1118151_172323758RepeatNote=LRR 1
TgeneRXFP1chr4:159690471chr4:159559160ENST00000307765+1118175_196323758RepeatNote=LRR 2
TgeneRXFP1chr4:159690471chr4:159559160ENST00000307765+1118199_220323758RepeatNote=LRR 3
TgeneRXFP1chr4:159690471chr4:159559160ENST00000307765+1118223_244323758RepeatNote=LRR 4
TgeneRXFP1chr4:159690471chr4:159559160ENST00000307765+1118248_269323758RepeatNote=LRR 5
TgeneRXFP1chr4:159690471chr4:159559160ENST00000307765+1118272_293323758RepeatNote=LRR 6
TgeneRXFP1chr4:159690471chr4:159559160ENST00000307765+1118296_317323758RepeatNote=LRR 7
TgeneRXFP1chr4:159690471chr4:159559160ENST00000470033+1017151_172290725RepeatNote=LRR 1
TgeneRXFP1chr4:159690471chr4:159559160ENST00000470033+1017175_196290725RepeatNote=LRR 2
TgeneRXFP1chr4:159690471chr4:159559160ENST00000470033+1017199_220290725RepeatNote=LRR 3
TgeneRXFP1chr4:159690471chr4:159559160ENST00000470033+1017223_244290725RepeatNote=LRR 4
TgeneRXFP1chr4:159690471chr4:159559160ENST00000470033+1017248_269290725RepeatNote=LRR 5
TgeneRXFP1chr4:159690471chr4:159559160ENST00000470033+1017272_293290725RepeatNote=LRR 6
TgeneRXFP1chr4:159690471chr4:159559160ENST00000307765+11181_409323758Topological domainExtracellular
TgeneRXFP1chr4:159690471chr4:159559160ENST00000470033+10171_409290725Topological domainExtracellular


Top

FusionGeneSequence for FNIP2_RXFP1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_FNIP2_ENST00000264433_chr4_159690471_+_RXFP1_ENST00000460056_chr4_159559160_+_470aa
MAPTLLQKLFNKRGSSGSSAAASAQGRAPKEGPAFRNLSYNPIQKIQANQFDYLVKLKSLSLEGIEISNIQQRMFRPLMNLSHIYFKKFQ
YCGYAPHVRSCKPNTDGISSLENLLASIIQRVFVWVVSAVTCFGNIFVICMRPYIRSENKLYAMSIISLCCADCLMGIYLFVIGGFDLKF
RGEYNKHAQLWMESTHCQLVGSLAILSTEVSVLLLTFLTLEKYICIVYPFRCVRPGKCRTITVLILIWITGFIVAFIPLSNKEFFKNYYG
TNGVCFPLHSEDTESIGAQIYSVAIFLGINLAAFIIIVFSYGSMFYSVHQSAITATEIRNQVKKEMILAKRFFFIVFTDALCWIPIFVVK
FLSLLQVEIPGTITSWVVIFILPINSALNPILYTLTTRPFKEMIHRFWYNYRQRKSMDSKGQKTYAPSFIWVEMWPLQEMPPELMKPDLF

>In-frame_FNIP2_ENST00000264433_chr4_159690471_+_RXFP1_ENST00000307765_chr4_159559160_+_470aa
MAPTLLQKLFNKRGSSGSSAAASAQGRAPKEGPAFRNLSYNPIQKIQANQFDYLVKLKSLSLEGIEISNIQQRMFRPLMNLSHIYFKKFQ
YCGYAPHVRSCKPNTDGISSLENLLASIIQRVFVWVVSAVTCFGNIFVICMRPYIRSENKLYAMSIISLCCADCLMGIYLFVIGGFDLKF
RGEYNKHAQLWMESTHCQLVGSLAILSTEVSVLLLTFLTLEKYICIVYPFRCVRPGKCRTITVLILIWITGFIVAFIPLSNKEFFKNYYG
TNGVCFPLHSEDTESIGAQIYSVAIFLGINLAAFIIIVFSYGSMFYSVHQSAITATEIRNQVKKEMILAKRFFFIVFTDALCWIPIFVVK
FLSLLQVEIPGTITSWVVIFILPINSALNPILYTLTTRPFKEMIHRFWYNYRQRKSMDSKGQKTYAPSFIWVEMWPLQEMPPELMKPDLF


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_FNIP2_ENST00000264433_chr4_159690471_+_RXFP1_ENST00000460056_chr4_159559160_+_1410nt
ATGGCCCCGACCCTGCTCCAGAAGCTCTTCAACAAAAGGGGCAGCAGCGGCAGCTCCGCGGCGGCGTCTGCCCAGGGCAGGGCTCCTAAG
GAAGGACCCGCCTTTAGGAATCTTTCCTATAATCCAATCCAGAAAATTCAAGCAAACCAATTTGATTATCTTGTCAAACTCAAGTCTCTC
AGCCTAGAAGGGATTGAAATTTCAAATATCCAACAAAGGATGTTTAGACCTCTTATGAATCTCTCTCACATATATTTTAAGAAATTCCAG
TACTGTGGGTATGCACCACATGTTCGCAGCTGTAAACCAAACACTGATGGAATTTCATCTCTAGAGAATCTCTTGGCAAGCATTATTCAG
AGAGTATTTGTCTGGGTTGTATCTGCAGTTACCTGCTTTGGAAACATTTTTGTCATTTGCATGCGACCTTATATCAGGTCTGAGAACAAG
CTGTATGCCATGTCAATCATTTCTCTCTGCTGTGCCGACTGCTTAATGGGAATATATTTATTCGTGATCGGAGGCTTTGACCTAAAGTTT
CGTGGAGAATACAATAAGCATGCGCAGCTGTGGATGGAGAGTACTCATTGTCAGCTTGTAGGATCTTTGGCCATTCTGTCCACAGAAGTA
TCAGTTTTACTGTTAACATTTCTGACATTGGAAAAATACATCTGCATTGTCTATCCTTTTAGATGTGTGAGACCTGGAAAATGCAGAACA
ATTACAGTTCTGATTCTCATTTGGATTACTGGTTTTATAGTGGCTTTCATTCCATTGAGCAATAAGGAATTTTTCAAAAACTACTATGGC
ACCAATGGAGTATGCTTCCCTCTTCATTCAGAAGATACAGAAAGTATTGGAGCCCAGATTTATTCAGTGGCAATTTTTCTTGGTATTAAT
TTGGCCGCATTTATCATCATAGTTTTTTCCTATGGAAGCATGTTTTATAGTGTTCATCAAAGTGCCATAACAGCAACTGAAATACGGAAT
CAAGTTAAAAAAGAGATGATCCTTGCCAAACGTTTTTTCTTTATAGTATTTACTGATGCATTATGCTGGATACCCATTTTTGTAGTGAAA
TTTCTTTCACTGCTTCAGGTAGAAATACCAGGTACCATAACCTCTTGGGTAGTGATTTTTATTCTGCCCATTAACAGTGCTTTGAACCCA
ATTCTCTATACTCTGACCACAAGACCATTTAAAGAAATGATTCATCGGTTTTGGTATAACTACAGACAAAGAAAATCTATGGACAGCAAA
GGTCAGAAAACATATGCTCCATCATTCATCTGGGTGGAAATGTGGCCACTGCAGGAGATGCCACCTGAGTTAATGAAGCCGGACCTTTTC

>In-frame_FNIP2_ENST00000264433_chr4_159690471_+_RXFP1_ENST00000307765_chr4_159559160_+_1410nt
ATGGCCCCGACCCTGCTCCAGAAGCTCTTCAACAAAAGGGGCAGCAGCGGCAGCTCCGCGGCGGCGTCTGCCCAGGGCAGGGCTCCTAAG
GAAGGACCCGCCTTTAGGAATCTTTCCTATAATCCAATCCAGAAAATTCAAGCAAACCAATTTGATTATCTTGTCAAACTCAAGTCTCTC
AGCCTAGAAGGGATTGAAATTTCAAATATCCAACAAAGGATGTTTAGACCTCTTATGAATCTCTCTCACATATATTTTAAGAAATTCCAG
TACTGTGGGTATGCACCACATGTTCGCAGCTGTAAACCAAACACTGATGGAATTTCATCTCTAGAGAATCTCTTGGCAAGCATTATTCAG
AGAGTATTTGTCTGGGTTGTATCTGCAGTTACCTGCTTTGGAAACATTTTTGTCATTTGCATGCGACCTTATATCAGGTCTGAGAACAAG
CTGTATGCCATGTCAATCATTTCTCTCTGCTGTGCCGACTGCTTAATGGGAATATATTTATTCGTGATCGGAGGCTTTGACCTAAAGTTT
CGTGGAGAATACAATAAGCATGCGCAGCTGTGGATGGAGAGTACTCATTGTCAGCTTGTAGGATCTTTGGCCATTCTGTCCACAGAAGTA
TCAGTTTTACTGTTAACATTTCTGACATTGGAAAAATACATCTGCATTGTCTATCCTTTTAGATGTGTGAGACCTGGAAAATGCAGAACA
ATTACAGTTCTGATTCTCATTTGGATTACTGGTTTTATAGTGGCTTTCATTCCATTGAGCAATAAGGAATTTTTCAAAAACTACTATGGC
ACCAATGGAGTATGCTTCCCTCTTCATTCAGAAGATACAGAAAGTATTGGAGCCCAGATTTATTCAGTGGCAATTTTTCTTGGTATTAAT
TTGGCCGCATTTATCATCATAGTTTTTTCCTATGGAAGCATGTTTTATAGTGTTCATCAAAGTGCCATAACAGCAACTGAAATACGGAAT
CAAGTTAAAAAAGAGATGATCCTTGCCAAACGTTTTTTCTTTATAGTATTTACTGATGCATTATGCTGGATACCCATTTTTGTAGTGAAA
TTTCTTTCACTGCTTCAGGTAGAAATACCAGGTACCATAACCTCTTGGGTAGTGATTTTTATTCTGCCCATTAACAGTGCTTTGAACCCA
ATTCTCTATACTCTGACCACAAGACCATTTAAAGAAATGATTCATCGGTTTTGGTATAACTACAGACAAAGAAAATCTATGGACAGCAAA
GGTCAGAAAACATATGCTCCATCATTCATCTGGGTGGAAATGTGGCCACTGCAGGAGATGCCACCTGAGTTAATGAAGCCGGACCTTTTC


* Fusion transcript sequences (Full-length transcript).
>In-frame_FNIP2_ENST00000264433_chr4_159690471_+_RXFP1_ENST00000460056_chr4_159559160_+_1642nt
GCGGCCGCCGCCCCCGGCTGCGCGCTGAGCCGCCGGCCCCCCGAGCGCCACGGCCGGAGCTGCGGCGGCGGCATCATGGCCCCGACCCTG
CTCCAGAAGCTCTTCAACAAAAGGGGCAGCAGCGGCAGCTCCGCGGCGGCGTCTGCCCAGGGCAGGGCTCCTAAGGAAGGACCCGCCTTT
AGGAATCTTTCCTATAATCCAATCCAGAAAATTCAAGCAAACCAATTTGATTATCTTGTCAAACTCAAGTCTCTCAGCCTAGAAGGGATT
GAAATTTCAAATATCCAACAAAGGATGTTTAGACCTCTTATGAATCTCTCTCACATATATTTTAAGAAATTCCAGTACTGTGGGTATGCA
CCACATGTTCGCAGCTGTAAACCAAACACTGATGGAATTTCATCTCTAGAGAATCTCTTGGCAAGCATTATTCAGAGAGTATTTGTCTGG
GTTGTATCTGCAGTTACCTGCTTTGGAAACATTTTTGTCATTTGCATGCGACCTTATATCAGGTCTGAGAACAAGCTGTATGCCATGTCA
ATCATTTCTCTCTGCTGTGCCGACTGCTTAATGGGAATATATTTATTCGTGATCGGAGGCTTTGACCTAAAGTTTCGTGGAGAATACAAT
AAGCATGCGCAGCTGTGGATGGAGAGTACTCATTGTCAGCTTGTAGGATCTTTGGCCATTCTGTCCACAGAAGTATCAGTTTTACTGTTA
ACATTTCTGACATTGGAAAAATACATCTGCATTGTCTATCCTTTTAGATGTGTGAGACCTGGAAAATGCAGAACAATTACAGTTCTGATT
CTCATTTGGATTACTGGTTTTATAGTGGCTTTCATTCCATTGAGCAATAAGGAATTTTTCAAAAACTACTATGGCACCAATGGAGTATGC
TTCCCTCTTCATTCAGAAGATACAGAAAGTATTGGAGCCCAGATTTATTCAGTGGCAATTTTTCTTGGTATTAATTTGGCCGCATTTATC
ATCATAGTTTTTTCCTATGGAAGCATGTTTTATAGTGTTCATCAAAGTGCCATAACAGCAACTGAAATACGGAATCAAGTTAAAAAAGAG
ATGATCCTTGCCAAACGTTTTTTCTTTATAGTATTTACTGATGCATTATGCTGGATACCCATTTTTGTAGTGAAATTTCTTTCACTGCTT
CAGGTAGAAATACCAGGTACCATAACCTCTTGGGTAGTGATTTTTATTCTGCCCATTAACAGTGCTTTGAACCCAATTCTCTATACTCTG
ACCACAAGACCATTTAAAGAAATGATTCATCGGTTTTGGTATAACTACAGACAAAGAAAATCTATGGACAGCAAAGGTCAGAAAACATAT
GCTCCATCATTCATCTGGGTGGAAATGTGGCCACTGCAGGAGATGCCACCTGAGTTAATGAAGCCGGACCTTTTCACATACCCCTGTGAA
ATGTCACTGATTTCTCAATCAACGAGACTCAATTCCTATTCATGACTGACTCTGAAATTCATTTCTTCGCAGAGAATACTGTGGGGGTGC
TTCATGAGGGATTTACTGGTATGAAATGAATACCACAAAATTAATTTATAATAATAGCTAAGATAAATATTTTACAAGGACATGAGGAAA

>In-frame_FNIP2_ENST00000264433_chr4_159690471_+_RXFP1_ENST00000307765_chr4_159559160_+_2802nt
GCGGCCGCCGCCCCCGGCTGCGCGCTGAGCCGCCGGCCCCCCGAGCGCCACGGCCGGAGCTGCGGCGGCGGCATCATGGCCCCGACCCTG
CTCCAGAAGCTCTTCAACAAAAGGGGCAGCAGCGGCAGCTCCGCGGCGGCGTCTGCCCAGGGCAGGGCTCCTAAGGAAGGACCCGCCTTT
AGGAATCTTTCCTATAATCCAATCCAGAAAATTCAAGCAAACCAATTTGATTATCTTGTCAAACTCAAGTCTCTCAGCCTAGAAGGGATT
GAAATTTCAAATATCCAACAAAGGATGTTTAGACCTCTTATGAATCTCTCTCACATATATTTTAAGAAATTCCAGTACTGTGGGTATGCA
CCACATGTTCGCAGCTGTAAACCAAACACTGATGGAATTTCATCTCTAGAGAATCTCTTGGCAAGCATTATTCAGAGAGTATTTGTCTGG
GTTGTATCTGCAGTTACCTGCTTTGGAAACATTTTTGTCATTTGCATGCGACCTTATATCAGGTCTGAGAACAAGCTGTATGCCATGTCA
ATCATTTCTCTCTGCTGTGCCGACTGCTTAATGGGAATATATTTATTCGTGATCGGAGGCTTTGACCTAAAGTTTCGTGGAGAATACAAT
AAGCATGCGCAGCTGTGGATGGAGAGTACTCATTGTCAGCTTGTAGGATCTTTGGCCATTCTGTCCACAGAAGTATCAGTTTTACTGTTA
ACATTTCTGACATTGGAAAAATACATCTGCATTGTCTATCCTTTTAGATGTGTGAGACCTGGAAAATGCAGAACAATTACAGTTCTGATT
CTCATTTGGATTACTGGTTTTATAGTGGCTTTCATTCCATTGAGCAATAAGGAATTTTTCAAAAACTACTATGGCACCAATGGAGTATGC
TTCCCTCTTCATTCAGAAGATACAGAAAGTATTGGAGCCCAGATTTATTCAGTGGCAATTTTTCTTGGTATTAATTTGGCCGCATTTATC
ATCATAGTTTTTTCCTATGGAAGCATGTTTTATAGTGTTCATCAAAGTGCCATAACAGCAACTGAAATACGGAATCAAGTTAAAAAAGAG
ATGATCCTTGCCAAACGTTTTTTCTTTATAGTATTTACTGATGCATTATGCTGGATACCCATTTTTGTAGTGAAATTTCTTTCACTGCTT
CAGGTAGAAATACCAGGTACCATAACCTCTTGGGTAGTGATTTTTATTCTGCCCATTAACAGTGCTTTGAACCCAATTCTCTATACTCTG
ACCACAAGACCATTTAAAGAAATGATTCATCGGTTTTGGTATAACTACAGACAAAGAAAATCTATGGACAGCAAAGGTCAGAAAACATAT
GCTCCATCATTCATCTGGGTGGAAATGTGGCCACTGCAGGAGATGCCACCTGAGTTAATGAAGCCGGACCTTTTCACATACCCCTGTGAA
ATGTCACTGATTTCTCAATCAACGAGACTCAATTCCTATTCATGACTGACTCTGAAATTCATTTCTTCGCAGAGAATACTGTGGGGGTGC
TTCATGAGGGATTTACTGGTATGAAATGAATACCACAAAATTAATTTATAATAATAGCTAAGATAAATATTTTACAAGGACATGAGGAAA
AATAAAAATGACTAATGCTCTTACAAAGGGAAGTAATTATATCAATAATGTATATATATTAGTAGACATTTTGCATAAGAAATTAAGAGA
AATCTACTTCAGTAACATTCATTCATTTTTCTAACATGCATTTATTGAGTACCCACTACTATGTGCATAGCATTGCAATATAGTCCTGGA
AGTAGACAGTGCAGAACCTTTCAATCTGTAGATGGTGTTTAATGACAAAAGACTATACAAAGTCCATCTGCAGTTCCTAGTTTAAAGTAG
AGCTTTACCTGTCATGTGCATCAGCAAGAATCATAGGCACTTTTAAATAAAGGTTTAAAGTTTTGGAATACTCAGTGTATTTGCATCATA
GAAAATGTCTGACTGTTTGCAAAATAATATTCTGTTTTAAGAATCCATCTTACCTCTCTTTAAGTTTCCATACACTTGAGAGCCAACACA
ACATATTTATTACTAAAAAGATGCTTTGCTAGAAACTCAAAAACAGCACTTCTTTTGGCACTTCCTGCCCAGTTTTCTCTTTGCTTTAAA
TGAACATCATCATATGGAATTGGAATAGGAGAGTATGAGTACGGCAGAGAAGTGGATCAGAAAAACTAGAATGAGGATAAACATTTACAT
TAGTGGAAACTCCTGAAATAAATCCTTGTATTGTCAGTTAACTGATTTTCAACAAGGATGCCAAGACAAAAAGGCTTTTCAACAAACCGT
GCTGTTTTAAGAACAGACCTAAGTGGTTTAATTCACCCACTTTAGATGGGTGAATGTTATGGTGTGTGAAATATCTCAGTAAAGCAGTTA
AAAGGAAAAAGAGCTGGAATGCACTGATTCAGGAACTTAATTTCAGGAAGGAAAGGTCTGTATGTACACATTTCACTTTAAGCAGAAAAT
CTTTCTTCAAGAAATGACTTTACTTTCTCTTTGCACTGCCAGCACGTGAGATACTAACTTTTTAACTAGTTGTTCTTCTCTAGTCTCTAC
GTTATTAGAATTTTTTGCTTTCATAATGTGAAACCTTTAAGCAGGAGAAGAAAATGTTTTCAGATAGTTTCAAATACACCAAAAATGTTT
GAAACACAAAAATACTGGAATCAAACCATAATGCACTTATTGAATATATAGTTGTATAGATTTGTTCTGAAAATAAATTATCTGAAATTT


Top

FusionGenePPI for FNIP2_RXFP1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
FNIP2FLCN, GABARAP, HSP90AA1, HSPA1B, STIP1, CDC37, PTGES3, NR3C1, CDK4, BRAF, FNIP2, FNIP1RXFP1RLN3, SRPK2, C1QTNF8


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneFNIP2chr4:159690471chr4:159559160ENST00000264433+117544_911351115PRKAA1
HgeneFNIP2chr4:159690471chr4:159559160ENST00000379346+117544_91101138PRKAA1


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for FNIP2_RXFP1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for FNIP2_RXFP1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneRXFP1C0014175Endometriosis1CTD_human