FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 13541

FusionGeneSummary for FKBP8_SLC1A6

check button Fusion gene summary
Fusion gene informationFusion gene name: FKBP8_SLC1A6
Fusion gene ID: 13541
HgeneTgene
Gene symbol

FKBP8

SLC1A6

Gene ID

23770

6511

Gene nameFK506 binding protein 8solute carrier family 1 member 6
SynonymsFKBP38|FKBPr38EAAT4
Cytomap

19p13.11

19p13.12

Type of geneprotein-codingprotein-coding
Descriptionpeptidyl-prolyl cis-trans isomerase FKBP838 kDa FK506-binding protein38 kDa FKBPFK506 binding protein 8, 38kDaFKBP-38FKBP-8PPIase FKBP8hFKBP38rotamaseexcitatory amino acid transporter 4sodium-dependent glutamate/aspartate transportersolute carrier family 1 (high affinity aspartate/glutamate transporter), member 6
Modification date2018052220180519
UniProtAcc

Q14318

P48664

Ensembl transtripts involved in fusion geneENST00000597960, ENST00000610101, 
ENST00000596558, ENST00000222308, 
ENST00000608443, ENST00000453489, 
ENST00000430939, ENST00000221742, 
ENST00000600144, ENST00000598504, 
ENST00000544886, 
Fusion gene scores* DoF score10 X 11 X 4=4407 X 3 X 7=147
# samples 118
** MAII scorelog2(11/440*10)=-2
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(8/147*10)=-0.877744249949002
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: FKBP8 [Title/Abstract] AND SLC1A6 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVGBMTCGA-14-1034-02BFKBP8chr19

18644080

-SLC1A6chr19

15061202

-
TCGARVGBMTCGA-14-1034-01AFKBP8chr19

18644080

-SLC1A6chr19

15061202

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000597960ENST00000430939FKBP8chr19

18644080

-SLC1A6chr19

15061202

-
Frame-shitENST00000597960ENST00000221742FKBP8chr19

18644080

-SLC1A6chr19

15061202

-
In-frameENST00000597960ENST00000600144FKBP8chr19

18644080

-SLC1A6chr19

15061202

-
5CDS-intronENST00000597960ENST00000598504FKBP8chr19

18644080

-SLC1A6chr19

15061202

-
5CDS-intronENST00000597960ENST00000544886FKBP8chr19

18644080

-SLC1A6chr19

15061202

-
Frame-shitENST00000610101ENST00000430939FKBP8chr19

18644080

-SLC1A6chr19

15061202

-
In-frameENST00000610101ENST00000221742FKBP8chr19

18644080

-SLC1A6chr19

15061202

-
Frame-shitENST00000610101ENST00000600144FKBP8chr19

18644080

-SLC1A6chr19

15061202

-
5CDS-intronENST00000610101ENST00000598504FKBP8chr19

18644080

-SLC1A6chr19

15061202

-
5CDS-intronENST00000610101ENST00000544886FKBP8chr19

18644080

-SLC1A6chr19

15061202

-
Frame-shitENST00000596558ENST00000430939FKBP8chr19

18644080

-SLC1A6chr19

15061202

-
Frame-shitENST00000596558ENST00000221742FKBP8chr19

18644080

-SLC1A6chr19

15061202

-
In-frameENST00000596558ENST00000600144FKBP8chr19

18644080

-SLC1A6chr19

15061202

-
5CDS-intronENST00000596558ENST00000598504FKBP8chr19

18644080

-SLC1A6chr19

15061202

-
5CDS-intronENST00000596558ENST00000544886FKBP8chr19

18644080

-SLC1A6chr19

15061202

-
Frame-shitENST00000222308ENST00000430939FKBP8chr19

18644080

-SLC1A6chr19

15061202

-
In-frameENST00000222308ENST00000221742FKBP8chr19

18644080

-SLC1A6chr19

15061202

-
Frame-shitENST00000222308ENST00000600144FKBP8chr19

18644080

-SLC1A6chr19

15061202

-
5CDS-intronENST00000222308ENST00000598504FKBP8chr19

18644080

-SLC1A6chr19

15061202

-
5CDS-intronENST00000222308ENST00000544886FKBP8chr19

18644080

-SLC1A6chr19

15061202

-
Frame-shitENST00000608443ENST00000430939FKBP8chr19

18644080

-SLC1A6chr19

15061202

-
In-frameENST00000608443ENST00000221742FKBP8chr19

18644080

-SLC1A6chr19

15061202

-
Frame-shitENST00000608443ENST00000600144FKBP8chr19

18644080

-SLC1A6chr19

15061202

-
5CDS-intronENST00000608443ENST00000598504FKBP8chr19

18644080

-SLC1A6chr19

15061202

-
5CDS-intronENST00000608443ENST00000544886FKBP8chr19

18644080

-SLC1A6chr19

15061202

-
In-frameENST00000453489ENST00000430939FKBP8chr19

18644080

-SLC1A6chr19

15061202

-
Frame-shitENST00000453489ENST00000221742FKBP8chr19

18644080

-SLC1A6chr19

15061202

-
Frame-shitENST00000453489ENST00000600144FKBP8chr19

18644080

-SLC1A6chr19

15061202

-
5CDS-intronENST00000453489ENST00000598504FKBP8chr19

18644080

-SLC1A6chr19

15061202

-
5CDS-intronENST00000453489ENST00000544886FKBP8chr19

18644080

-SLC1A6chr19

15061202

-

Top

FusionProtFeatures for FKBP8_SLC1A6


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
FKBP8

Q14318

SLC1A6

P48664

Constitutively inactive PPiase, which becomes activewhen bound to calmodulin and calcium. Seems to act as a chaperonefor BCL2, targets it to the mitochondria and modulates itsphosphorylation state. The BCL2/FKBP8/calmodulin/calcium complexprobably interferes with the binding of BCL2 to its targets. Theactive form of FKBP8 may therefore play a role in the regulationof apoptosis. {ECO:0000269|PubMed:12510191,ECO:0000269|PubMed:15757646, ECO:0000269|PubMed:16176796}. Sodium-dependent, high-affinity amino acid transporterthat mediates the uptake of L-glutamate and also L-aspartate andD-aspartate (PubMed:7791878). Functions as a symporter thattransports one amino acid molecule together with two or threeNa(+) ions and one proton, in parallel with the counter-transportof one K(+) ion. Mediates Cl(-) flux that is not coupled to aminoacid transport; this avoids the accumulation of negative chargesdue to aspartate and Na(+) symport (By similarity). Plays aredundant role in the rapid removal of released glutamate from thesynaptic cleft, which is essential for terminating thepostsynaptic action of glutamate (Probable).{ECO:0000250|UniProtKB:O35921, ECO:0000269|PubMed:7791878,ECO:0000305}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for FKBP8_SLC1A6


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_FKBP8_ENST00000597960_chr19_18644080_-_SLC1A6_ENST00000600144_chr19_15061202_-_406aa
MASCAEPSEPSAPLPAGVPPLEDFEVLDGVEDAEGEEEEEEEEEEEDDLSELPPLEDMGQPPAEEAEQPGALAREFLAAMEPEPAPAPAP
EEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYG
PQGSRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRKRECGNAHYQRADFVLAANSYDLAIKAITSSAKVDMTFEEEAQLLQ
LKVKCLNNLAASQLKLDHYRAALRSCSLVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNK_PASHNDQRTGGLNWSGRH

>In-frame_FKBP8_ENST00000610101_chr19_18644080_-_SLC1A6_ENST00000221742_chr19_15061202_-_246aa
MASCAEPSEPSAPLPAGVPPLEDFEVLDGVEDAEGEEEEEEEEEEEDDLSELPPLEDMGQPPAEEAEQPGALAREFLAAMEPEPAPAPAP
EEWLDILVDMTFEEEAQLLQLKVKCLNNLAASQLKLDHYRAALRSCSLVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSN

>In-frame_FKBP8_ENST00000596558_chr19_18644080_-_SLC1A6_ENST00000600144_chr19_15061202_-_405aa
MASCAEPSEPSAPLPAGVPPLEDFEVLDGVEDAEGEEEEEEEEEEEDDLSELPPLEDMGQPPAEEAEQPGALAREFLAAMEPEPAPAPAP
EEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYG
PQGRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRKRECGNAHYQRADFVLAANSYDLAIKAITSSAKVDMTFEEEAQLLQL
KVKCLNNLAASQLKLDHYRAALRSCSLVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNK_PASHNDQRTGGLNWSGRHR

>In-frame_FKBP8_ENST00000222308_chr19_18644080_-_SLC1A6_ENST00000221742_chr19_15061202_-_405aa
MASCAEPSEPSAPLPAGVPPLEDFEVLDGVEDAEGEEEEEEEEEEEDDLSELPPLEDMGQPPAEEAEQPGALAREFLAAMEPEPAPAPAP
EEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYG
PQGRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRKRECGNAHYQRADFVLAANSYDLAIKAITSSAKVDMTFEEEAQLLQL
KVKCLNNLAASQLKLDHYRAALRSCSLVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNK_PASHNDQRTGGLNWSGRHR

>In-frame_FKBP8_ENST00000608443_chr19_18644080_-_SLC1A6_ENST00000221742_chr19_15061202_-_406aa
MASCAEPSEPSAPLPAGVPPLEDFEVLDGVEDAEGEEEEEEEEEEEDDLSELPPLEDMGQPPAEEAEQPGALAREFLAAMEPEPAPAPAP
EEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYG
PQGSRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRKRECGNAHYQRADFVLAANSYDLAIKAITSSAKVDMTFEEEAQLLQ
LKVKCLNNLAASQLKLDHYRAALRSCSLVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRAALKLEPSNK_PASHNDQRTGGLNWSGRH

>In-frame_FKBP8_ENST00000453489_chr19_18644080_-_SLC1A6_ENST00000430939_chr19_15061202_-_434aa
MGVGAGRVSQSGAPSPGGAGRANSCPPSSMASCAEPSEPSAPLPAGVPPLEDFEVLDGVEDAEGEEEEEEEEEEEDDLSELPPLEDMGQP
PAEEAEQPGALAREFLAAMEPEPAPAPAPEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCD
VIQALDLSVPLMDVGETAMVTADSKYCYGPQGRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRKRECGNAHYQRADFVLAA
NSYDLAIKAITSSAKVDMTFEEEAQLLQLKVKCLNNLAASQLKLDHYRAALRSCSLVLEHQPDNIKALFRKGKVLAQQGEYSEAIPILRA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_FKBP8_ENST00000597960_chr19_18644080_-_SLC1A6_ENST00000600144_chr19_15061202_-_1219nt
ATGGCATCGTGTGCTGAACCCTCTGAGCCCTCTGCCCCACTGCCCGCCGGGGTCCCACCGCTCGAGGACTTCGAGGTACTGGATGGGGTT
GAGGATGCAGAGGGTGAGGAGGAAGAGGAGGAGGAAGAGGAGGAAGAGGATGACCTGAGTGAGCTGCCACCGCTGGAGGACATGGGACAA
CCCCCGGCGGAGGAGGCTGAGCAGCCTGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCATGGAGCCCGAGCCCGCCCCAGCCCCGGCCCCA
GAAGAGTGGCTGGACATTCTGGGGAACGGGCTGTTGAGGAAGAAGACGCTGGTCCCAGGGCCGCCAGGTTCGAGCCGCCCGGTCAAGGGC
CAGGTGGTCACCGTACATCTGCAGACGTCGCTGGAGAATGGCACACGGGTGCAGGAGGAGCCGGAGCTGGTGTTCACTCTGGGTGACTGT
GACGTCATCCAGGCCCTGGATCTCAGTGTCCCACTCATGGACGTGGGGGAGACGGCCATGGTCACTGCTGACTCCAAGTACTGCTACGGC
CCCCAAGGCAGCAGGAGCCCATACATCCCCCCGCACGCGGCCCTGTGCCTGGAGGTGACCCTGAAGACGGCTGTGGACGGGCCTGACCTG
GAGATGCTCACGGGGCAGGAGCGCGTGGCCCTGGCCAACCGGAAGCGGGAGTGCGGCAACGCCCACTACCAGCGGGCGGACTTCGTCCTG
GCCGCCAACTCCTACGACCTCGCCATCAAGGCTATCACCTCCAGCGCCAAAGTGGACATGACGTTCGAGGAGGAGGCACAGCTCCTGCAG
TTGAAGGTGAAGTGTCTGAACAACCTGGCGGCCTCGCAGCTGAAGCTCGACCACTACCGCGCAGCCCTGCGCTCCTGCAGCCTTGTGCTG
GAGCACCAGCCAGACAACATCAAGGCTCTCTTCCGCAAGGGCAAGGTGCTGGCCCAGCAGGGGGAGTACAGTGAGGCCATCCCCATCCTG
AGGGCAGCCCTGAAGCTGGAACCTTCCAACAAGTGACCGGCTTCGCACAATGACCAACGTACTGGGGGACTCAATTGGAGCGGCCGTCAT
CGAGCACTTGTCTCAGCGGGAGCTGGAGCTTCAGGAAGCTGAGCTTACCCTCCCCAGCCTGGGGAAACCCTACAAGTCCCTCATGGCACA

>In-frame_FKBP8_ENST00000610101_chr19_18644080_-_SLC1A6_ENST00000221742_chr19_15061202_-_739nt
ATGGCATCGTGTGCTGAACCCTCTGAGCCCTCTGCCCCACTGCCCGCCGGGGTCCCACCGCTCGAGGACTTCGAGGTACTGGATGGGGTT
GAGGATGCAGAGGGTGAGGAGGAAGAGGAGGAGGAAGAGGAGGAAGAGGATGACCTGAGTGAGCTGCCACCGCTGGAGGACATGGGACAA
CCCCCGGCGGAGGAGGCTGAGCAGCCTGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCATGGAGCCCGAGCCCGCCCCAGCCCCGGCCCCA
GAAGAGTGGCTGGACATTCTGGTGGACATGACGTTCGAGGAGGAGGCACAGCTCCTGCAGTTGAAGGTGAAGTGTCTGAACAACCTGGCG
GCCTCGCAGCTGAAGCTCGACCACTACCGCGCAGCCCTGCGCTCCTGCAGCCTTGTGCTGGAGCACCAGCCAGACAACATCAAGGCTCTC
TTCCGCAAGGGCAAGGTGCTGGCCCAGCAGGGGGAGTACAGTGAGGCCATCCCCATCCTGAGGGCAGCCCTGAAGCTGGAACCTTCCAAC
AAGTGACCGGCTTCGCACAATGACCAACGTACTGGGGGACTCAATTGGAGCGGCCGTCATCGAGCACTTGTCTCAGCGGGAGCTGGAGCT
TCAGGAAGCTGAGCTTACCCTCCCCAGCCTGGGGAAACCCTACAAGTCCCTCATGGCACAGGAGAAGGGGGCATCCCGGGGACGGGGAGG

>In-frame_FKBP8_ENST00000596558_chr19_18644080_-_SLC1A6_ENST00000600144_chr19_15061202_-_1216nt
ATGGCATCGTGTGCTGAACCCTCTGAGCCCTCTGCCCCACTGCCCGCCGGGGTCCCACCGCTCGAGGACTTCGAGGTACTGGATGGGGTT
GAGGATGCAGAGGGTGAGGAGGAAGAGGAGGAGGAAGAGGAGGAAGAGGATGACCTGAGTGAGCTGCCACCGCTGGAGGACATGGGACAA
CCCCCGGCGGAGGAGGCTGAGCAGCCTGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCATGGAGCCCGAGCCCGCCCCAGCCCCGGCCCCA
GAAGAGTGGCTGGACATTCTGGGGAACGGGCTGTTGAGGAAGAAGACGCTGGTCCCAGGGCCGCCAGGTTCGAGCCGCCCGGTCAAGGGC
CAGGTGGTCACCGTACATCTGCAGACGTCGCTGGAGAATGGCACACGGGTGCAGGAGGAGCCGGAGCTGGTGTTCACTCTGGGTGACTGT
GACGTCATCCAGGCCCTGGATCTCAGTGTCCCACTCATGGACGTGGGGGAGACGGCCATGGTCACTGCTGACTCCAAGTACTGCTACGGC
CCCCAAGGCAGGAGCCCATACATCCCCCCGCACGCGGCCCTGTGCCTGGAGGTGACCCTGAAGACGGCTGTGGACGGGCCTGACCTGGAG
ATGCTCACGGGGCAGGAGCGCGTGGCCCTGGCCAACCGGAAGCGGGAGTGCGGCAACGCCCACTACCAGCGGGCGGACTTCGTCCTGGCC
GCCAACTCCTACGACCTCGCCATCAAGGCTATCACCTCCAGCGCCAAAGTGGACATGACGTTCGAGGAGGAGGCACAGCTCCTGCAGTTG
AAGGTGAAGTGTCTGAACAACCTGGCGGCCTCGCAGCTGAAGCTCGACCACTACCGCGCAGCCCTGCGCTCCTGCAGCCTTGTGCTGGAG
CACCAGCCAGACAACATCAAGGCTCTCTTCCGCAAGGGCAAGGTGCTGGCCCAGCAGGGGGAGTACAGTGAGGCCATCCCCATCCTGAGG
GCAGCCCTGAAGCTGGAACCTTCCAACAAGTGACCGGCTTCGCACAATGACCAACGTACTGGGGGACTCAATTGGAGCGGCCGTCATCGA
GCACTTGTCTCAGCGGGAGCTGGAGCTTCAGGAAGCTGAGCTTACCCTCCCCAGCCTGGGGAAACCCTACAAGTCCCTCATGGCACAGGA

>In-frame_FKBP8_ENST00000222308_chr19_18644080_-_SLC1A6_ENST00000221742_chr19_15061202_-_1216nt
ATGGCATCGTGTGCTGAACCCTCTGAGCCCTCTGCCCCACTGCCCGCCGGGGTCCCACCGCTCGAGGACTTCGAGGTACTGGATGGGGTT
GAGGATGCAGAGGGTGAGGAGGAAGAGGAGGAGGAAGAGGAGGAAGAGGATGACCTGAGTGAGCTGCCACCGCTGGAGGACATGGGACAA
CCCCCGGCGGAGGAGGCTGAGCAGCCTGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCATGGAGCCCGAGCCCGCCCCAGCCCCGGCCCCA
GAAGAGTGGCTGGACATTCTGGGGAACGGGCTGTTGAGGAAGAAGACGCTGGTCCCAGGGCCGCCAGGTTCGAGCCGCCCGGTCAAGGGC
CAGGTGGTCACCGTACATCTGCAGACGTCGCTGGAGAATGGCACACGGGTGCAGGAGGAGCCGGAGCTGGTGTTCACTCTGGGTGACTGT
GACGTCATCCAGGCCCTGGATCTCAGTGTCCCACTCATGGACGTGGGGGAGACGGCCATGGTCACTGCTGACTCCAAGTACTGCTACGGC
CCCCAAGGCAGGAGCCCATACATCCCCCCGCACGCGGCCCTGTGCCTGGAGGTGACCCTGAAGACGGCTGTGGACGGGCCTGACCTGGAG
ATGCTCACGGGGCAGGAGCGCGTGGCCCTGGCCAACCGGAAGCGGGAGTGCGGCAACGCCCACTACCAGCGGGCGGACTTCGTCCTGGCC
GCCAACTCCTACGACCTCGCCATCAAGGCTATCACCTCCAGCGCCAAAGTGGACATGACGTTCGAGGAGGAGGCACAGCTCCTGCAGTTG
AAGGTGAAGTGTCTGAACAACCTGGCGGCCTCGCAGCTGAAGCTCGACCACTACCGCGCAGCCCTGCGCTCCTGCAGCCTTGTGCTGGAG
CACCAGCCAGACAACATCAAGGCTCTCTTCCGCAAGGGCAAGGTGCTGGCCCAGCAGGGGGAGTACAGTGAGGCCATCCCCATCCTGAGG
GCAGCCCTGAAGCTGGAACCTTCCAACAAGTGACCGGCTTCGCACAATGACCAACGTACTGGGGGACTCAATTGGAGCGGCCGTCATCGA
GCACTTGTCTCAGCGGGAGCTGGAGCTTCAGGAAGCTGAGCTTACCCTCCCCAGCCTGGGGAAACCCTACAAGTCCCTCATGGCACAGGA

>In-frame_FKBP8_ENST00000608443_chr19_18644080_-_SLC1A6_ENST00000221742_chr19_15061202_-_1219nt
ATGGCATCGTGTGCTGAACCCTCTGAGCCCTCTGCCCCACTGCCCGCCGGGGTCCCACCGCTCGAGGACTTCGAGGTACTGGATGGGGTT
GAGGATGCAGAGGGTGAGGAGGAAGAGGAGGAGGAAGAGGAGGAAGAGGATGACCTGAGTGAGCTGCCACCGCTGGAGGACATGGGACAA
CCCCCGGCGGAGGAGGCTGAGCAGCCTGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCATGGAGCCCGAGCCCGCCCCAGCCCCGGCCCCA
GAAGAGTGGCTGGACATTCTGGGGAACGGGCTGTTGAGGAAGAAGACGCTGGTCCCAGGGCCGCCAGGTTCGAGCCGCCCGGTCAAGGGC
CAGGTGGTCACCGTACATCTGCAGACGTCGCTGGAGAATGGCACACGGGTGCAGGAGGAGCCGGAGCTGGTGTTCACTCTGGGTGACTGT
GACGTCATCCAGGCCCTGGATCTCAGTGTCCCACTCATGGACGTGGGGGAGACGGCCATGGTCACTGCTGACTCCAAGTACTGCTACGGC
CCCCAAGGCAGCAGGAGCCCATACATCCCCCCGCACGCGGCCCTGTGCCTGGAGGTGACCCTGAAGACGGCTGTGGACGGGCCTGACCTG
GAGATGCTCACGGGGCAGGAGCGCGTGGCCCTGGCCAACCGGAAGCGGGAGTGCGGCAACGCCCACTACCAGCGGGCGGACTTCGTCCTG
GCCGCCAACTCCTACGACCTCGCCATCAAGGCTATCACCTCCAGCGCCAAAGTGGACATGACGTTCGAGGAGGAGGCACAGCTCCTGCAG
TTGAAGGTGAAGTGTCTGAACAACCTGGCGGCCTCGCAGCTGAAGCTCGACCACTACCGCGCAGCCCTGCGCTCCTGCAGCCTTGTGCTG
GAGCACCAGCCAGACAACATCAAGGCTCTCTTCCGCAAGGGCAAGGTGCTGGCCCAGCAGGGGGAGTACAGTGAGGCCATCCCCATCCTG
AGGGCAGCCCTGAAGCTGGAACCTTCCAACAAGTGACCGGCTTCGCACAATGACCAACGTACTGGGGGACTCAATTGGAGCGGCCGTCAT
CGAGCACTTGTCTCAGCGGGAGCTGGAGCTTCAGGAAGCTGAGCTTACCCTCCCCAGCCTGGGGAAACCCTACAAGTCCCTCATGGCACA

>In-frame_FKBP8_ENST00000453489_chr19_18644080_-_SLC1A6_ENST00000430939_chr19_15061202_-_1303nt
ATGGGGGTGGGGGCTGGGAGGGTCTCTCAAAGTGGGGCTCCGAGCCCGGGAGGAGCAGGCAGGGCCAATTCCTGTCCCCCCAGCAGCATG
GCATCGTGTGCTGAACCCTCTGAGCCCTCTGCCCCACTGCCCGCCGGGGTCCCACCGCTCGAGGACTTCGAGGTACTGGATGGGGTTGAG
GATGCAGAGGGTGAGGAGGAAGAGGAGGAGGAAGAGGAGGAAGAGGATGACCTGAGTGAGCTGCCACCGCTGGAGGACATGGGACAACCC
CCGGCGGAGGAGGCTGAGCAGCCTGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCATGGAGCCCGAGCCCGCCCCAGCCCCGGCCCCAGAA
GAGTGGCTGGACATTCTGGGGAACGGGCTGTTGAGGAAGAAGACGCTGGTCCCAGGGCCGCCAGGTTCGAGCCGCCCGGTCAAGGGCCAG
GTGGTCACCGTACATCTGCAGACGTCGCTGGAGAATGGCACACGGGTGCAGGAGGAGCCGGAGCTGGTGTTCACTCTGGGTGACTGTGAC
GTCATCCAGGCCCTGGATCTCAGTGTCCCACTCATGGACGTGGGGGAGACGGCCATGGTCACTGCTGACTCCAAGTACTGCTACGGCCCC
CAAGGCAGGAGCCCATACATCCCCCCGCACGCGGCCCTGTGCCTGGAGGTGACCCTGAAGACGGCTGTGGACGGGCCTGACCTGGAGATG
CTCACGGGGCAGGAGCGCGTGGCCCTGGCCAACCGGAAGCGGGAGTGCGGCAACGCCCACTACCAGCGGGCGGACTTCGTCCTGGCCGCC
AACTCCTACGACCTCGCCATCAAGGCTATCACCTCCAGCGCCAAAGTGGACATGACGTTCGAGGAGGAGGCACAGCTCCTGCAGTTGAAG
GTGAAGTGTCTGAACAACCTGGCGGCCTCGCAGCTGAAGCTCGACCACTACCGCGCAGCCCTGCGCTCCTGCAGCCTTGTGCTGGAGCAC
CAGCCAGACAACATCAAGGCTCTCTTCCGCAAGGGCAAGGTGCTGGCCCAGCAGGGGGAGTACAGTGAGGCCATCCCCATCCTGAGGGCA
GCCCTGAAGCTGGAACCTTCCAACAAGTGACCGGCTTCGCACAATGACCAACGTACTGGGGGACTCAATTGGAGCGGCCGTCATCGAGCA
CTTGTCTCAGCGGGAGCTGGAGCTTCAGGAAGCTGAGCTTACCCTCCCCAGCCTGGGGAAACCCTACAAGTCCCTCATGGCACAGGAGAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_FKBP8_ENST00000597960_chr19_18644080_-_SLC1A6_ENST00000600144_chr19_15061202_-_1340nt
AAGCGGCCGAACCTGGTTCCCGAGGCGCGGCGGCCGCGGCTGGGGGCGGGGAGGGGGGCGCAGGACCCCAAGTGGGGGTCCCGGAGCCAG
AGGCAAGGCCAATTCCTGTCCCCCCAGCAGCATGGCATCGTGTGCTGAACCCTCTGAGCCCTCTGCCCCACTGCCCGCCGGGGTCCCACC
GCTCGAGGACTTCGAGGTACTGGATGGGGTTGAGGATGCAGAGGGTGAGGAGGAAGAGGAGGAGGAAGAGGAGGAAGAGGATGACCTGAG
TGAGCTGCCACCGCTGGAGGACATGGGACAACCCCCGGCGGAGGAGGCTGAGCAGCCTGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCAT
GGAGCCCGAGCCCGCCCCAGCCCCGGCCCCAGAAGAGTGGCTGGACATTCTGGGGAACGGGCTGTTGAGGAAGAAGACGCTGGTCCCAGG
GCCGCCAGGTTCGAGCCGCCCGGTCAAGGGCCAGGTGGTCACCGTACATCTGCAGACGTCGCTGGAGAATGGCACACGGGTGCAGGAGGA
GCCGGAGCTGGTGTTCACTCTGGGTGACTGTGACGTCATCCAGGCCCTGGATCTCAGTGTCCCACTCATGGACGTGGGGGAGACGGCCAT
GGTCACTGCTGACTCCAAGTACTGCTACGGCCCCCAAGGCAGCAGGAGCCCATACATCCCCCCGCACGCGGCCCTGTGCCTGGAGGTGAC
CCTGAAGACGGCTGTGGACGGGCCTGACCTGGAGATGCTCACGGGGCAGGAGCGCGTGGCCCTGGCCAACCGGAAGCGGGAGTGCGGCAA
CGCCCACTACCAGCGGGCGGACTTCGTCCTGGCCGCCAACTCCTACGACCTCGCCATCAAGGCTATCACCTCCAGCGCCAAAGTGGACAT
GACGTTCGAGGAGGAGGCACAGCTCCTGCAGTTGAAGGTGAAGTGTCTGAACAACCTGGCGGCCTCGCAGCTGAAGCTCGACCACTACCG
CGCAGCCCTGCGCTCCTGCAGCCTTGTGCTGGAGCACCAGCCAGACAACATCAAGGCTCTCTTCCGCAAGGGCAAGGTGCTGGCCCAGCA
GGGGGAGTACAGTGAGGCCATCCCCATCCTGAGGGCAGCCCTGAAGCTGGAACCTTCCAACAAGTGACCGGCTTCGCACAATGACCAACG
TACTGGGGGACTCAATTGGAGCGGCCGTCATCGAGCACTTGTCTCAGCGGGAGCTGGAGCTTCAGGAAGCTGAGCTTACCCTCCCCAGCC

>In-frame_FKBP8_ENST00000610101_chr19_18644080_-_SLC1A6_ENST00000221742_chr19_15061202_-_868nt
GGCCGAACCTGGTTCCCGAGGCGCGGCGGCCGCGGCTGGGGGCGGGGAGGGGGGCGCAGGACCCCAAGTGGGGGTCCCGGAGCCAGAGGG
CCAATTCCTGTCCCCCCAGCAGCATGGCATCGTGTGCTGAACCCTCTGAGCCCTCTGCCCCACTGCCCGCCGGGGTCCCACCGCTCGAGG
ACTTCGAGGTACTGGATGGGGTTGAGGATGCAGAGGGTGAGGAGGAAGAGGAGGAGGAAGAGGAGGAAGAGGATGACCTGAGTGAGCTGC
CACCGCTGGAGGACATGGGACAACCCCCGGCGGAGGAGGCTGAGCAGCCTGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCATGGAGCCCG
AGCCCGCCCCAGCCCCGGCCCCAGAAGAGTGGCTGGACATTCTGGTGGACATGACGTTCGAGGAGGAGGCACAGCTCCTGCAGTTGAAGG
TGAAGTGTCTGAACAACCTGGCGGCCTCGCAGCTGAAGCTCGACCACTACCGCGCAGCCCTGCGCTCCTGCAGCCTTGTGCTGGAGCACC
AGCCAGACAACATCAAGGCTCTCTTCCGCAAGGGCAAGGTGCTGGCCCAGCAGGGGGAGTACAGTGAGGCCATCCCCATCCTGAGGGCAG
CCCTGAAGCTGGAACCTTCCAACAAGTGACCGGCTTCGCACAATGACCAACGTACTGGGGGACTCAATTGGAGCGGCCGTCATCGAGCAC
TTGTCTCAGCGGGAGCTGGAGCTTCAGGAAGCTGAGCTTACCCTCCCCAGCCTGGGGAAACCCTACAAGTCCCTCATGGCACAGGAGAAG

>In-frame_FKBP8_ENST00000596558_chr19_18644080_-_SLC1A6_ENST00000600144_chr19_15061202_-_1326nt
GAATTGTGCGGGCGCGGGGAATTATGGGGGTGGGGGCTGGGAGGGTCTCTCAAAGTGGGGCTCCGAGCCCGGGAGGAGCAGGCAGGGCCA
ATTCCTGTCCCCCCAGCAGCATGGCATCGTGTGCTGAACCCTCTGAGCCCTCTGCCCCACTGCCCGCCGGGGTCCCACCGCTCGAGGACT
TCGAGGTACTGGATGGGGTTGAGGATGCAGAGGGTGAGGAGGAAGAGGAGGAGGAAGAGGAGGAAGAGGATGACCTGAGTGAGCTGCCAC
CGCTGGAGGACATGGGACAACCCCCGGCGGAGGAGGCTGAGCAGCCTGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCATGGAGCCCGAGC
CCGCCCCAGCCCCGGCCCCAGAAGAGTGGCTGGACATTCTGGGGAACGGGCTGTTGAGGAAGAAGACGCTGGTCCCAGGGCCGCCAGGTT
CGAGCCGCCCGGTCAAGGGCCAGGTGGTCACCGTACATCTGCAGACGTCGCTGGAGAATGGCACACGGGTGCAGGAGGAGCCGGAGCTGG
TGTTCACTCTGGGTGACTGTGACGTCATCCAGGCCCTGGATCTCAGTGTCCCACTCATGGACGTGGGGGAGACGGCCATGGTCACTGCTG
ACTCCAAGTACTGCTACGGCCCCCAAGGCAGGAGCCCATACATCCCCCCGCACGCGGCCCTGTGCCTGGAGGTGACCCTGAAGACGGCTG
TGGACGGGCCTGACCTGGAGATGCTCACGGGGCAGGAGCGCGTGGCCCTGGCCAACCGGAAGCGGGAGTGCGGCAACGCCCACTACCAGC
GGGCGGACTTCGTCCTGGCCGCCAACTCCTACGACCTCGCCATCAAGGCTATCACCTCCAGCGCCAAAGTGGACATGACGTTCGAGGAGG
AGGCACAGCTCCTGCAGTTGAAGGTGAAGTGTCTGAACAACCTGGCGGCCTCGCAGCTGAAGCTCGACCACTACCGCGCAGCCCTGCGCT
CCTGCAGCCTTGTGCTGGAGCACCAGCCAGACAACATCAAGGCTCTCTTCCGCAAGGGCAAGGTGCTGGCCCAGCAGGGGGAGTACAGTG
AGGCCATCCCCATCCTGAGGGCAGCCCTGAAGCTGGAACCTTCCAACAAGTGACCGGCTTCGCACAATGACCAACGTACTGGGGGACTCA
ATTGGAGCGGCCGTCATCGAGCACTTGTCTCAGCGGGAGCTGGAGCTTCAGGAAGCTGAGCTTACCCTCCCCAGCCTGGGGAAACCCTAC

>In-frame_FKBP8_ENST00000222308_chr19_18644080_-_SLC1A6_ENST00000221742_chr19_15061202_-_1296nt
GGGGGCGCAGGACCCCAAGTGGGGGTCCCGGAGCCAGAGGGCCAATTCCTGTCCCCCCAGCAGCATGGCATCGTGTGCTGAACCCTCTGA
GCCCTCTGCCCCACTGCCCGCCGGGGTCCCACCGCTCGAGGACTTCGAGGTACTGGATGGGGTTGAGGATGCAGAGGGTGAGGAGGAAGA
GGAGGAGGAAGAGGAGGAAGAGGATGACCTGAGTGAGCTGCCACCGCTGGAGGACATGGGACAACCCCCGGCGGAGGAGGCTGAGCAGCC
TGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCATGGAGCCCGAGCCCGCCCCAGCCCCGGCCCCAGAAGAGTGGCTGGACATTCTGGGGAA
CGGGCTGTTGAGGAAGAAGACGCTGGTCCCAGGGCCGCCAGGTTCGAGCCGCCCGGTCAAGGGCCAGGTGGTCACCGTACATCTGCAGAC
GTCGCTGGAGAATGGCACACGGGTGCAGGAGGAGCCGGAGCTGGTGTTCACTCTGGGTGACTGTGACGTCATCCAGGCCCTGGATCTCAG
TGTCCCACTCATGGACGTGGGGGAGACGGCCATGGTCACTGCTGACTCCAAGTACTGCTACGGCCCCCAAGGCAGGAGCCCATACATCCC
CCCGCACGCGGCCCTGTGCCTGGAGGTGACCCTGAAGACGGCTGTGGACGGGCCTGACCTGGAGATGCTCACGGGGCAGGAGCGCGTGGC
CCTGGCCAACCGGAAGCGGGAGTGCGGCAACGCCCACTACCAGCGGGCGGACTTCGTCCTGGCCGCCAACTCCTACGACCTCGCCATCAA
GGCTATCACCTCCAGCGCCAAAGTGGACATGACGTTCGAGGAGGAGGCACAGCTCCTGCAGTTGAAGGTGAAGTGTCTGAACAACCTGGC
GGCCTCGCAGCTGAAGCTCGACCACTACCGCGCAGCCCTGCGCTCCTGCAGCCTTGTGCTGGAGCACCAGCCAGACAACATCAAGGCTCT
CTTCCGCAAGGGCAAGGTGCTGGCCCAGCAGGGGGAGTACAGTGAGGCCATCCCCATCCTGAGGGCAGCCCTGAAGCTGGAACCTTCCAA
CAAGTGACCGGCTTCGCACAATGACCAACGTACTGGGGGACTCAATTGGAGCGGCCGTCATCGAGCACTTGTCTCAGCGGGAGCTGGAGC
TTCAGGAAGCTGAGCTTACCCTCCCCAGCCTGGGGAAACCCTACAAGTCCCTCATGGCACAGGAGAAGGGGGCATCCCGGGGACGGGGAG

>In-frame_FKBP8_ENST00000608443_chr19_18644080_-_SLC1A6_ENST00000221742_chr19_15061202_-_1435nt
ACGCCCGGGACGGACGTCTGCATGAGCCAACGGGTGCGGCAGTCGCGGCAGCGGCGGCCAATGGGCACGGCAGGGGCGGGGCCAAGCGGC
CGAACCTGGTTCCCGAGGCGCGGCGGCCGCGGCTGGGGGCGGGGAGGGGGGCGCAGGACCCCAAGTGGGGGTCCCGGAGCCAGAGGGCCA
ATTCCTGTCCCCCCAGCAGCATGGCATCGTGTGCTGAACCCTCTGAGCCCTCTGCCCCACTGCCCGCCGGGGTCCCACCGCTCGAGGACT
TCGAGGTACTGGATGGGGTTGAGGATGCAGAGGGTGAGGAGGAAGAGGAGGAGGAAGAGGAGGAAGAGGATGACCTGAGTGAGCTGCCAC
CGCTGGAGGACATGGGACAACCCCCGGCGGAGGAGGCTGAGCAGCCTGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCATGGAGCCCGAGC
CCGCCCCAGCCCCGGCCCCAGAAGAGTGGCTGGACATTCTGGGGAACGGGCTGTTGAGGAAGAAGACGCTGGTCCCAGGGCCGCCAGGTT
CGAGCCGCCCGGTCAAGGGCCAGGTGGTCACCGTACATCTGCAGACGTCGCTGGAGAATGGCACACGGGTGCAGGAGGAGCCGGAGCTGG
TGTTCACTCTGGGTGACTGTGACGTCATCCAGGCCCTGGATCTCAGTGTCCCACTCATGGACGTGGGGGAGACGGCCATGGTCACTGCTG
ACTCCAAGTACTGCTACGGCCCCCAAGGCAGCAGGAGCCCATACATCCCCCCGCACGCGGCCCTGTGCCTGGAGGTGACCCTGAAGACGG
CTGTGGACGGGCCTGACCTGGAGATGCTCACGGGGCAGGAGCGCGTGGCCCTGGCCAACCGGAAGCGGGAGTGCGGCAACGCCCACTACC
AGCGGGCGGACTTCGTCCTGGCCGCCAACTCCTACGACCTCGCCATCAAGGCTATCACCTCCAGCGCCAAAGTGGACATGACGTTCGAGG
AGGAGGCACAGCTCCTGCAGTTGAAGGTGAAGTGTCTGAACAACCTGGCGGCCTCGCAGCTGAAGCTCGACCACTACCGCGCAGCCCTGC
GCTCCTGCAGCCTTGTGCTGGAGCACCAGCCAGACAACATCAAGGCTCTCTTCCGCAAGGGCAAGGTGCTGGCCCAGCAGGGGGAGTACA
GTGAGGCCATCCCCATCCTGAGGGCAGCCCTGAAGCTGGAACCTTCCAACAAGTGACCGGCTTCGCACAATGACCAACGTACTGGGGGAC
TCAATTGGAGCGGCCGTCATCGAGCACTTGTCTCAGCGGGAGCTGGAGCTTCAGGAAGCTGAGCTTACCCTCCCCAGCCTGGGGAAACCC

>In-frame_FKBP8_ENST00000453489_chr19_18644080_-_SLC1A6_ENST00000430939_chr19_15061202_-_1487nt
GAATTGTGCGGGCGCGGGGAATTATGGGGGTGGGGGCTGGGAGGGTCTCTCAAAGTGGGGCTCCGAGCCCGGGAGGAGCAGGCAGGGCCA
ATTCCTGTCCCCCCAGCAGCATGGCATCGTGTGCTGAACCCTCTGAGCCCTCTGCCCCACTGCCCGCCGGGGTCCCACCGCTCGAGGACT
TCGAGGTACTGGATGGGGTTGAGGATGCAGAGGGTGAGGAGGAAGAGGAGGAGGAAGAGGAGGAAGAGGATGACCTGAGTGAGCTGCCAC
CGCTGGAGGACATGGGACAACCCCCGGCGGAGGAGGCTGAGCAGCCTGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCATGGAGCCCGAGC
CCGCCCCAGCCCCGGCCCCAGAAGAGTGGCTGGACATTCTGGGGAACGGGCTGTTGAGGAAGAAGACGCTGGTCCCAGGGCCGCCAGGTT
CGAGCCGCCCGGTCAAGGGCCAGGTGGTCACCGTACATCTGCAGACGTCGCTGGAGAATGGCACACGGGTGCAGGAGGAGCCGGAGCTGG
TGTTCACTCTGGGTGACTGTGACGTCATCCAGGCCCTGGATCTCAGTGTCCCACTCATGGACGTGGGGGAGACGGCCATGGTCACTGCTG
ACTCCAAGTACTGCTACGGCCCCCAAGGCAGGAGCCCATACATCCCCCCGCACGCGGCCCTGTGCCTGGAGGTGACCCTGAAGACGGCTG
TGGACGGGCCTGACCTGGAGATGCTCACGGGGCAGGAGCGCGTGGCCCTGGCCAACCGGAAGCGGGAGTGCGGCAACGCCCACTACCAGC
GGGCGGACTTCGTCCTGGCCGCCAACTCCTACGACCTCGCCATCAAGGCTATCACCTCCAGCGCCAAAGTGGACATGACGTTCGAGGAGG
AGGCACAGCTCCTGCAGTTGAAGGTGAAGTGTCTGAACAACCTGGCGGCCTCGCAGCTGAAGCTCGACCACTACCGCGCAGCCCTGCGCT
CCTGCAGCCTTGTGCTGGAGCACCAGCCAGACAACATCAAGGCTCTCTTCCGCAAGGGCAAGGTGCTGGCCCAGCAGGGGGAGTACAGTG
AGGCCATCCCCATCCTGAGGGCAGCCCTGAAGCTGGAACCTTCCAACAAGTGACCGGCTTCGCACAATGACCAACGTACTGGGGGACTCA
ATTGGAGCGGCCGTCATCGAGCACTTGTCTCAGCGGGAGCTGGAGCTTCAGGAAGCTGAGCTTACCCTCCCCAGCCTGGGGAAACCCTAC
AAGTCCCTCATGGCACAGGAGAAGGGGGCATCCCGGGGACGGGGAGGCAACGAGAGTGCTATGTGAGGGGCCTCCAGCTCTGCCCCCCCA
GAGAGGAGGGAAGGGGGCTGGGGAGGGGAGTCCTGGTGACACATCTGTTGCCCAACTGACCGTGGGCTGAACACACGTTCTGCTTGACTC


Top

FusionGenePPI for FKBP8_SLC1A6


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
FKBP8BCL2, BCL2L1, USP19, BRE, EGFR, HSP90AA1, CALM1, PSMC1, PSMC2, PSMC3, PSMC4, PSMC5, PSMC6, PSMD1, PSMD2, PSMD3, PSMD4, PSMD6, PSMD7, PSMD11, PSMD12, PSMD13, PSMD14, PSMA1, PSMA2, PSMA3, PSMA4, PSMA5, PSMA6, PSMA7, PSMB1, PSMB2, PSMB3, PSMB5, PSMB7, ADRM1, PTPRK, UBC, TERF1, EGLN1, CUL3, VHL, ATP13A2, SURF1, MRPL11, YME1L1, UQCRC1, UQCRC2, MRPL15, SSR1, UQCRFS1, PGRMC1, DHODH, NDUFB10, TOMM22, ABCC1, NNT, KCNH2, FKBP8, CAMK2A, CLN3, ADRB2, BNIPL, ARHGEF5, CDK20, PDCL, SUGT1, PTGES3, CACYBP, HSPBP1, RHEB, MTOR, MLST8, RPTOR, RICTOR, CCDC8, RPS6KB2, ABCB7, TCTN2, TCTN3, EVC2, TMEM216, MLH1, XRCC3, VAPA, ATP6AP2, COQ9, TMEM258, CLCN1, CUL4A, CUL4B, MTMR11, PTPMT1, ANKMY2SLC1A6ARIH2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for FKBP8_SLC1A6


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneSLC1A6P48664DB00142Glutamic AcidExcitatory amino acid transporter 4small moleculeapproved|nutraceutical

Top

RelatedDiseases for FKBP8_SLC1A6


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneSLC1A6C0005586Bipolar Disorder1PSYGENET
TgeneSLC1A6C0036341Schizophrenia1PSYGENET
TgeneSLC1A6C0041696Unipolar Depression1PSYGENET
TgeneSLC1A6C1269683Major Depressive Disorder1PSYGENET