FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 13537

FusionGeneSummary for FKBP8_MEF2B

check button Fusion gene summary
Fusion gene informationFusion gene name: FKBP8_MEF2B
Fusion gene ID: 13537
HgeneTgene
Gene symbol

FKBP8

MEF2B

Gene ID

23770

100271849

Gene nameFK506 binding protein 8myocyte enhancer factor 2B
SynonymsFKBP38|FKBPr38RSRFR2
Cytomap

19p13.11

19p13.11

Type of geneprotein-codingprotein-coding
Descriptionpeptidyl-prolyl cis-trans isomerase FKBP838 kDa FK506-binding protein38 kDa FKBPFK506 binding protein 8, 38kDaFKBP-38FKBP-8PPIase FKBP8hFKBP38rotamasemyocyte-specific enhancer factor 2BMADS box transcription enhancer factor 2, polypeptide B (myocyte enhancer factor 2B)serum response factor-like protein 2
Modification date2018052220180523
UniProtAcc

Q14318

Q02080

Ensembl transtripts involved in fusion geneENST00000597960, ENST00000610101, 
ENST00000596558, ENST00000222308, 
ENST00000608443, ENST00000453489, 
ENST00000409224, ENST00000424583, 
ENST00000410050, ENST00000602424, 
ENST00000409447, ENST00000162023, 
Fusion gene scores* DoF score10 X 11 X 4=4403 X 3 X 3=27
# samples 113
** MAII scorelog2(11/440*10)=-2
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(3/27*10)=0.15200309344505
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: FKBP8 [Title/Abstract] AND MEF2B [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneMEF2B

GO:0045944

positive regulation of transcription by RNA polymerase II

7760790


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDOVTCGA-61-2000-01AFKBP8chr19

18649026

-MEF2Bchr19

19258641

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000597960ENST00000409224FKBP8chr19

18649026

-MEF2Bchr19

19258641

-
In-frameENST00000597960ENST00000424583FKBP8chr19

18649026

-MEF2Bchr19

19258641

-
In-frameENST00000597960ENST00000410050FKBP8chr19

18649026

-MEF2Bchr19

19258641

-
In-frameENST00000597960ENST00000602424FKBP8chr19

18649026

-MEF2Bchr19

19258641

-
In-frameENST00000597960ENST00000409447FKBP8chr19

18649026

-MEF2Bchr19

19258641

-
In-frameENST00000597960ENST00000162023FKBP8chr19

18649026

-MEF2Bchr19

19258641

-
intron-3CDSENST00000610101ENST00000409224FKBP8chr19

18649026

-MEF2Bchr19

19258641

-
intron-3CDSENST00000610101ENST00000424583FKBP8chr19

18649026

-MEF2Bchr19

19258641

-
intron-3CDSENST00000610101ENST00000410050FKBP8chr19

18649026

-MEF2Bchr19

19258641

-
intron-3CDSENST00000610101ENST00000602424FKBP8chr19

18649026

-MEF2Bchr19

19258641

-
intron-3CDSENST00000610101ENST00000409447FKBP8chr19

18649026

-MEF2Bchr19

19258641

-
intron-3CDSENST00000610101ENST00000162023FKBP8chr19

18649026

-MEF2Bchr19

19258641

-
In-frameENST00000596558ENST00000409224FKBP8chr19

18649026

-MEF2Bchr19

19258641

-
In-frameENST00000596558ENST00000424583FKBP8chr19

18649026

-MEF2Bchr19

19258641

-
In-frameENST00000596558ENST00000410050FKBP8chr19

18649026

-MEF2Bchr19

19258641

-
In-frameENST00000596558ENST00000602424FKBP8chr19

18649026

-MEF2Bchr19

19258641

-
In-frameENST00000596558ENST00000409447FKBP8chr19

18649026

-MEF2Bchr19

19258641

-
In-frameENST00000596558ENST00000162023FKBP8chr19

18649026

-MEF2Bchr19

19258641

-
Frame-shitENST00000222308ENST00000409224FKBP8chr19

18649026

-MEF2Bchr19

19258641

-
Frame-shitENST00000222308ENST00000424583FKBP8chr19

18649026

-MEF2Bchr19

19258641

-
Frame-shitENST00000222308ENST00000410050FKBP8chr19

18649026

-MEF2Bchr19

19258641

-
Frame-shitENST00000222308ENST00000602424FKBP8chr19

18649026

-MEF2Bchr19

19258641

-
Frame-shitENST00000222308ENST00000409447FKBP8chr19

18649026

-MEF2Bchr19

19258641

-
Frame-shitENST00000222308ENST00000162023FKBP8chr19

18649026

-MEF2Bchr19

19258641

-
Frame-shitENST00000608443ENST00000409224FKBP8chr19

18649026

-MEF2Bchr19

19258641

-
Frame-shitENST00000608443ENST00000424583FKBP8chr19

18649026

-MEF2Bchr19

19258641

-
Frame-shitENST00000608443ENST00000410050FKBP8chr19

18649026

-MEF2Bchr19

19258641

-
Frame-shitENST00000608443ENST00000602424FKBP8chr19

18649026

-MEF2Bchr19

19258641

-
Frame-shitENST00000608443ENST00000409447FKBP8chr19

18649026

-MEF2Bchr19

19258641

-
Frame-shitENST00000608443ENST00000162023FKBP8chr19

18649026

-MEF2Bchr19

19258641

-
Frame-shitENST00000453489ENST00000409224FKBP8chr19

18649026

-MEF2Bchr19

19258641

-
Frame-shitENST00000453489ENST00000424583FKBP8chr19

18649026

-MEF2Bchr19

19258641

-
Frame-shitENST00000453489ENST00000410050FKBP8chr19

18649026

-MEF2Bchr19

19258641

-
Frame-shitENST00000453489ENST00000602424FKBP8chr19

18649026

-MEF2Bchr19

19258641

-
Frame-shitENST00000453489ENST00000409447FKBP8chr19

18649026

-MEF2Bchr19

19258641

-
Frame-shitENST00000453489ENST00000162023FKBP8chr19

18649026

-MEF2Bchr19

19258641

-

Top

FusionProtFeatures for FKBP8_MEF2B


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
FKBP8

Q14318

MEF2B

Q02080

Constitutively inactive PPiase, which becomes activewhen bound to calmodulin and calcium. Seems to act as a chaperonefor BCL2, targets it to the mitochondria and modulates itsphosphorylation state. The BCL2/FKBP8/calmodulin/calcium complexprobably interferes with the binding of BCL2 to its targets. Theactive form of FKBP8 may therefore play a role in the regulationof apoptosis. {ECO:0000269|PubMed:12510191,ECO:0000269|PubMed:15757646, ECO:0000269|PubMed:16176796}. Transcriptional activator which binds specifically tothe MEF2 element, 5'-YTA[AT](4)TAR-3', found in numerous muscle-specific genes. Activates transcription via this element. May beinvolved in muscle-specific and/or growth factor-relatedtranscription.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneFKBP8chr19:18649026chr19:19258641ENST00000222308-5922_92256413Compositional biasNote=Glu-rich
HgeneFKBP8chr19:18649026chr19:19258641ENST00000596558-5922_92256413Compositional biasNote=Glu-rich
HgeneFKBP8chr19:18649026chr19:19258641ENST00000597960-5922_92257414Compositional biasNote=Glu-rich
HgeneFKBP8chr19:18649026chr19:19258641ENST00000222308-59120_204256413DomainPPIase FKBP-type
HgeneFKBP8chr19:18649026chr19:19258641ENST00000596558-59120_204256413DomainPPIase FKBP-type
HgeneFKBP8chr19:18649026chr19:19258641ENST00000597960-59120_204257414DomainPPIase FKBP-type
HgeneFKBP8chr19:18649026chr19:19258641ENST00000222308-59221_254256413RepeatNote=TPR 1
HgeneFKBP8chr19:18649026chr19:19258641ENST00000596558-59221_254256413RepeatNote=TPR 1
HgeneFKBP8chr19:18649026chr19:19258641ENST00000597960-59221_254257414RepeatNote=TPR 1

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneFKBP8chr19:18649026chr19:19258641ENST00000222308-59272_305256413RepeatNote=TPR 2
HgeneFKBP8chr19:18649026chr19:19258641ENST00000222308-59306_339256413RepeatNote=TPR 3
HgeneFKBP8chr19:18649026chr19:19258641ENST00000596558-59272_305256413RepeatNote=TPR 2
HgeneFKBP8chr19:18649026chr19:19258641ENST00000596558-59306_339256413RepeatNote=TPR 3
HgeneFKBP8chr19:18649026chr19:19258641ENST00000597960-59272_305257414RepeatNote=TPR 2
HgeneFKBP8chr19:18649026chr19:19258641ENST00000597960-59306_339257414RepeatNote=TPR 3
HgeneFKBP8chr19:18649026chr19:19258641ENST00000222308-59390_410256413TransmembraneHelical
HgeneFKBP8chr19:18649026chr19:19258641ENST00000596558-59390_410256413TransmembraneHelical
HgeneFKBP8chr19:18649026chr19:19258641ENST00000597960-59390_410257414TransmembraneHelical
TgeneMEF2Bchr19:18649026chr19:19258641ENST00000162023-6134_3186369Compositional biasNote=Lys-rich (basic)
TgeneMEF2Bchr19:18649026chr19:19258641ENST00000424583-294_3186369Compositional biasNote=Lys-rich (basic)
TgeneMEF2Bchr19:18649026chr19:19258641ENST00000602424-4104_3186366Compositional biasNote=Lys-rich (basic)
TgeneMEF2Bchr19:18649026chr19:19258641ENST00000162023-61358_8686369DNA bindingMef2-type
TgeneMEF2Bchr19:18649026chr19:19258641ENST00000424583-2958_8686369DNA bindingMef2-type
TgeneMEF2Bchr19:18649026chr19:19258641ENST00000602424-41058_8686366DNA bindingMef2-type
TgeneMEF2Bchr19:18649026chr19:19258641ENST00000162023-6133_5786369DomainMADS-box
TgeneMEF2Bchr19:18649026chr19:19258641ENST00000424583-293_5786369DomainMADS-box
TgeneMEF2Bchr19:18649026chr19:19258641ENST00000602424-4103_5786366DomainMADS-box


Top

FusionGeneSequence for FKBP8_MEF2B


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_FKBP8_ENST00000597960_chr19_18649026_-_MEF2B_ENST00000409224_chr19_19258641_-_466aa
MASCAEPSEPSAPLPAGVPPLEDFEVLDGVEDAEGEEEEEEEEEEEDDLSELPPLEDMGQPPAEEAEQPGALAREFLAAMEPEPAPAPAP
EEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYG
PQGSRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRKRECGNAHYQRADFVLAANSYDLAIKAITSSAKDAEAEGHWPRWAR
AGAG_RA_GARREVSEAGRRRG_SGLAPTPAVSCSSCTAQPRCGIRGLTATRL_PQWAWGSTARPEPPISLPTSSPQSRAPRPGAPSLLT
KPPHQQDTTPTVPADGRAEVRPAWWPGWAPRGTKHLQKPLQWPAEPLLHCNSRTPTGELPLPPRRPPRIWPGRPSTAPWLVAAPHPGPLA

>In-frame_FKBP8_ENST00000597960_chr19_18649026_-_MEF2B_ENST00000424583_chr19_19258641_-_540aa
MASCAEPSEPSAPLPAGVPPLEDFEVLDGVEDAEGEEEEEEEEEEEDDLSELPPLEDMGQPPAEEAEQPGALAREFLAAMEPEPAPAPAP
EEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYG
PQGSRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRKRECGNAHYQRADFVLAANSYDLAIKAITSSAKDAEAEGHWPRWAR
AGAG_RA_GARREVSEAGRRRG_SGLAPTPAVSCSSCTAQPRCGIRGLTATRL_PQWAWGSTARPEPPISLPTSSPQSRAPRPGAPSLLT
KPPHQQDTTPTVPADGRAEVRPAWWPGWAPRGTKHLQKPLQWPAEPLLHCNSRTPTGELPLPPRRPPRIWPGRPSTAPWLVAAPHPGPLA
ALEG_WAPRRVLPAQWGPKPGRGGSPNPRRLPADPPSQHQV_APLSGPRGPRRLS_DLPLSLAPRPVPGRASAAWARPAPAALGRRLAPV

>In-frame_FKBP8_ENST00000597960_chr19_18649026_-_MEF2B_ENST00000410050_chr19_19258641_-_547aa
MASCAEPSEPSAPLPAGVPPLEDFEVLDGVEDAEGEEEEEEEEEEEDDLSELPPLEDMGQPPAEEAEQPGALAREFLAAMEPEPAPAPAP
EEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYG
PQGSRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRKRECGNAHYQRADFVLAANSYDLAIKAITSSAKDAEAEGHWPRWAR
AGAG_RA_GARREVSEAGRRRG_SGLAPTPAVSCSSCTAQPRCGIRGLTATRL_PQWAWGSTARPEPPISLPTSSPQSRAPRPGAPSLLT
KPPHQQDTTPTVPADGRAEVRPAWWPGWAPRGTKHLQKPLQWPAEPLLHCNSRTPTGELPLPPRRPPSPQFLPTRIWPGRPSTAPWLVAA
PHPGPLAALEG_WAPRRVLPAQWGPKPGRGGSPNPRRLPADPPSQHQV_APLSGPRGPRRLS_DLPLSLAPRPVPGRASAAWARPAPAAL

>In-frame_FKBP8_ENST00000597960_chr19_18649026_-_MEF2B_ENST00000602424_chr19_19258641_-_537aa
MASCAEPSEPSAPLPAGVPPLEDFEVLDGVEDAEGEEEEEEEEEEEDDLSELPPLEDMGQPPAEEAEQPGALAREFLAAMEPEPAPAPAP
EEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYG
PQGSRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRKRECGNAHYQRADFVLAANSYDLAIKAITSSAKDAEAEGHWPRWAR
AGAG_RA_GARREVSEAGRRRG_SGLAPTPAVSCSSCTAQPRCGIRGLTATRL_PQWAWGSTARPEPPISLPTSSPQSRAPRPGAPSLLT
KPPHQQDTTPTVPADGRAEVRPAWWPGWAPRGTKHLQKPLQWPAEPLLHCNSRTPTGELPLPPRRPPSGGRSLGEEGPPTRGASPPTPPV

>In-frame_FKBP8_ENST00000597960_chr19_18649026_-_MEF2B_ENST00000409447_chr19_19258641_-_458aa
MASCAEPSEPSAPLPAGVPPLEDFEVLDGVEDAEGEEEEEEEEEEEDDLSELPPLEDMGQPPAEEAEQPGALAREFLAAMEPEPAPAPAP
EEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYG
PQGSRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRKRECGNAHYQRADFVLAANSYDLAIKAITSSAKDAEAEGHWPRWAR
AGAG_RA_GARREVSEAGRRRG_SGLAPTPAVSCSSCTAQPRCGIRGLTATRL_PQWAWGSTARPEPPISLPTSSPQSRAPREASTVACR
TPAPLQLPDPHWGASPSSPEAPQWGPKPGRGGSPNPRRLPADPPSQHQV_APLSGPRGPRRLS_DLPLSLAPRPVPGRASAAWARPAPAA

>In-frame_FKBP8_ENST00000597960_chr19_18649026_-_MEF2B_ENST00000162023_chr19_19258641_-_540aa
MASCAEPSEPSAPLPAGVPPLEDFEVLDGVEDAEGEEEEEEEEEEEDDLSELPPLEDMGQPPAEEAEQPGALAREFLAAMEPEPAPAPAP
EEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYG
PQGSRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRKRECGNAHYQRADFVLAANSYDLAIKAITSSAKDAEAEGHWPRWAR
AGAG_RA_GARREVSEAGRRRG_SGLAPTPAVSCSSCTAQPRCGIRGLTATRL_PQWAWGSTARPEPPISLPTSSPQSRAPRPGAPSLLT
KPPHQQDTTPTVPADGRAEVRPAWWPGWAPRGTKHLQKPLQWPAEPLLHCNSRTPTGELPLPPRRPPRIWPGRPSTAPWLVAAPHPGPLA
ALEG_WAPRRVLPAQWGPKPGRGGSPNPRRLPADPPSQHQV_APLSGPRGPRRLS_DLPLSLAPRPVPGRASAAWARPAPAALGRRLAPV

>In-frame_FKBP8_ENST00000596558_chr19_18649026_-_MEF2B_ENST00000409224_chr19_19258641_-_465aa
MASCAEPSEPSAPLPAGVPPLEDFEVLDGVEDAEGEEEEEEEEEEEDDLSELPPLEDMGQPPAEEAEQPGALAREFLAAMEPEPAPAPAP
EEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYG
PQGRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRKRECGNAHYQRADFVLAANSYDLAIKAITSSAKDAEAEGHWPRWARA
GAG_RA_GARREVSEAGRRRG_SGLAPTPAVSCSSCTAQPRCGIRGLTATRL_PQWAWGSTARPEPPISLPTSSPQSRAPRPGAPSLLTK
PPHQQDTTPTVPADGRAEVRPAWWPGWAPRGTKHLQKPLQWPAEPLLHCNSRTPTGELPLPPRRPPRIWPGRPSTAPWLVAAPHPGPLAA

>In-frame_FKBP8_ENST00000596558_chr19_18649026_-_MEF2B_ENST00000424583_chr19_19258641_-_539aa
MASCAEPSEPSAPLPAGVPPLEDFEVLDGVEDAEGEEEEEEEEEEEDDLSELPPLEDMGQPPAEEAEQPGALAREFLAAMEPEPAPAPAP
EEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYG
PQGRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRKRECGNAHYQRADFVLAANSYDLAIKAITSSAKDAEAEGHWPRWARA
GAG_RA_GARREVSEAGRRRG_SGLAPTPAVSCSSCTAQPRCGIRGLTATRL_PQWAWGSTARPEPPISLPTSSPQSRAPRPGAPSLLTK
PPHQQDTTPTVPADGRAEVRPAWWPGWAPRGTKHLQKPLQWPAEPLLHCNSRTPTGELPLPPRRPPRIWPGRPSTAPWLVAAPHPGPLAA

>In-frame_FKBP8_ENST00000596558_chr19_18649026_-_MEF2B_ENST00000410050_chr19_19258641_-_546aa
MASCAEPSEPSAPLPAGVPPLEDFEVLDGVEDAEGEEEEEEEEEEEDDLSELPPLEDMGQPPAEEAEQPGALAREFLAAMEPEPAPAPAP
EEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYG
PQGRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRKRECGNAHYQRADFVLAANSYDLAIKAITSSAKDAEAEGHWPRWARA
GAG_RA_GARREVSEAGRRRG_SGLAPTPAVSCSSCTAQPRCGIRGLTATRL_PQWAWGSTARPEPPISLPTSSPQSRAPRPGAPSLLTK
PPHQQDTTPTVPADGRAEVRPAWWPGWAPRGTKHLQKPLQWPAEPLLHCNSRTPTGELPLPPRRPPSPQFLPTRIWPGRPSTAPWLVAAP
HPGPLAALEG_WAPRRVLPAQWGPKPGRGGSPNPRRLPADPPSQHQV_APLSGPRGPRRLS_DLPLSLAPRPVPGRASAAWARPAPAALG

>In-frame_FKBP8_ENST00000596558_chr19_18649026_-_MEF2B_ENST00000602424_chr19_19258641_-_536aa
MASCAEPSEPSAPLPAGVPPLEDFEVLDGVEDAEGEEEEEEEEEEEDDLSELPPLEDMGQPPAEEAEQPGALAREFLAAMEPEPAPAPAP
EEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYG
PQGRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRKRECGNAHYQRADFVLAANSYDLAIKAITSSAKDAEAEGHWPRWARA
GAG_RA_GARREVSEAGRRRG_SGLAPTPAVSCSSCTAQPRCGIRGLTATRL_PQWAWGSTARPEPPISLPTSSPQSRAPRPGAPSLLTK
PPHQQDTTPTVPADGRAEVRPAWWPGWAPRGTKHLQKPLQWPAEPLLHCNSRTPTGELPLPPRRPPSGGRSLGEEGPPTRGASPPTPPVS

>In-frame_FKBP8_ENST00000596558_chr19_18649026_-_MEF2B_ENST00000409447_chr19_19258641_-_457aa
MASCAEPSEPSAPLPAGVPPLEDFEVLDGVEDAEGEEEEEEEEEEEDDLSELPPLEDMGQPPAEEAEQPGALAREFLAAMEPEPAPAPAP
EEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYG
PQGRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRKRECGNAHYQRADFVLAANSYDLAIKAITSSAKDAEAEGHWPRWARA
GAG_RA_GARREVSEAGRRRG_SGLAPTPAVSCSSCTAQPRCGIRGLTATRL_PQWAWGSTARPEPPISLPTSSPQSRAPREASTVACRT
PAPLQLPDPHWGASPSSPEAPQWGPKPGRGGSPNPRRLPADPPSQHQV_APLSGPRGPRRLS_DLPLSLAPRPVPGRASAAWARPAPAAL

>In-frame_FKBP8_ENST00000596558_chr19_18649026_-_MEF2B_ENST00000162023_chr19_19258641_-_539aa
MASCAEPSEPSAPLPAGVPPLEDFEVLDGVEDAEGEEEEEEEEEEEDDLSELPPLEDMGQPPAEEAEQPGALAREFLAAMEPEPAPAPAP
EEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYG
PQGRSPYIPPHAALCLEVTLKTAVDGPDLEMLTGQERVALANRKRECGNAHYQRADFVLAANSYDLAIKAITSSAKDAEAEGHWPRWARA
GAG_RA_GARREVSEAGRRRG_SGLAPTPAVSCSSCTAQPRCGIRGLTATRL_PQWAWGSTARPEPPISLPTSSPQSRAPRPGAPSLLTK
PPHQQDTTPTVPADGRAEVRPAWWPGWAPRGTKHLQKPLQWPAEPLLHCNSRTPTGELPLPPRRPPRIWPGRPSTAPWLVAAPHPGPLAA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_FKBP8_ENST00000597960_chr19_18649026_-_MEF2B_ENST00000409224_chr19_19258641_-_1399nt
ATGGCATCGTGTGCTGAACCCTCTGAGCCCTCTGCCCCACTGCCCGCCGGGGTCCCACCGCTCGAGGACTTCGAGGTACTGGATGGGGTT
GAGGATGCAGAGGGTGAGGAGGAAGAGGAGGAGGAAGAGGAGGAAGAGGATGACCTGAGTGAGCTGCCACCGCTGGAGGACATGGGACAA
CCCCCGGCGGAGGAGGCTGAGCAGCCTGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCATGGAGCCCGAGCCCGCCCCAGCCCCGGCCCCA
GAAGAGTGGCTGGACATTCTGGGGAACGGGCTGTTGAGGAAGAAGACGCTGGTCCCAGGGCCGCCAGGTTCGAGCCGCCCGGTCAAGGGC
CAGGTGGTCACCGTACATCTGCAGACGTCGCTGGAGAATGGCACACGGGTGCAGGAGGAGCCGGAGCTGGTGTTCACTCTGGGTGACTGT
GACGTCATCCAGGCCCTGGATCTCAGTGTCCCACTCATGGACGTGGGGGAGACGGCCATGGTCACTGCTGACTCCAAGTACTGCTACGGC
CCCCAAGGCAGCAGGAGCCCATACATCCCCCCGCACGCGGCCCTGTGCCTGGAGGTGACCCTGAAGACGGCTGTGGACGGGCCTGACCTG
GAGATGCTCACGGGGCAGGAGCGCGTGGCCCTGGCCAACCGGAAGCGGGAGTGCGGCAACGCCCACTACCAGCGGGCGGACTTCGTCCTG
GCCGCCAACTCCTACGACCTCGCCATCAAGGCTATCACCTCCAGCGCCAAAGACGCTGAAGCGGAGGGGCATTGGCCTCGATGGGCCAGA
GCTGGAGCCGGATGAAGGGCCTGAGGAGCCAGGAGAGAAGTTTCGGAGGCTGGCAGGCGAAGGGGGTGATCCGGCCTTGCCCCGACCCCG
GCTGTATCCTGCAGCTCCTGCTATGCCCAGCCCAGATGTGGTATACGGGGCCTTACCGCCACCAGGCTGTGACCCCAGTGGGCTTGGGGA
AGCACTGCCCGCCCAGAGCCGCCCATCTCCCTTCCGACCAGCAGCCCCCAAAGCCGGGCCCCCAGGCCTGGTGCACCCTCTCTTCTCACC
AAGCCACCTCACCAGCAAGACACCACCCCCACTGTACCTGCCGACGGAAGGGCGGAGGTCAGACCTGCCTGGTGGCCTGGCTGGGCCCCG
AGGGGGACTAAACACCTCCAGAAGCCTCTACAGTGGCCTGCAGAACCCCTGCTCCACTGCAACTCCCGGACCCCCACTGGGGAGCTTCCC
CTTCCTCCCCGGAGGCCCCCCAGAATATGGCCTGGGAGACCCTCCACCGCCCCCTGGCTTGTTGCAGCCCCCCACCCTGGCCCCCTGGCA

>In-frame_FKBP8_ENST00000597960_chr19_18649026_-_MEF2B_ENST00000424583_chr19_19258641_-_1621nt
ATGGCATCGTGTGCTGAACCCTCTGAGCCCTCTGCCCCACTGCCCGCCGGGGTCCCACCGCTCGAGGACTTCGAGGTACTGGATGGGGTT
GAGGATGCAGAGGGTGAGGAGGAAGAGGAGGAGGAAGAGGAGGAAGAGGATGACCTGAGTGAGCTGCCACCGCTGGAGGACATGGGACAA
CCCCCGGCGGAGGAGGCTGAGCAGCCTGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCATGGAGCCCGAGCCCGCCCCAGCCCCGGCCCCA
GAAGAGTGGCTGGACATTCTGGGGAACGGGCTGTTGAGGAAGAAGACGCTGGTCCCAGGGCCGCCAGGTTCGAGCCGCCCGGTCAAGGGC
CAGGTGGTCACCGTACATCTGCAGACGTCGCTGGAGAATGGCACACGGGTGCAGGAGGAGCCGGAGCTGGTGTTCACTCTGGGTGACTGT
GACGTCATCCAGGCCCTGGATCTCAGTGTCCCACTCATGGACGTGGGGGAGACGGCCATGGTCACTGCTGACTCCAAGTACTGCTACGGC
CCCCAAGGCAGCAGGAGCCCATACATCCCCCCGCACGCGGCCCTGTGCCTGGAGGTGACCCTGAAGACGGCTGTGGACGGGCCTGACCTG
GAGATGCTCACGGGGCAGGAGCGCGTGGCCCTGGCCAACCGGAAGCGGGAGTGCGGCAACGCCCACTACCAGCGGGCGGACTTCGTCCTG
GCCGCCAACTCCTACGACCTCGCCATCAAGGCTATCACCTCCAGCGCCAAAGACGCTGAAGCGGAGGGGCATTGGCCTCGATGGGCCAGA
GCTGGAGCCGGATGAAGGGCCTGAGGAGCCAGGAGAGAAGTTTCGGAGGCTGGCAGGCGAAGGGGGTGATCCGGCCTTGCCCCGACCCCG
GCTGTATCCTGCAGCTCCTGCTATGCCCAGCCCAGATGTGGTATACGGGGCCTTACCGCCACCAGGCTGTGACCCCAGTGGGCTTGGGGA
AGCACTGCCCGCCCAGAGCCGCCCATCTCCCTTCCGACCAGCAGCCCCCAAAGCCGGGCCCCCAGGCCTGGTGCACCCTCTCTTCTCACC
AAGCCACCTCACCAGCAAGACACCACCCCCACTGTACCTGCCGACGGAAGGGCGGAGGTCAGACCTGCCTGGTGGCCTGGCTGGGCCCCG
AGGGGGACTAAACACCTCCAGAAGCCTCTACAGTGGCCTGCAGAACCCCTGCTCCACTGCAACTCCCGGACCCCCACTGGGGAGCTTCCC
CTTCCTCCCCGGAGGCCCCCCAGAATATGGCCTGGGAGACCCTCCACCGCCCCCTGGCTTGTTGCAGCCCCCCACCCTGGCCCCCTGGCA
GCCCTCGAGGGGTGATGGGCCCCCCGCCGTGTCCTCCCAGCCCAGTGGGGGCCGAAGCCTGGGCGAGGAGGGTCCCCCAACCCGCGGCGC
CTCCCCGCCGACCCCCCCAGTCAGCATCAAGTCTGAGCGCCTCTCTCCGGCCCCCGGGGGCCCCGGCGACTTTCCTAAGACCTTCCCCTA
TCCCTTGCTCCTCGCCCGGTCCCTGGCAGAGCCTCTGCGGCCTGGGCCCGCCCTGCGCCGGCTGCCCTTGGCCGACGGCTGGCCCCGGTA

>In-frame_FKBP8_ENST00000597960_chr19_18649026_-_MEF2B_ENST00000410050_chr19_19258641_-_1642nt
ATGGCATCGTGTGCTGAACCCTCTGAGCCCTCTGCCCCACTGCCCGCCGGGGTCCCACCGCTCGAGGACTTCGAGGTACTGGATGGGGTT
GAGGATGCAGAGGGTGAGGAGGAAGAGGAGGAGGAAGAGGAGGAAGAGGATGACCTGAGTGAGCTGCCACCGCTGGAGGACATGGGACAA
CCCCCGGCGGAGGAGGCTGAGCAGCCTGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCATGGAGCCCGAGCCCGCCCCAGCCCCGGCCCCA
GAAGAGTGGCTGGACATTCTGGGGAACGGGCTGTTGAGGAAGAAGACGCTGGTCCCAGGGCCGCCAGGTTCGAGCCGCCCGGTCAAGGGC
CAGGTGGTCACCGTACATCTGCAGACGTCGCTGGAGAATGGCACACGGGTGCAGGAGGAGCCGGAGCTGGTGTTCACTCTGGGTGACTGT
GACGTCATCCAGGCCCTGGATCTCAGTGTCCCACTCATGGACGTGGGGGAGACGGCCATGGTCACTGCTGACTCCAAGTACTGCTACGGC
CCCCAAGGCAGCAGGAGCCCATACATCCCCCCGCACGCGGCCCTGTGCCTGGAGGTGACCCTGAAGACGGCTGTGGACGGGCCTGACCTG
GAGATGCTCACGGGGCAGGAGCGCGTGGCCCTGGCCAACCGGAAGCGGGAGTGCGGCAACGCCCACTACCAGCGGGCGGACTTCGTCCTG
GCCGCCAACTCCTACGACCTCGCCATCAAGGCTATCACCTCCAGCGCCAAAGACGCTGAAGCGGAGGGGCATTGGCCTCGATGGGCCAGA
GCTGGAGCCGGATGAAGGGCCTGAGGAGCCAGGAGAGAAGTTTCGGAGGCTGGCAGGCGAAGGGGGTGATCCGGCCTTGCCCCGACCCCG
GCTGTATCCTGCAGCTCCTGCTATGCCCAGCCCAGATGTGGTATACGGGGCCTTACCGCCACCAGGCTGTGACCCCAGTGGGCTTGGGGA
AGCACTGCCCGCCCAGAGCCGCCCATCTCCCTTCCGACCAGCAGCCCCCAAAGCCGGGCCCCCAGGCCTGGTGCACCCTCTCTTCTCACC
AAGCCACCTCACCAGCAAGACACCACCCCCACTGTACCTGCCGACGGAAGGGCGGAGGTCAGACCTGCCTGGTGGCCTGGCTGGGCCCCG
AGGGGGACTAAACACCTCCAGAAGCCTCTACAGTGGCCTGCAGAACCCCTGCTCCACTGCAACTCCCGGACCCCCACTGGGGAGCTTCCC
CTTCCTCCCCGGAGGCCCCCCAGCCCCCAATTCCTGCCCACCAGAATATGGCCTGGGAGACCCTCCACCGCCCCCTGGCTTGTTGCAGCC
CCCCACCCTGGCCCCCTGGCAGCCCTCGAGGGGTGATGGGCCCCCCGCCGTGTCCTCCCAGCCCAGTGGGGGCCGAAGCCTGGGCGAGGA
GGGTCCCCCAACCCGCGGCGCCTCCCCGCCGACCCCCCCAGTCAGCATCAAGTCTGAGCGCCTCTCTCCGGCCCCCGGGGGCCCCGGCGA
CTTTCCTAAGACCTTCCCCTATCCCTTGCTCCTCGCCCGGTCCCTGGCAGAGCCTCTGCGGCCTGGGCCCGCCCTGCGCCGGCTGCCCTT

>In-frame_FKBP8_ENST00000597960_chr19_18649026_-_MEF2B_ENST00000602424_chr19_19258641_-_1612nt
ATGGCATCGTGTGCTGAACCCTCTGAGCCCTCTGCCCCACTGCCCGCCGGGGTCCCACCGCTCGAGGACTTCGAGGTACTGGATGGGGTT
GAGGATGCAGAGGGTGAGGAGGAAGAGGAGGAGGAAGAGGAGGAAGAGGATGACCTGAGTGAGCTGCCACCGCTGGAGGACATGGGACAA
CCCCCGGCGGAGGAGGCTGAGCAGCCTGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCATGGAGCCCGAGCCCGCCCCAGCCCCGGCCCCA
GAAGAGTGGCTGGACATTCTGGGGAACGGGCTGTTGAGGAAGAAGACGCTGGTCCCAGGGCCGCCAGGTTCGAGCCGCCCGGTCAAGGGC
CAGGTGGTCACCGTACATCTGCAGACGTCGCTGGAGAATGGCACACGGGTGCAGGAGGAGCCGGAGCTGGTGTTCACTCTGGGTGACTGT
GACGTCATCCAGGCCCTGGATCTCAGTGTCCCACTCATGGACGTGGGGGAGACGGCCATGGTCACTGCTGACTCCAAGTACTGCTACGGC
CCCCAAGGCAGCAGGAGCCCATACATCCCCCCGCACGCGGCCCTGTGCCTGGAGGTGACCCTGAAGACGGCTGTGGACGGGCCTGACCTG
GAGATGCTCACGGGGCAGGAGCGCGTGGCCCTGGCCAACCGGAAGCGGGAGTGCGGCAACGCCCACTACCAGCGGGCGGACTTCGTCCTG
GCCGCCAACTCCTACGACCTCGCCATCAAGGCTATCACCTCCAGCGCCAAAGACGCTGAAGCGGAGGGGCATTGGCCTCGATGGGCCAGA
GCTGGAGCCGGATGAAGGGCCTGAGGAGCCAGGAGAGAAGTTTCGGAGGCTGGCAGGCGAAGGGGGTGATCCGGCCTTGCCCCGACCCCG
GCTGTATCCTGCAGCTCCTGCTATGCCCAGCCCAGATGTGGTATACGGGGCCTTACCGCCACCAGGCTGTGACCCCAGTGGGCTTGGGGA
AGCACTGCCCGCCCAGAGCCGCCCATCTCCCTTCCGACCAGCAGCCCCCAAAGCCGGGCCCCCAGGCCTGGTGCACCCTCTCTTCTCACC
AAGCCACCTCACCAGCAAGACACCACCCCCACTGTACCTGCCGACGGAAGGGCGGAGGTCAGACCTGCCTGGTGGCCTGGCTGGGCCCCG
AGGGGGACTAAACACCTCCAGAAGCCTCTACAGTGGCCTGCAGAACCCCTGCTCCACTGCAACTCCCGGACCCCCACTGGGGAGCTTCCC
CTTCCTCCCCGGAGGCCCCCCAGTGGGGGCCGAAGCCTGGGCGAGGAGGGTCCCCCAACCCGCGGCGCCTCCCCGCCGACCCCCCCAGTC
AGCATCAAGTCTGAGCGCCTCTCTCCGGCCCCCGGGGGCCCCGGCGACTTTCCTAAGACCTTCCCCTATCCCTTGCTCCTCGCCCGGTCC
CTGGCAGAGCCTCTGCGGCCTGGGCCCGCCCTGCGCCGGCTGCCCTTGGCCGACGGCTGGCCCCGGTAGGAGATCACCCGGTGGCACCAG

>In-frame_FKBP8_ENST00000597960_chr19_18649026_-_MEF2B_ENST00000409447_chr19_19258641_-_1375nt
ATGGCATCGTGTGCTGAACCCTCTGAGCCCTCTGCCCCACTGCCCGCCGGGGTCCCACCGCTCGAGGACTTCGAGGTACTGGATGGGGTT
GAGGATGCAGAGGGTGAGGAGGAAGAGGAGGAGGAAGAGGAGGAAGAGGATGACCTGAGTGAGCTGCCACCGCTGGAGGACATGGGACAA
CCCCCGGCGGAGGAGGCTGAGCAGCCTGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCATGGAGCCCGAGCCCGCCCCAGCCCCGGCCCCA
GAAGAGTGGCTGGACATTCTGGGGAACGGGCTGTTGAGGAAGAAGACGCTGGTCCCAGGGCCGCCAGGTTCGAGCCGCCCGGTCAAGGGC
CAGGTGGTCACCGTACATCTGCAGACGTCGCTGGAGAATGGCACACGGGTGCAGGAGGAGCCGGAGCTGGTGTTCACTCTGGGTGACTGT
GACGTCATCCAGGCCCTGGATCTCAGTGTCCCACTCATGGACGTGGGGGAGACGGCCATGGTCACTGCTGACTCCAAGTACTGCTACGGC
CCCCAAGGCAGCAGGAGCCCATACATCCCCCCGCACGCGGCCCTGTGCCTGGAGGTGACCCTGAAGACGGCTGTGGACGGGCCTGACCTG
GAGATGCTCACGGGGCAGGAGCGCGTGGCCCTGGCCAACCGGAAGCGGGAGTGCGGCAACGCCCACTACCAGCGGGCGGACTTCGTCCTG
GCCGCCAACTCCTACGACCTCGCCATCAAGGCTATCACCTCCAGCGCCAAAGACGCTGAAGCGGAGGGGCATTGGCCTCGATGGGCCAGA
GCTGGAGCCGGATGAAGGGCCTGAGGAGCCAGGAGAGAAGTTTCGGAGGCTGGCAGGCGAAGGGGGTGATCCGGCCTTGCCCCGACCCCG
GCTGTATCCTGCAGCTCCTGCTATGCCCAGCCCAGATGTGGTATACGGGGCCTTACCGCCACCAGGCTGTGACCCCAGTGGGCTTGGGGA
AGCACTGCCCGCCCAGAGCCGCCCATCTCCCTTCCGACCAGCAGCCCCCAAAGCCGGGCCCCCAGAGAAGCCTCTACAGTGGCCTGCAGA
ACCCCTGCTCCACTGCAACTCCCGGACCCCCACTGGGGAGCTTCCCCTTCCTCCCCGGAGGCCCCCCAGTGGGGGCCGAAGCCTGGGCGA
GGAGGGTCCCCCAACCCGCGGCGCCTCCCCGCCGACCCCCCCAGTCAGCATCAAGTCTGAGCGCCTCTCTCCGGCCCCCGGGGGCCCCGG
CGACTTTCCTAAGACCTTCCCCTATCCCTTGCTCCTCGCCCGGTCCCTGGCAGAGCCTCTGCGGCCTGGGCCCGCCCTGCGCCGGCTGCC

>In-frame_FKBP8_ENST00000597960_chr19_18649026_-_MEF2B_ENST00000162023_chr19_19258641_-_1621nt
ATGGCATCGTGTGCTGAACCCTCTGAGCCCTCTGCCCCACTGCCCGCCGGGGTCCCACCGCTCGAGGACTTCGAGGTACTGGATGGGGTT
GAGGATGCAGAGGGTGAGGAGGAAGAGGAGGAGGAAGAGGAGGAAGAGGATGACCTGAGTGAGCTGCCACCGCTGGAGGACATGGGACAA
CCCCCGGCGGAGGAGGCTGAGCAGCCTGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCATGGAGCCCGAGCCCGCCCCAGCCCCGGCCCCA
GAAGAGTGGCTGGACATTCTGGGGAACGGGCTGTTGAGGAAGAAGACGCTGGTCCCAGGGCCGCCAGGTTCGAGCCGCCCGGTCAAGGGC
CAGGTGGTCACCGTACATCTGCAGACGTCGCTGGAGAATGGCACACGGGTGCAGGAGGAGCCGGAGCTGGTGTTCACTCTGGGTGACTGT
GACGTCATCCAGGCCCTGGATCTCAGTGTCCCACTCATGGACGTGGGGGAGACGGCCATGGTCACTGCTGACTCCAAGTACTGCTACGGC
CCCCAAGGCAGCAGGAGCCCATACATCCCCCCGCACGCGGCCCTGTGCCTGGAGGTGACCCTGAAGACGGCTGTGGACGGGCCTGACCTG
GAGATGCTCACGGGGCAGGAGCGCGTGGCCCTGGCCAACCGGAAGCGGGAGTGCGGCAACGCCCACTACCAGCGGGCGGACTTCGTCCTG
GCCGCCAACTCCTACGACCTCGCCATCAAGGCTATCACCTCCAGCGCCAAAGACGCTGAAGCGGAGGGGCATTGGCCTCGATGGGCCAGA
GCTGGAGCCGGATGAAGGGCCTGAGGAGCCAGGAGAGAAGTTTCGGAGGCTGGCAGGCGAAGGGGGTGATCCGGCCTTGCCCCGACCCCG
GCTGTATCCTGCAGCTCCTGCTATGCCCAGCCCAGATGTGGTATACGGGGCCTTACCGCCACCAGGCTGTGACCCCAGTGGGCTTGGGGA
AGCACTGCCCGCCCAGAGCCGCCCATCTCCCTTCCGACCAGCAGCCCCCAAAGCCGGGCCCCCAGGCCTGGTGCACCCTCTCTTCTCACC
AAGCCACCTCACCAGCAAGACACCACCCCCACTGTACCTGCCGACGGAAGGGCGGAGGTCAGACCTGCCTGGTGGCCTGGCTGGGCCCCG
AGGGGGACTAAACACCTCCAGAAGCCTCTACAGTGGCCTGCAGAACCCCTGCTCCACTGCAACTCCCGGACCCCCACTGGGGAGCTTCCC
CTTCCTCCCCGGAGGCCCCCCAGAATATGGCCTGGGAGACCCTCCACCGCCCCCTGGCTTGTTGCAGCCCCCCACCCTGGCCCCCTGGCA
GCCCTCGAGGGGTGATGGGCCCCCCGCCGTGTCCTCCCAGCCCAGTGGGGGCCGAAGCCTGGGCGAGGAGGGTCCCCCAACCCGCGGCGC
CTCCCCGCCGACCCCCCCAGTCAGCATCAAGTCTGAGCGCCTCTCTCCGGCCCCCGGGGGCCCCGGCGACTTTCCTAAGACCTTCCCCTA
TCCCTTGCTCCTCGCCCGGTCCCTGGCAGAGCCTCTGCGGCCTGGGCCCGCCCTGCGCCGGCTGCCCTTGGCCGACGGCTGGCCCCGGTA

>In-frame_FKBP8_ENST00000596558_chr19_18649026_-_MEF2B_ENST00000409224_chr19_19258641_-_1396nt
ATGGCATCGTGTGCTGAACCCTCTGAGCCCTCTGCCCCACTGCCCGCCGGGGTCCCACCGCTCGAGGACTTCGAGGTACTGGATGGGGTT
GAGGATGCAGAGGGTGAGGAGGAAGAGGAGGAGGAAGAGGAGGAAGAGGATGACCTGAGTGAGCTGCCACCGCTGGAGGACATGGGACAA
CCCCCGGCGGAGGAGGCTGAGCAGCCTGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCATGGAGCCCGAGCCCGCCCCAGCCCCGGCCCCA
GAAGAGTGGCTGGACATTCTGGGGAACGGGCTGTTGAGGAAGAAGACGCTGGTCCCAGGGCCGCCAGGTTCGAGCCGCCCGGTCAAGGGC
CAGGTGGTCACCGTACATCTGCAGACGTCGCTGGAGAATGGCACACGGGTGCAGGAGGAGCCGGAGCTGGTGTTCACTCTGGGTGACTGT
GACGTCATCCAGGCCCTGGATCTCAGTGTCCCACTCATGGACGTGGGGGAGACGGCCATGGTCACTGCTGACTCCAAGTACTGCTACGGC
CCCCAAGGCAGGAGCCCATACATCCCCCCGCACGCGGCCCTGTGCCTGGAGGTGACCCTGAAGACGGCTGTGGACGGGCCTGACCTGGAG
ATGCTCACGGGGCAGGAGCGCGTGGCCCTGGCCAACCGGAAGCGGGAGTGCGGCAACGCCCACTACCAGCGGGCGGACTTCGTCCTGGCC
GCCAACTCCTACGACCTCGCCATCAAGGCTATCACCTCCAGCGCCAAAGACGCTGAAGCGGAGGGGCATTGGCCTCGATGGGCCAGAGCT
GGAGCCGGATGAAGGGCCTGAGGAGCCAGGAGAGAAGTTTCGGAGGCTGGCAGGCGAAGGGGGTGATCCGGCCTTGCCCCGACCCCGGCT
GTATCCTGCAGCTCCTGCTATGCCCAGCCCAGATGTGGTATACGGGGCCTTACCGCCACCAGGCTGTGACCCCAGTGGGCTTGGGGAAGC
ACTGCCCGCCCAGAGCCGCCCATCTCCCTTCCGACCAGCAGCCCCCAAAGCCGGGCCCCCAGGCCTGGTGCACCCTCTCTTCTCACCAAG
CCACCTCACCAGCAAGACACCACCCCCACTGTACCTGCCGACGGAAGGGCGGAGGTCAGACCTGCCTGGTGGCCTGGCTGGGCCCCGAGG
GGGACTAAACACCTCCAGAAGCCTCTACAGTGGCCTGCAGAACCCCTGCTCCACTGCAACTCCCGGACCCCCACTGGGGAGCTTCCCCTT
CCTCCCCGGAGGCCCCCCAGAATATGGCCTGGGAGACCCTCCACCGCCCCCTGGCTTGTTGCAGCCCCCCACCCTGGCCCCCTGGCAGCC

>In-frame_FKBP8_ENST00000596558_chr19_18649026_-_MEF2B_ENST00000424583_chr19_19258641_-_1618nt
ATGGCATCGTGTGCTGAACCCTCTGAGCCCTCTGCCCCACTGCCCGCCGGGGTCCCACCGCTCGAGGACTTCGAGGTACTGGATGGGGTT
GAGGATGCAGAGGGTGAGGAGGAAGAGGAGGAGGAAGAGGAGGAAGAGGATGACCTGAGTGAGCTGCCACCGCTGGAGGACATGGGACAA
CCCCCGGCGGAGGAGGCTGAGCAGCCTGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCATGGAGCCCGAGCCCGCCCCAGCCCCGGCCCCA
GAAGAGTGGCTGGACATTCTGGGGAACGGGCTGTTGAGGAAGAAGACGCTGGTCCCAGGGCCGCCAGGTTCGAGCCGCCCGGTCAAGGGC
CAGGTGGTCACCGTACATCTGCAGACGTCGCTGGAGAATGGCACACGGGTGCAGGAGGAGCCGGAGCTGGTGTTCACTCTGGGTGACTGT
GACGTCATCCAGGCCCTGGATCTCAGTGTCCCACTCATGGACGTGGGGGAGACGGCCATGGTCACTGCTGACTCCAAGTACTGCTACGGC
CCCCAAGGCAGGAGCCCATACATCCCCCCGCACGCGGCCCTGTGCCTGGAGGTGACCCTGAAGACGGCTGTGGACGGGCCTGACCTGGAG
ATGCTCACGGGGCAGGAGCGCGTGGCCCTGGCCAACCGGAAGCGGGAGTGCGGCAACGCCCACTACCAGCGGGCGGACTTCGTCCTGGCC
GCCAACTCCTACGACCTCGCCATCAAGGCTATCACCTCCAGCGCCAAAGACGCTGAAGCGGAGGGGCATTGGCCTCGATGGGCCAGAGCT
GGAGCCGGATGAAGGGCCTGAGGAGCCAGGAGAGAAGTTTCGGAGGCTGGCAGGCGAAGGGGGTGATCCGGCCTTGCCCCGACCCCGGCT
GTATCCTGCAGCTCCTGCTATGCCCAGCCCAGATGTGGTATACGGGGCCTTACCGCCACCAGGCTGTGACCCCAGTGGGCTTGGGGAAGC
ACTGCCCGCCCAGAGCCGCCCATCTCCCTTCCGACCAGCAGCCCCCAAAGCCGGGCCCCCAGGCCTGGTGCACCCTCTCTTCTCACCAAG
CCACCTCACCAGCAAGACACCACCCCCACTGTACCTGCCGACGGAAGGGCGGAGGTCAGACCTGCCTGGTGGCCTGGCTGGGCCCCGAGG
GGGACTAAACACCTCCAGAAGCCTCTACAGTGGCCTGCAGAACCCCTGCTCCACTGCAACTCCCGGACCCCCACTGGGGAGCTTCCCCTT
CCTCCCCGGAGGCCCCCCAGAATATGGCCTGGGAGACCCTCCACCGCCCCCTGGCTTGTTGCAGCCCCCCACCCTGGCCCCCTGGCAGCC
CTCGAGGGGTGATGGGCCCCCCGCCGTGTCCTCCCAGCCCAGTGGGGGCCGAAGCCTGGGCGAGGAGGGTCCCCCAACCCGCGGCGCCTC
CCCGCCGACCCCCCCAGTCAGCATCAAGTCTGAGCGCCTCTCTCCGGCCCCCGGGGGCCCCGGCGACTTTCCTAAGACCTTCCCCTATCC

>In-frame_FKBP8_ENST00000596558_chr19_18649026_-_MEF2B_ENST00000410050_chr19_19258641_-_1639nt
ATGGCATCGTGTGCTGAACCCTCTGAGCCCTCTGCCCCACTGCCCGCCGGGGTCCCACCGCTCGAGGACTTCGAGGTACTGGATGGGGTT
GAGGATGCAGAGGGTGAGGAGGAAGAGGAGGAGGAAGAGGAGGAAGAGGATGACCTGAGTGAGCTGCCACCGCTGGAGGACATGGGACAA
CCCCCGGCGGAGGAGGCTGAGCAGCCTGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCATGGAGCCCGAGCCCGCCCCAGCCCCGGCCCCA
GAAGAGTGGCTGGACATTCTGGGGAACGGGCTGTTGAGGAAGAAGACGCTGGTCCCAGGGCCGCCAGGTTCGAGCCGCCCGGTCAAGGGC
CAGGTGGTCACCGTACATCTGCAGACGTCGCTGGAGAATGGCACACGGGTGCAGGAGGAGCCGGAGCTGGTGTTCACTCTGGGTGACTGT
GACGTCATCCAGGCCCTGGATCTCAGTGTCCCACTCATGGACGTGGGGGAGACGGCCATGGTCACTGCTGACTCCAAGTACTGCTACGGC
CCCCAAGGCAGGAGCCCATACATCCCCCCGCACGCGGCCCTGTGCCTGGAGGTGACCCTGAAGACGGCTGTGGACGGGCCTGACCTGGAG
ATGCTCACGGGGCAGGAGCGCGTGGCCCTGGCCAACCGGAAGCGGGAGTGCGGCAACGCCCACTACCAGCGGGCGGACTTCGTCCTGGCC
GCCAACTCCTACGACCTCGCCATCAAGGCTATCACCTCCAGCGCCAAAGACGCTGAAGCGGAGGGGCATTGGCCTCGATGGGCCAGAGCT
GGAGCCGGATGAAGGGCCTGAGGAGCCAGGAGAGAAGTTTCGGAGGCTGGCAGGCGAAGGGGGTGATCCGGCCTTGCCCCGACCCCGGCT
GTATCCTGCAGCTCCTGCTATGCCCAGCCCAGATGTGGTATACGGGGCCTTACCGCCACCAGGCTGTGACCCCAGTGGGCTTGGGGAAGC
ACTGCCCGCCCAGAGCCGCCCATCTCCCTTCCGACCAGCAGCCCCCAAAGCCGGGCCCCCAGGCCTGGTGCACCCTCTCTTCTCACCAAG
CCACCTCACCAGCAAGACACCACCCCCACTGTACCTGCCGACGGAAGGGCGGAGGTCAGACCTGCCTGGTGGCCTGGCTGGGCCCCGAGG
GGGACTAAACACCTCCAGAAGCCTCTACAGTGGCCTGCAGAACCCCTGCTCCACTGCAACTCCCGGACCCCCACTGGGGAGCTTCCCCTT
CCTCCCCGGAGGCCCCCCAGCCCCCAATTCCTGCCCACCAGAATATGGCCTGGGAGACCCTCCACCGCCCCCTGGCTTGTTGCAGCCCCC
CACCCTGGCCCCCTGGCAGCCCTCGAGGGGTGATGGGCCCCCCGCCGTGTCCTCCCAGCCCAGTGGGGGCCGAAGCCTGGGCGAGGAGGG
TCCCCCAACCCGCGGCGCCTCCCCGCCGACCCCCCCAGTCAGCATCAAGTCTGAGCGCCTCTCTCCGGCCCCCGGGGGCCCCGGCGACTT
TCCTAAGACCTTCCCCTATCCCTTGCTCCTCGCCCGGTCCCTGGCAGAGCCTCTGCGGCCTGGGCCCGCCCTGCGCCGGCTGCCCTTGGC

>In-frame_FKBP8_ENST00000596558_chr19_18649026_-_MEF2B_ENST00000602424_chr19_19258641_-_1609nt
ATGGCATCGTGTGCTGAACCCTCTGAGCCCTCTGCCCCACTGCCCGCCGGGGTCCCACCGCTCGAGGACTTCGAGGTACTGGATGGGGTT
GAGGATGCAGAGGGTGAGGAGGAAGAGGAGGAGGAAGAGGAGGAAGAGGATGACCTGAGTGAGCTGCCACCGCTGGAGGACATGGGACAA
CCCCCGGCGGAGGAGGCTGAGCAGCCTGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCATGGAGCCCGAGCCCGCCCCAGCCCCGGCCCCA
GAAGAGTGGCTGGACATTCTGGGGAACGGGCTGTTGAGGAAGAAGACGCTGGTCCCAGGGCCGCCAGGTTCGAGCCGCCCGGTCAAGGGC
CAGGTGGTCACCGTACATCTGCAGACGTCGCTGGAGAATGGCACACGGGTGCAGGAGGAGCCGGAGCTGGTGTTCACTCTGGGTGACTGT
GACGTCATCCAGGCCCTGGATCTCAGTGTCCCACTCATGGACGTGGGGGAGACGGCCATGGTCACTGCTGACTCCAAGTACTGCTACGGC
CCCCAAGGCAGGAGCCCATACATCCCCCCGCACGCGGCCCTGTGCCTGGAGGTGACCCTGAAGACGGCTGTGGACGGGCCTGACCTGGAG
ATGCTCACGGGGCAGGAGCGCGTGGCCCTGGCCAACCGGAAGCGGGAGTGCGGCAACGCCCACTACCAGCGGGCGGACTTCGTCCTGGCC
GCCAACTCCTACGACCTCGCCATCAAGGCTATCACCTCCAGCGCCAAAGACGCTGAAGCGGAGGGGCATTGGCCTCGATGGGCCAGAGCT
GGAGCCGGATGAAGGGCCTGAGGAGCCAGGAGAGAAGTTTCGGAGGCTGGCAGGCGAAGGGGGTGATCCGGCCTTGCCCCGACCCCGGCT
GTATCCTGCAGCTCCTGCTATGCCCAGCCCAGATGTGGTATACGGGGCCTTACCGCCACCAGGCTGTGACCCCAGTGGGCTTGGGGAAGC
ACTGCCCGCCCAGAGCCGCCCATCTCCCTTCCGACCAGCAGCCCCCAAAGCCGGGCCCCCAGGCCTGGTGCACCCTCTCTTCTCACCAAG
CCACCTCACCAGCAAGACACCACCCCCACTGTACCTGCCGACGGAAGGGCGGAGGTCAGACCTGCCTGGTGGCCTGGCTGGGCCCCGAGG
GGGACTAAACACCTCCAGAAGCCTCTACAGTGGCCTGCAGAACCCCTGCTCCACTGCAACTCCCGGACCCCCACTGGGGAGCTTCCCCTT
CCTCCCCGGAGGCCCCCCAGTGGGGGCCGAAGCCTGGGCGAGGAGGGTCCCCCAACCCGCGGCGCCTCCCCGCCGACCCCCCCAGTCAGC
ATCAAGTCTGAGCGCCTCTCTCCGGCCCCCGGGGGCCCCGGCGACTTTCCTAAGACCTTCCCCTATCCCTTGCTCCTCGCCCGGTCCCTG
GCAGAGCCTCTGCGGCCTGGGCCCGCCCTGCGCCGGCTGCCCTTGGCCGACGGCTGGCCCCGGTAGGAGATCACCCGGTGGCACCAGCCC

>In-frame_FKBP8_ENST00000596558_chr19_18649026_-_MEF2B_ENST00000409447_chr19_19258641_-_1372nt
ATGGCATCGTGTGCTGAACCCTCTGAGCCCTCTGCCCCACTGCCCGCCGGGGTCCCACCGCTCGAGGACTTCGAGGTACTGGATGGGGTT
GAGGATGCAGAGGGTGAGGAGGAAGAGGAGGAGGAAGAGGAGGAAGAGGATGACCTGAGTGAGCTGCCACCGCTGGAGGACATGGGACAA
CCCCCGGCGGAGGAGGCTGAGCAGCCTGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCATGGAGCCCGAGCCCGCCCCAGCCCCGGCCCCA
GAAGAGTGGCTGGACATTCTGGGGAACGGGCTGTTGAGGAAGAAGACGCTGGTCCCAGGGCCGCCAGGTTCGAGCCGCCCGGTCAAGGGC
CAGGTGGTCACCGTACATCTGCAGACGTCGCTGGAGAATGGCACACGGGTGCAGGAGGAGCCGGAGCTGGTGTTCACTCTGGGTGACTGT
GACGTCATCCAGGCCCTGGATCTCAGTGTCCCACTCATGGACGTGGGGGAGACGGCCATGGTCACTGCTGACTCCAAGTACTGCTACGGC
CCCCAAGGCAGGAGCCCATACATCCCCCCGCACGCGGCCCTGTGCCTGGAGGTGACCCTGAAGACGGCTGTGGACGGGCCTGACCTGGAG
ATGCTCACGGGGCAGGAGCGCGTGGCCCTGGCCAACCGGAAGCGGGAGTGCGGCAACGCCCACTACCAGCGGGCGGACTTCGTCCTGGCC
GCCAACTCCTACGACCTCGCCATCAAGGCTATCACCTCCAGCGCCAAAGACGCTGAAGCGGAGGGGCATTGGCCTCGATGGGCCAGAGCT
GGAGCCGGATGAAGGGCCTGAGGAGCCAGGAGAGAAGTTTCGGAGGCTGGCAGGCGAAGGGGGTGATCCGGCCTTGCCCCGACCCCGGCT
GTATCCTGCAGCTCCTGCTATGCCCAGCCCAGATGTGGTATACGGGGCCTTACCGCCACCAGGCTGTGACCCCAGTGGGCTTGGGGAAGC
ACTGCCCGCCCAGAGCCGCCCATCTCCCTTCCGACCAGCAGCCCCCAAAGCCGGGCCCCCAGAGAAGCCTCTACAGTGGCCTGCAGAACC
CCTGCTCCACTGCAACTCCCGGACCCCCACTGGGGAGCTTCCCCTTCCTCCCCGGAGGCCCCCCAGTGGGGGCCGAAGCCTGGGCGAGGA
GGGTCCCCCAACCCGCGGCGCCTCCCCGCCGACCCCCCCAGTCAGCATCAAGTCTGAGCGCCTCTCTCCGGCCCCCGGGGGCCCCGGCGA
CTTTCCTAAGACCTTCCCCTATCCCTTGCTCCTCGCCCGGTCCCTGGCAGAGCCTCTGCGGCCTGGGCCCGCCCTGCGCCGGCTGCCCTT

>In-frame_FKBP8_ENST00000596558_chr19_18649026_-_MEF2B_ENST00000162023_chr19_19258641_-_1618nt
ATGGCATCGTGTGCTGAACCCTCTGAGCCCTCTGCCCCACTGCCCGCCGGGGTCCCACCGCTCGAGGACTTCGAGGTACTGGATGGGGTT
GAGGATGCAGAGGGTGAGGAGGAAGAGGAGGAGGAAGAGGAGGAAGAGGATGACCTGAGTGAGCTGCCACCGCTGGAGGACATGGGACAA
CCCCCGGCGGAGGAGGCTGAGCAGCCTGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCATGGAGCCCGAGCCCGCCCCAGCCCCGGCCCCA
GAAGAGTGGCTGGACATTCTGGGGAACGGGCTGTTGAGGAAGAAGACGCTGGTCCCAGGGCCGCCAGGTTCGAGCCGCCCGGTCAAGGGC
CAGGTGGTCACCGTACATCTGCAGACGTCGCTGGAGAATGGCACACGGGTGCAGGAGGAGCCGGAGCTGGTGTTCACTCTGGGTGACTGT
GACGTCATCCAGGCCCTGGATCTCAGTGTCCCACTCATGGACGTGGGGGAGACGGCCATGGTCACTGCTGACTCCAAGTACTGCTACGGC
CCCCAAGGCAGGAGCCCATACATCCCCCCGCACGCGGCCCTGTGCCTGGAGGTGACCCTGAAGACGGCTGTGGACGGGCCTGACCTGGAG
ATGCTCACGGGGCAGGAGCGCGTGGCCCTGGCCAACCGGAAGCGGGAGTGCGGCAACGCCCACTACCAGCGGGCGGACTTCGTCCTGGCC
GCCAACTCCTACGACCTCGCCATCAAGGCTATCACCTCCAGCGCCAAAGACGCTGAAGCGGAGGGGCATTGGCCTCGATGGGCCAGAGCT
GGAGCCGGATGAAGGGCCTGAGGAGCCAGGAGAGAAGTTTCGGAGGCTGGCAGGCGAAGGGGGTGATCCGGCCTTGCCCCGACCCCGGCT
GTATCCTGCAGCTCCTGCTATGCCCAGCCCAGATGTGGTATACGGGGCCTTACCGCCACCAGGCTGTGACCCCAGTGGGCTTGGGGAAGC
ACTGCCCGCCCAGAGCCGCCCATCTCCCTTCCGACCAGCAGCCCCCAAAGCCGGGCCCCCAGGCCTGGTGCACCCTCTCTTCTCACCAAG
CCACCTCACCAGCAAGACACCACCCCCACTGTACCTGCCGACGGAAGGGCGGAGGTCAGACCTGCCTGGTGGCCTGGCTGGGCCCCGAGG
GGGACTAAACACCTCCAGAAGCCTCTACAGTGGCCTGCAGAACCCCTGCTCCACTGCAACTCCCGGACCCCCACTGGGGAGCTTCCCCTT
CCTCCCCGGAGGCCCCCCAGAATATGGCCTGGGAGACCCTCCACCGCCCCCTGGCTTGTTGCAGCCCCCCACCCTGGCCCCCTGGCAGCC
CTCGAGGGGTGATGGGCCCCCCGCCGTGTCCTCCCAGCCCAGTGGGGGCCGAAGCCTGGGCGAGGAGGGTCCCCCAACCCGCGGCGCCTC
CCCGCCGACCCCCCCAGTCAGCATCAAGTCTGAGCGCCTCTCTCCGGCCCCCGGGGGCCCCGGCGACTTTCCTAAGACCTTCCCCTATCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_FKBP8_ENST00000597960_chr19_18649026_-_MEF2B_ENST00000409224_chr19_19258641_-_2221nt
AAGCGGCCGAACCTGGTTCCCGAGGCGCGGCGGCCGCGGCTGGGGGCGGGGAGGGGGGCGCAGGACCCCAAGTGGGGGTCCCGGAGCCAG
AGGCAAGGCCAATTCCTGTCCCCCCAGCAGCATGGCATCGTGTGCTGAACCCTCTGAGCCCTCTGCCCCACTGCCCGCCGGGGTCCCACC
GCTCGAGGACTTCGAGGTACTGGATGGGGTTGAGGATGCAGAGGGTGAGGAGGAAGAGGAGGAGGAAGAGGAGGAAGAGGATGACCTGAG
TGAGCTGCCACCGCTGGAGGACATGGGACAACCCCCGGCGGAGGAGGCTGAGCAGCCTGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCAT
GGAGCCCGAGCCCGCCCCAGCCCCGGCCCCAGAAGAGTGGCTGGACATTCTGGGGAACGGGCTGTTGAGGAAGAAGACGCTGGTCCCAGG
GCCGCCAGGTTCGAGCCGCCCGGTCAAGGGCCAGGTGGTCACCGTACATCTGCAGACGTCGCTGGAGAATGGCACACGGGTGCAGGAGGA
GCCGGAGCTGGTGTTCACTCTGGGTGACTGTGACGTCATCCAGGCCCTGGATCTCAGTGTCCCACTCATGGACGTGGGGGAGACGGCCAT
GGTCACTGCTGACTCCAAGTACTGCTACGGCCCCCAAGGCAGCAGGAGCCCATACATCCCCCCGCACGCGGCCCTGTGCCTGGAGGTGAC
CCTGAAGACGGCTGTGGACGGGCCTGACCTGGAGATGCTCACGGGGCAGGAGCGCGTGGCCCTGGCCAACCGGAAGCGGGAGTGCGGCAA
CGCCCACTACCAGCGGGCGGACTTCGTCCTGGCCGCCAACTCCTACGACCTCGCCATCAAGGCTATCACCTCCAGCGCCAAAGACGCTGA
AGCGGAGGGGCATTGGCCTCGATGGGCCAGAGCTGGAGCCGGATGAAGGGCCTGAGGAGCCAGGAGAGAAGTTTCGGAGGCTGGCAGGCG
AAGGGGGTGATCCGGCCTTGCCCCGACCCCGGCTGTATCCTGCAGCTCCTGCTATGCCCAGCCCAGATGTGGTATACGGGGCCTTACCGC
CACCAGGCTGTGACCCCAGTGGGCTTGGGGAAGCACTGCCCGCCCAGAGCCGCCCATCTCCCTTCCGACCAGCAGCCCCCAAAGCCGGGC
CCCCAGGCCTGGTGCACCCTCTCTTCTCACCAAGCCACCTCACCAGCAAGACACCACCCCCACTGTACCTGCCGACGGAAGGGCGGAGGT
CAGACCTGCCTGGTGGCCTGGCTGGGCCCCGAGGGGGACTAAACACCTCCAGAAGCCTCTACAGTGGCCTGCAGAACCCCTGCTCCACTG
CAACTCCCGGACCCCCACTGGGGAGCTTCCCCTTCCTCCCCGGAGGCCCCCCAGAATATGGCCTGGGAGACCCTCCACCGCCCCCTGGCT
TGTTGCAGCCCCCCACCCTGGCCCCCTGGCAGCCCTCGAGGGGTGATGGGCCCCCCGCCGTGTCCTCCCAGCCCAGGTAAGTGCCCTGAG
ACGACGGCAAGTCCCAGTCCTCCAAAGCCCCGGCCGCTGCTGACCCCTGGTGGCCATCCCTGGTACTGCGCACACTTCCGGTACGGATGG
GCAGCTATTTTGAGGCCCCAAGAGGGACCGCCACCCCCTCCTTTCCCAGGGTCCTCCTGCCAAGCCTTTGCCCACGCTGTGCCATCCCCT
GGCTTCCTTCCCTTCCTCGCTGAGCTCACGGCCTCCCTCTCTCTTTCCCCCTGCAGTGGGGGCCGAAGCCTGGGCGAGGAGGGTCCCCCA
ACCCGCGGCGCCTCCCCGCCGACCCCCCCAGTCAGCATCAAGTCTGAGCGCCTCTCTCCGGCCCCCGGGGGCCCCGGCGACTTTCCTAAG
ACCTTCCCCTATCCCTTGCTCCTCGCCCGGTCCCTGGCAGAGCCTCTGCGGCCTGGGCCCGCCCTGCGCCGGCTGCCCTTGGCCGACGGC
TGGCCCCGGTAGGAGATCACCCGGTGGCACCAGCCCAGAGCGCTCGCCAGGTACGGCGAGGGCACGTGGGGACCCCACCTCCCTCCAGGC
CTCTTCAGAGAAGACCCAACAGTGACGCCCCCCTCCGCGGTGGGGGCTTGGAGGTGGGCGGCTGGACTCAATCCACCCTGGGGGGCTCCT

>In-frame_FKBP8_ENST00000597960_chr19_18649026_-_MEF2B_ENST00000424583_chr19_19258641_-_1970nt
AAGCGGCCGAACCTGGTTCCCGAGGCGCGGCGGCCGCGGCTGGGGGCGGGGAGGGGGGCGCAGGACCCCAAGTGGGGGTCCCGGAGCCAG
AGGCAAGGCCAATTCCTGTCCCCCCAGCAGCATGGCATCGTGTGCTGAACCCTCTGAGCCCTCTGCCCCACTGCCCGCCGGGGTCCCACC
GCTCGAGGACTTCGAGGTACTGGATGGGGTTGAGGATGCAGAGGGTGAGGAGGAAGAGGAGGAGGAAGAGGAGGAAGAGGATGACCTGAG
TGAGCTGCCACCGCTGGAGGACATGGGACAACCCCCGGCGGAGGAGGCTGAGCAGCCTGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCAT
GGAGCCCGAGCCCGCCCCAGCCCCGGCCCCAGAAGAGTGGCTGGACATTCTGGGGAACGGGCTGTTGAGGAAGAAGACGCTGGTCCCAGG
GCCGCCAGGTTCGAGCCGCCCGGTCAAGGGCCAGGTGGTCACCGTACATCTGCAGACGTCGCTGGAGAATGGCACACGGGTGCAGGAGGA
GCCGGAGCTGGTGTTCACTCTGGGTGACTGTGACGTCATCCAGGCCCTGGATCTCAGTGTCCCACTCATGGACGTGGGGGAGACGGCCAT
GGTCACTGCTGACTCCAAGTACTGCTACGGCCCCCAAGGCAGCAGGAGCCCATACATCCCCCCGCACGCGGCCCTGTGCCTGGAGGTGAC
CCTGAAGACGGCTGTGGACGGGCCTGACCTGGAGATGCTCACGGGGCAGGAGCGCGTGGCCCTGGCCAACCGGAAGCGGGAGTGCGGCAA
CGCCCACTACCAGCGGGCGGACTTCGTCCTGGCCGCCAACTCCTACGACCTCGCCATCAAGGCTATCACCTCCAGCGCCAAAGACGCTGA
AGCGGAGGGGCATTGGCCTCGATGGGCCAGAGCTGGAGCCGGATGAAGGGCCTGAGGAGCCAGGAGAGAAGTTTCGGAGGCTGGCAGGCG
AAGGGGGTGATCCGGCCTTGCCCCGACCCCGGCTGTATCCTGCAGCTCCTGCTATGCCCAGCCCAGATGTGGTATACGGGGCCTTACCGC
CACCAGGCTGTGACCCCAGTGGGCTTGGGGAAGCACTGCCCGCCCAGAGCCGCCCATCTCCCTTCCGACCAGCAGCCCCCAAAGCCGGGC
CCCCAGGCCTGGTGCACCCTCTCTTCTCACCAAGCCACCTCACCAGCAAGACACCACCCCCACTGTACCTGCCGACGGAAGGGCGGAGGT
CAGACCTGCCTGGTGGCCTGGCTGGGCCCCGAGGGGGACTAAACACCTCCAGAAGCCTCTACAGTGGCCTGCAGAACCCCTGCTCCACTG
CAACTCCCGGACCCCCACTGGGGAGCTTCCCCTTCCTCCCCGGAGGCCCCCCAGAATATGGCCTGGGAGACCCTCCACCGCCCCCTGGCT
TGTTGCAGCCCCCCACCCTGGCCCCCTGGCAGCCCTCGAGGGGTGATGGGCCCCCCGCCGTGTCCTCCCAGCCCAGTGGGGGCCGAAGCC
TGGGCGAGGAGGGTCCCCCAACCCGCGGCGCCTCCCCGCCGACCCCCCCAGTCAGCATCAAGTCTGAGCGCCTCTCTCCGGCCCCCGGGG
GCCCCGGCGACTTTCCTAAGACCTTCCCCTATCCCTTGCTCCTCGCCCGGTCCCTGGCAGAGCCTCTGCGGCCTGGGCCCGCCCTGCGCC
GGCTGCCCTTGGCCGACGGCTGGCCCCGGTAGGAGATCACCCGGTGGCACCAGCCCAGAGCGCTCGCCAGGTACGGCGAGGGCACGTGGG
GACCCCACCTCCCTCCAGGCCTCTTCAGAGAAGACCCAACAGTGACGCCCCCCTCCGCGGTGGGGGCTTGGAGGTGGGCGGCTGGACTCA

>In-frame_FKBP8_ENST00000597960_chr19_18649026_-_MEF2B_ENST00000410050_chr19_19258641_-_1991nt
AAGCGGCCGAACCTGGTTCCCGAGGCGCGGCGGCCGCGGCTGGGGGCGGGGAGGGGGGCGCAGGACCCCAAGTGGGGGTCCCGGAGCCAG
AGGCAAGGCCAATTCCTGTCCCCCCAGCAGCATGGCATCGTGTGCTGAACCCTCTGAGCCCTCTGCCCCACTGCCCGCCGGGGTCCCACC
GCTCGAGGACTTCGAGGTACTGGATGGGGTTGAGGATGCAGAGGGTGAGGAGGAAGAGGAGGAGGAAGAGGAGGAAGAGGATGACCTGAG
TGAGCTGCCACCGCTGGAGGACATGGGACAACCCCCGGCGGAGGAGGCTGAGCAGCCTGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCAT
GGAGCCCGAGCCCGCCCCAGCCCCGGCCCCAGAAGAGTGGCTGGACATTCTGGGGAACGGGCTGTTGAGGAAGAAGACGCTGGTCCCAGG
GCCGCCAGGTTCGAGCCGCCCGGTCAAGGGCCAGGTGGTCACCGTACATCTGCAGACGTCGCTGGAGAATGGCACACGGGTGCAGGAGGA
GCCGGAGCTGGTGTTCACTCTGGGTGACTGTGACGTCATCCAGGCCCTGGATCTCAGTGTCCCACTCATGGACGTGGGGGAGACGGCCAT
GGTCACTGCTGACTCCAAGTACTGCTACGGCCCCCAAGGCAGCAGGAGCCCATACATCCCCCCGCACGCGGCCCTGTGCCTGGAGGTGAC
CCTGAAGACGGCTGTGGACGGGCCTGACCTGGAGATGCTCACGGGGCAGGAGCGCGTGGCCCTGGCCAACCGGAAGCGGGAGTGCGGCAA
CGCCCACTACCAGCGGGCGGACTTCGTCCTGGCCGCCAACTCCTACGACCTCGCCATCAAGGCTATCACCTCCAGCGCCAAAGACGCTGA
AGCGGAGGGGCATTGGCCTCGATGGGCCAGAGCTGGAGCCGGATGAAGGGCCTGAGGAGCCAGGAGAGAAGTTTCGGAGGCTGGCAGGCG
AAGGGGGTGATCCGGCCTTGCCCCGACCCCGGCTGTATCCTGCAGCTCCTGCTATGCCCAGCCCAGATGTGGTATACGGGGCCTTACCGC
CACCAGGCTGTGACCCCAGTGGGCTTGGGGAAGCACTGCCCGCCCAGAGCCGCCCATCTCCCTTCCGACCAGCAGCCCCCAAAGCCGGGC
CCCCAGGCCTGGTGCACCCTCTCTTCTCACCAAGCCACCTCACCAGCAAGACACCACCCCCACTGTACCTGCCGACGGAAGGGCGGAGGT
CAGACCTGCCTGGTGGCCTGGCTGGGCCCCGAGGGGGACTAAACACCTCCAGAAGCCTCTACAGTGGCCTGCAGAACCCCTGCTCCACTG
CAACTCCCGGACCCCCACTGGGGAGCTTCCCCTTCCTCCCCGGAGGCCCCCCAGCCCCCAATTCCTGCCCACCAGAATATGGCCTGGGAG
ACCCTCCACCGCCCCCTGGCTTGTTGCAGCCCCCCACCCTGGCCCCCTGGCAGCCCTCGAGGGGTGATGGGCCCCCCGCCGTGTCCTCCC
AGCCCAGTGGGGGCCGAAGCCTGGGCGAGGAGGGTCCCCCAACCCGCGGCGCCTCCCCGCCGACCCCCCCAGTCAGCATCAAGTCTGAGC
GCCTCTCTCCGGCCCCCGGGGGCCCCGGCGACTTTCCTAAGACCTTCCCCTATCCCTTGCTCCTCGCCCGGTCCCTGGCAGAGCCTCTGC
GGCCTGGGCCCGCCCTGCGCCGGCTGCCCTTGGCCGACGGCTGGCCCCGGTAGGAGATCACCCGGTGGCACCAGCCCAGAGCGCTCGCCA
GGTACGGCGAGGGCACGTGGGGACCCCACCTCCCTCCAGGCCTCTTCAGAGAAGACCCAACAGTGACGCCCCCCTCCGCGGTGGGGGCTT
GGAGGTGGGCGGCTGGACTCAATCCACCCTGGGGGGCTCCTTTCCTTCTTCCTATTTGTGTGTATATCCACAAATAAAACGCGCGTGGCG

>In-frame_FKBP8_ENST00000597960_chr19_18649026_-_MEF2B_ENST00000602424_chr19_19258641_-_1857nt
AAGCGGCCGAACCTGGTTCCCGAGGCGCGGCGGCCGCGGCTGGGGGCGGGGAGGGGGGCGCAGGACCCCAAGTGGGGGTCCCGGAGCCAG
AGGCAAGGCCAATTCCTGTCCCCCCAGCAGCATGGCATCGTGTGCTGAACCCTCTGAGCCCTCTGCCCCACTGCCCGCCGGGGTCCCACC
GCTCGAGGACTTCGAGGTACTGGATGGGGTTGAGGATGCAGAGGGTGAGGAGGAAGAGGAGGAGGAAGAGGAGGAAGAGGATGACCTGAG
TGAGCTGCCACCGCTGGAGGACATGGGACAACCCCCGGCGGAGGAGGCTGAGCAGCCTGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCAT
GGAGCCCGAGCCCGCCCCAGCCCCGGCCCCAGAAGAGTGGCTGGACATTCTGGGGAACGGGCTGTTGAGGAAGAAGACGCTGGTCCCAGG
GCCGCCAGGTTCGAGCCGCCCGGTCAAGGGCCAGGTGGTCACCGTACATCTGCAGACGTCGCTGGAGAATGGCACACGGGTGCAGGAGGA
GCCGGAGCTGGTGTTCACTCTGGGTGACTGTGACGTCATCCAGGCCCTGGATCTCAGTGTCCCACTCATGGACGTGGGGGAGACGGCCAT
GGTCACTGCTGACTCCAAGTACTGCTACGGCCCCCAAGGCAGCAGGAGCCCATACATCCCCCCGCACGCGGCCCTGTGCCTGGAGGTGAC
CCTGAAGACGGCTGTGGACGGGCCTGACCTGGAGATGCTCACGGGGCAGGAGCGCGTGGCCCTGGCCAACCGGAAGCGGGAGTGCGGCAA
CGCCCACTACCAGCGGGCGGACTTCGTCCTGGCCGCCAACTCCTACGACCTCGCCATCAAGGCTATCACCTCCAGCGCCAAAGACGCTGA
AGCGGAGGGGCATTGGCCTCGATGGGCCAGAGCTGGAGCCGGATGAAGGGCCTGAGGAGCCAGGAGAGAAGTTTCGGAGGCTGGCAGGCG
AAGGGGGTGATCCGGCCTTGCCCCGACCCCGGCTGTATCCTGCAGCTCCTGCTATGCCCAGCCCAGATGTGGTATACGGGGCCTTACCGC
CACCAGGCTGTGACCCCAGTGGGCTTGGGGAAGCACTGCCCGCCCAGAGCCGCCCATCTCCCTTCCGACCAGCAGCCCCCAAAGCCGGGC
CCCCAGGCCTGGTGCACCCTCTCTTCTCACCAAGCCACCTCACCAGCAAGACACCACCCCCACTGTACCTGCCGACGGAAGGGCGGAGGT
CAGACCTGCCTGGTGGCCTGGCTGGGCCCCGAGGGGGACTAAACACCTCCAGAAGCCTCTACAGTGGCCTGCAGAACCCCTGCTCCACTG
CAACTCCCGGACCCCCACTGGGGAGCTTCCCCTTCCTCCCCGGAGGCCCCCCAGTGGGGGCCGAAGCCTGGGCGAGGAGGGTCCCCCAAC
CCGCGGCGCCTCCCCGCCGACCCCCCCAGTCAGCATCAAGTCTGAGCGCCTCTCTCCGGCCCCCGGGGGCCCCGGCGACTTTCCTAAGAC
CTTCCCCTATCCCTTGCTCCTCGCCCGGTCCCTGGCAGAGCCTCTGCGGCCTGGGCCCGCCCTGCGCCGGCTGCCCTTGGCCGACGGCTG
GCCCCGGTAGGAGATCACCCGGTGGCACCAGCCCAGAGCGCTCGCCAGGTACGGCGAGGGCACGTGGGGACCCCACCTCCCTCCAGGCCT
CTTCAGAGAAGACCCAACAGTGACGCCCCCCTCCGCGGTGGGGGCTTGGAGGTGGGCGGCTGGACTCAATCCACCCTGGGGGGCTCCTTT

>In-frame_FKBP8_ENST00000597960_chr19_18649026_-_MEF2B_ENST00000409447_chr19_19258641_-_1700nt
AAGCGGCCGAACCTGGTTCCCGAGGCGCGGCGGCCGCGGCTGGGGGCGGGGAGGGGGGCGCAGGACCCCAAGTGGGGGTCCCGGAGCCAG
AGGCAAGGCCAATTCCTGTCCCCCCAGCAGCATGGCATCGTGTGCTGAACCCTCTGAGCCCTCTGCCCCACTGCCCGCCGGGGTCCCACC
GCTCGAGGACTTCGAGGTACTGGATGGGGTTGAGGATGCAGAGGGTGAGGAGGAAGAGGAGGAGGAAGAGGAGGAAGAGGATGACCTGAG
TGAGCTGCCACCGCTGGAGGACATGGGACAACCCCCGGCGGAGGAGGCTGAGCAGCCTGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCAT
GGAGCCCGAGCCCGCCCCAGCCCCGGCCCCAGAAGAGTGGCTGGACATTCTGGGGAACGGGCTGTTGAGGAAGAAGACGCTGGTCCCAGG
GCCGCCAGGTTCGAGCCGCCCGGTCAAGGGCCAGGTGGTCACCGTACATCTGCAGACGTCGCTGGAGAATGGCACACGGGTGCAGGAGGA
GCCGGAGCTGGTGTTCACTCTGGGTGACTGTGACGTCATCCAGGCCCTGGATCTCAGTGTCCCACTCATGGACGTGGGGGAGACGGCCAT
GGTCACTGCTGACTCCAAGTACTGCTACGGCCCCCAAGGCAGCAGGAGCCCATACATCCCCCCGCACGCGGCCCTGTGCCTGGAGGTGAC
CCTGAAGACGGCTGTGGACGGGCCTGACCTGGAGATGCTCACGGGGCAGGAGCGCGTGGCCCTGGCCAACCGGAAGCGGGAGTGCGGCAA
CGCCCACTACCAGCGGGCGGACTTCGTCCTGGCCGCCAACTCCTACGACCTCGCCATCAAGGCTATCACCTCCAGCGCCAAAGACGCTGA
AGCGGAGGGGCATTGGCCTCGATGGGCCAGAGCTGGAGCCGGATGAAGGGCCTGAGGAGCCAGGAGAGAAGTTTCGGAGGCTGGCAGGCG
AAGGGGGTGATCCGGCCTTGCCCCGACCCCGGCTGTATCCTGCAGCTCCTGCTATGCCCAGCCCAGATGTGGTATACGGGGCCTTACCGC
CACCAGGCTGTGACCCCAGTGGGCTTGGGGAAGCACTGCCCGCCCAGAGCCGCCCATCTCCCTTCCGACCAGCAGCCCCCAAAGCCGGGC
CCCCAGAGAAGCCTCTACAGTGGCCTGCAGAACCCCTGCTCCACTGCAACTCCCGGACCCCCACTGGGGAGCTTCCCCTTCCTCCCCGGA
GGCCCCCCAGTGGGGGCCGAAGCCTGGGCGAGGAGGGTCCCCCAACCCGCGGCGCCTCCCCGCCGACCCCCCCAGTCAGCATCAAGTCTG
AGCGCCTCTCTCCGGCCCCCGGGGGCCCCGGCGACTTTCCTAAGACCTTCCCCTATCCCTTGCTCCTCGCCCGGTCCCTGGCAGAGCCTC
TGCGGCCTGGGCCCGCCCTGCGCCGGCTGCCCTTGGCCGACGGCTGGCCCCGGTAGGAGATCACCCGGTGGCACCAGCCCAGAGCGCTCG
CCAGGTACGGCGAGGGCACGTGGGGACCCCACCTCCCTCCAGGCCTCTTCAGAGAAGACCCAACAGTGACGCCCCCCTCCGCGGTGGGGG

>In-frame_FKBP8_ENST00000597960_chr19_18649026_-_MEF2B_ENST00000162023_chr19_19258641_-_1786nt
AAGCGGCCGAACCTGGTTCCCGAGGCGCGGCGGCCGCGGCTGGGGGCGGGGAGGGGGGCGCAGGACCCCAAGTGGGGGTCCCGGAGCCAG
AGGCAAGGCCAATTCCTGTCCCCCCAGCAGCATGGCATCGTGTGCTGAACCCTCTGAGCCCTCTGCCCCACTGCCCGCCGGGGTCCCACC
GCTCGAGGACTTCGAGGTACTGGATGGGGTTGAGGATGCAGAGGGTGAGGAGGAAGAGGAGGAGGAAGAGGAGGAAGAGGATGACCTGAG
TGAGCTGCCACCGCTGGAGGACATGGGACAACCCCCGGCGGAGGAGGCTGAGCAGCCTGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCAT
GGAGCCCGAGCCCGCCCCAGCCCCGGCCCCAGAAGAGTGGCTGGACATTCTGGGGAACGGGCTGTTGAGGAAGAAGACGCTGGTCCCAGG
GCCGCCAGGTTCGAGCCGCCCGGTCAAGGGCCAGGTGGTCACCGTACATCTGCAGACGTCGCTGGAGAATGGCACACGGGTGCAGGAGGA
GCCGGAGCTGGTGTTCACTCTGGGTGACTGTGACGTCATCCAGGCCCTGGATCTCAGTGTCCCACTCATGGACGTGGGGGAGACGGCCAT
GGTCACTGCTGACTCCAAGTACTGCTACGGCCCCCAAGGCAGCAGGAGCCCATACATCCCCCCGCACGCGGCCCTGTGCCTGGAGGTGAC
CCTGAAGACGGCTGTGGACGGGCCTGACCTGGAGATGCTCACGGGGCAGGAGCGCGTGGCCCTGGCCAACCGGAAGCGGGAGTGCGGCAA
CGCCCACTACCAGCGGGCGGACTTCGTCCTGGCCGCCAACTCCTACGACCTCGCCATCAAGGCTATCACCTCCAGCGCCAAAGACGCTGA
AGCGGAGGGGCATTGGCCTCGATGGGCCAGAGCTGGAGCCGGATGAAGGGCCTGAGGAGCCAGGAGAGAAGTTTCGGAGGCTGGCAGGCG
AAGGGGGTGATCCGGCCTTGCCCCGACCCCGGCTGTATCCTGCAGCTCCTGCTATGCCCAGCCCAGATGTGGTATACGGGGCCTTACCGC
CACCAGGCTGTGACCCCAGTGGGCTTGGGGAAGCACTGCCCGCCCAGAGCCGCCCATCTCCCTTCCGACCAGCAGCCCCCAAAGCCGGGC
CCCCAGGCCTGGTGCACCCTCTCTTCTCACCAAGCCACCTCACCAGCAAGACACCACCCCCACTGTACCTGCCGACGGAAGGGCGGAGGT
CAGACCTGCCTGGTGGCCTGGCTGGGCCCCGAGGGGGACTAAACACCTCCAGAAGCCTCTACAGTGGCCTGCAGAACCCCTGCTCCACTG
CAACTCCCGGACCCCCACTGGGGAGCTTCCCCTTCCTCCCCGGAGGCCCCCCAGAATATGGCCTGGGAGACCCTCCACCGCCCCCTGGCT
TGTTGCAGCCCCCCACCCTGGCCCCCTGGCAGCCCTCGAGGGGTGATGGGCCCCCCGCCGTGTCCTCCCAGCCCAGTGGGGGCCGAAGCC
TGGGCGAGGAGGGTCCCCCAACCCGCGGCGCCTCCCCGCCGACCCCCCCAGTCAGCATCAAGTCTGAGCGCCTCTCTCCGGCCCCCGGGG
GCCCCGGCGACTTTCCTAAGACCTTCCCCTATCCCTTGCTCCTCGCCCGGTCCCTGGCAGAGCCTCTGCGGCCTGGGCCCGCCCTGCGCC

>In-frame_FKBP8_ENST00000596558_chr19_18649026_-_MEF2B_ENST00000409224_chr19_19258641_-_2207nt
GAATTGTGCGGGCGCGGGGAATTATGGGGGTGGGGGCTGGGAGGGTCTCTCAAAGTGGGGCTCCGAGCCCGGGAGGAGCAGGCAGGGCCA
ATTCCTGTCCCCCCAGCAGCATGGCATCGTGTGCTGAACCCTCTGAGCCCTCTGCCCCACTGCCCGCCGGGGTCCCACCGCTCGAGGACT
TCGAGGTACTGGATGGGGTTGAGGATGCAGAGGGTGAGGAGGAAGAGGAGGAGGAAGAGGAGGAAGAGGATGACCTGAGTGAGCTGCCAC
CGCTGGAGGACATGGGACAACCCCCGGCGGAGGAGGCTGAGCAGCCTGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCATGGAGCCCGAGC
CCGCCCCAGCCCCGGCCCCAGAAGAGTGGCTGGACATTCTGGGGAACGGGCTGTTGAGGAAGAAGACGCTGGTCCCAGGGCCGCCAGGTT
CGAGCCGCCCGGTCAAGGGCCAGGTGGTCACCGTACATCTGCAGACGTCGCTGGAGAATGGCACACGGGTGCAGGAGGAGCCGGAGCTGG
TGTTCACTCTGGGTGACTGTGACGTCATCCAGGCCCTGGATCTCAGTGTCCCACTCATGGACGTGGGGGAGACGGCCATGGTCACTGCTG
ACTCCAAGTACTGCTACGGCCCCCAAGGCAGGAGCCCATACATCCCCCCGCACGCGGCCCTGTGCCTGGAGGTGACCCTGAAGACGGCTG
TGGACGGGCCTGACCTGGAGATGCTCACGGGGCAGGAGCGCGTGGCCCTGGCCAACCGGAAGCGGGAGTGCGGCAACGCCCACTACCAGC
GGGCGGACTTCGTCCTGGCCGCCAACTCCTACGACCTCGCCATCAAGGCTATCACCTCCAGCGCCAAAGACGCTGAAGCGGAGGGGCATT
GGCCTCGATGGGCCAGAGCTGGAGCCGGATGAAGGGCCTGAGGAGCCAGGAGAGAAGTTTCGGAGGCTGGCAGGCGAAGGGGGTGATCCG
GCCTTGCCCCGACCCCGGCTGTATCCTGCAGCTCCTGCTATGCCCAGCCCAGATGTGGTATACGGGGCCTTACCGCCACCAGGCTGTGAC
CCCAGTGGGCTTGGGGAAGCACTGCCCGCCCAGAGCCGCCCATCTCCCTTCCGACCAGCAGCCCCCAAAGCCGGGCCCCCAGGCCTGGTG
CACCCTCTCTTCTCACCAAGCCACCTCACCAGCAAGACACCACCCCCACTGTACCTGCCGACGGAAGGGCGGAGGTCAGACCTGCCTGGT
GGCCTGGCTGGGCCCCGAGGGGGACTAAACACCTCCAGAAGCCTCTACAGTGGCCTGCAGAACCCCTGCTCCACTGCAACTCCCGGACCC
CCACTGGGGAGCTTCCCCTTCCTCCCCGGAGGCCCCCCAGAATATGGCCTGGGAGACCCTCCACCGCCCCCTGGCTTGTTGCAGCCCCCC
ACCCTGGCCCCCTGGCAGCCCTCGAGGGGTGATGGGCCCCCCGCCGTGTCCTCCCAGCCCAGGTAAGTGCCCTGAGACGACGGCAAGTCC
CAGTCCTCCAAAGCCCCGGCCGCTGCTGACCCCTGGTGGCCATCCCTGGTACTGCGCACACTTCCGGTACGGATGGGCAGCTATTTTGAG
GCCCCAAGAGGGACCGCCACCCCCTCCTTTCCCAGGGTCCTCCTGCCAAGCCTTTGCCCACGCTGTGCCATCCCCTGGCTTCCTTCCCTT
CCTCGCTGAGCTCACGGCCTCCCTCTCTCTTTCCCCCTGCAGTGGGGGCCGAAGCCTGGGCGAGGAGGGTCCCCCAACCCGCGGCGCCTC
CCCGCCGACCCCCCCAGTCAGCATCAAGTCTGAGCGCCTCTCTCCGGCCCCCGGGGGCCCCGGCGACTTTCCTAAGACCTTCCCCTATCC
CTTGCTCCTCGCCCGGTCCCTGGCAGAGCCTCTGCGGCCTGGGCCCGCCCTGCGCCGGCTGCCCTTGGCCGACGGCTGGCCCCGGTAGGA
GATCACCCGGTGGCACCAGCCCAGAGCGCTCGCCAGGTACGGCGAGGGCACGTGGGGACCCCACCTCCCTCCAGGCCTCTTCAGAGAAGA
CCCAACAGTGACGCCCCCCTCCGCGGTGGGGGCTTGGAGGTGGGCGGCTGGACTCAATCCACCCTGGGGGGCTCCTTTCCTTCTTCCTAT

>In-frame_FKBP8_ENST00000596558_chr19_18649026_-_MEF2B_ENST00000424583_chr19_19258641_-_1956nt
GAATTGTGCGGGCGCGGGGAATTATGGGGGTGGGGGCTGGGAGGGTCTCTCAAAGTGGGGCTCCGAGCCCGGGAGGAGCAGGCAGGGCCA
ATTCCTGTCCCCCCAGCAGCATGGCATCGTGTGCTGAACCCTCTGAGCCCTCTGCCCCACTGCCCGCCGGGGTCCCACCGCTCGAGGACT
TCGAGGTACTGGATGGGGTTGAGGATGCAGAGGGTGAGGAGGAAGAGGAGGAGGAAGAGGAGGAAGAGGATGACCTGAGTGAGCTGCCAC
CGCTGGAGGACATGGGACAACCCCCGGCGGAGGAGGCTGAGCAGCCTGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCATGGAGCCCGAGC
CCGCCCCAGCCCCGGCCCCAGAAGAGTGGCTGGACATTCTGGGGAACGGGCTGTTGAGGAAGAAGACGCTGGTCCCAGGGCCGCCAGGTT
CGAGCCGCCCGGTCAAGGGCCAGGTGGTCACCGTACATCTGCAGACGTCGCTGGAGAATGGCACACGGGTGCAGGAGGAGCCGGAGCTGG
TGTTCACTCTGGGTGACTGTGACGTCATCCAGGCCCTGGATCTCAGTGTCCCACTCATGGACGTGGGGGAGACGGCCATGGTCACTGCTG
ACTCCAAGTACTGCTACGGCCCCCAAGGCAGGAGCCCATACATCCCCCCGCACGCGGCCCTGTGCCTGGAGGTGACCCTGAAGACGGCTG
TGGACGGGCCTGACCTGGAGATGCTCACGGGGCAGGAGCGCGTGGCCCTGGCCAACCGGAAGCGGGAGTGCGGCAACGCCCACTACCAGC
GGGCGGACTTCGTCCTGGCCGCCAACTCCTACGACCTCGCCATCAAGGCTATCACCTCCAGCGCCAAAGACGCTGAAGCGGAGGGGCATT
GGCCTCGATGGGCCAGAGCTGGAGCCGGATGAAGGGCCTGAGGAGCCAGGAGAGAAGTTTCGGAGGCTGGCAGGCGAAGGGGGTGATCCG
GCCTTGCCCCGACCCCGGCTGTATCCTGCAGCTCCTGCTATGCCCAGCCCAGATGTGGTATACGGGGCCTTACCGCCACCAGGCTGTGAC
CCCAGTGGGCTTGGGGAAGCACTGCCCGCCCAGAGCCGCCCATCTCCCTTCCGACCAGCAGCCCCCAAAGCCGGGCCCCCAGGCCTGGTG
CACCCTCTCTTCTCACCAAGCCACCTCACCAGCAAGACACCACCCCCACTGTACCTGCCGACGGAAGGGCGGAGGTCAGACCTGCCTGGT
GGCCTGGCTGGGCCCCGAGGGGGACTAAACACCTCCAGAAGCCTCTACAGTGGCCTGCAGAACCCCTGCTCCACTGCAACTCCCGGACCC
CCACTGGGGAGCTTCCCCTTCCTCCCCGGAGGCCCCCCAGAATATGGCCTGGGAGACCCTCCACCGCCCCCTGGCTTGTTGCAGCCCCCC
ACCCTGGCCCCCTGGCAGCCCTCGAGGGGTGATGGGCCCCCCGCCGTGTCCTCCCAGCCCAGTGGGGGCCGAAGCCTGGGCGAGGAGGGT
CCCCCAACCCGCGGCGCCTCCCCGCCGACCCCCCCAGTCAGCATCAAGTCTGAGCGCCTCTCTCCGGCCCCCGGGGGCCCCGGCGACTTT
CCTAAGACCTTCCCCTATCCCTTGCTCCTCGCCCGGTCCCTGGCAGAGCCTCTGCGGCCTGGGCCCGCCCTGCGCCGGCTGCCCTTGGCC
GACGGCTGGCCCCGGTAGGAGATCACCCGGTGGCACCAGCCCAGAGCGCTCGCCAGGTACGGCGAGGGCACGTGGGGACCCCACCTCCCT
CCAGGCCTCTTCAGAGAAGACCCAACAGTGACGCCCCCCTCCGCGGTGGGGGCTTGGAGGTGGGCGGCTGGACTCAATCCACCCTGGGGG

>In-frame_FKBP8_ENST00000596558_chr19_18649026_-_MEF2B_ENST00000410050_chr19_19258641_-_1977nt
GAATTGTGCGGGCGCGGGGAATTATGGGGGTGGGGGCTGGGAGGGTCTCTCAAAGTGGGGCTCCGAGCCCGGGAGGAGCAGGCAGGGCCA
ATTCCTGTCCCCCCAGCAGCATGGCATCGTGTGCTGAACCCTCTGAGCCCTCTGCCCCACTGCCCGCCGGGGTCCCACCGCTCGAGGACT
TCGAGGTACTGGATGGGGTTGAGGATGCAGAGGGTGAGGAGGAAGAGGAGGAGGAAGAGGAGGAAGAGGATGACCTGAGTGAGCTGCCAC
CGCTGGAGGACATGGGACAACCCCCGGCGGAGGAGGCTGAGCAGCCTGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCATGGAGCCCGAGC
CCGCCCCAGCCCCGGCCCCAGAAGAGTGGCTGGACATTCTGGGGAACGGGCTGTTGAGGAAGAAGACGCTGGTCCCAGGGCCGCCAGGTT
CGAGCCGCCCGGTCAAGGGCCAGGTGGTCACCGTACATCTGCAGACGTCGCTGGAGAATGGCACACGGGTGCAGGAGGAGCCGGAGCTGG
TGTTCACTCTGGGTGACTGTGACGTCATCCAGGCCCTGGATCTCAGTGTCCCACTCATGGACGTGGGGGAGACGGCCATGGTCACTGCTG
ACTCCAAGTACTGCTACGGCCCCCAAGGCAGGAGCCCATACATCCCCCCGCACGCGGCCCTGTGCCTGGAGGTGACCCTGAAGACGGCTG
TGGACGGGCCTGACCTGGAGATGCTCACGGGGCAGGAGCGCGTGGCCCTGGCCAACCGGAAGCGGGAGTGCGGCAACGCCCACTACCAGC
GGGCGGACTTCGTCCTGGCCGCCAACTCCTACGACCTCGCCATCAAGGCTATCACCTCCAGCGCCAAAGACGCTGAAGCGGAGGGGCATT
GGCCTCGATGGGCCAGAGCTGGAGCCGGATGAAGGGCCTGAGGAGCCAGGAGAGAAGTTTCGGAGGCTGGCAGGCGAAGGGGGTGATCCG
GCCTTGCCCCGACCCCGGCTGTATCCTGCAGCTCCTGCTATGCCCAGCCCAGATGTGGTATACGGGGCCTTACCGCCACCAGGCTGTGAC
CCCAGTGGGCTTGGGGAAGCACTGCCCGCCCAGAGCCGCCCATCTCCCTTCCGACCAGCAGCCCCCAAAGCCGGGCCCCCAGGCCTGGTG
CACCCTCTCTTCTCACCAAGCCACCTCACCAGCAAGACACCACCCCCACTGTACCTGCCGACGGAAGGGCGGAGGTCAGACCTGCCTGGT
GGCCTGGCTGGGCCCCGAGGGGGACTAAACACCTCCAGAAGCCTCTACAGTGGCCTGCAGAACCCCTGCTCCACTGCAACTCCCGGACCC
CCACTGGGGAGCTTCCCCTTCCTCCCCGGAGGCCCCCCAGCCCCCAATTCCTGCCCACCAGAATATGGCCTGGGAGACCCTCCACCGCCC
CCTGGCTTGTTGCAGCCCCCCACCCTGGCCCCCTGGCAGCCCTCGAGGGGTGATGGGCCCCCCGCCGTGTCCTCCCAGCCCAGTGGGGGC
CGAAGCCTGGGCGAGGAGGGTCCCCCAACCCGCGGCGCCTCCCCGCCGACCCCCCCAGTCAGCATCAAGTCTGAGCGCCTCTCTCCGGCC
CCCGGGGGCCCCGGCGACTTTCCTAAGACCTTCCCCTATCCCTTGCTCCTCGCCCGGTCCCTGGCAGAGCCTCTGCGGCCTGGGCCCGCC
CTGCGCCGGCTGCCCTTGGCCGACGGCTGGCCCCGGTAGGAGATCACCCGGTGGCACCAGCCCAGAGCGCTCGCCAGGTACGGCGAGGGC
ACGTGGGGACCCCACCTCCCTCCAGGCCTCTTCAGAGAAGACCCAACAGTGACGCCCCCCTCCGCGGTGGGGGCTTGGAGGTGGGCGGCT

>In-frame_FKBP8_ENST00000596558_chr19_18649026_-_MEF2B_ENST00000602424_chr19_19258641_-_1843nt
GAATTGTGCGGGCGCGGGGAATTATGGGGGTGGGGGCTGGGAGGGTCTCTCAAAGTGGGGCTCCGAGCCCGGGAGGAGCAGGCAGGGCCA
ATTCCTGTCCCCCCAGCAGCATGGCATCGTGTGCTGAACCCTCTGAGCCCTCTGCCCCACTGCCCGCCGGGGTCCCACCGCTCGAGGACT
TCGAGGTACTGGATGGGGTTGAGGATGCAGAGGGTGAGGAGGAAGAGGAGGAGGAAGAGGAGGAAGAGGATGACCTGAGTGAGCTGCCAC
CGCTGGAGGACATGGGACAACCCCCGGCGGAGGAGGCTGAGCAGCCTGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCATGGAGCCCGAGC
CCGCCCCAGCCCCGGCCCCAGAAGAGTGGCTGGACATTCTGGGGAACGGGCTGTTGAGGAAGAAGACGCTGGTCCCAGGGCCGCCAGGTT
CGAGCCGCCCGGTCAAGGGCCAGGTGGTCACCGTACATCTGCAGACGTCGCTGGAGAATGGCACACGGGTGCAGGAGGAGCCGGAGCTGG
TGTTCACTCTGGGTGACTGTGACGTCATCCAGGCCCTGGATCTCAGTGTCCCACTCATGGACGTGGGGGAGACGGCCATGGTCACTGCTG
ACTCCAAGTACTGCTACGGCCCCCAAGGCAGGAGCCCATACATCCCCCCGCACGCGGCCCTGTGCCTGGAGGTGACCCTGAAGACGGCTG
TGGACGGGCCTGACCTGGAGATGCTCACGGGGCAGGAGCGCGTGGCCCTGGCCAACCGGAAGCGGGAGTGCGGCAACGCCCACTACCAGC
GGGCGGACTTCGTCCTGGCCGCCAACTCCTACGACCTCGCCATCAAGGCTATCACCTCCAGCGCCAAAGACGCTGAAGCGGAGGGGCATT
GGCCTCGATGGGCCAGAGCTGGAGCCGGATGAAGGGCCTGAGGAGCCAGGAGAGAAGTTTCGGAGGCTGGCAGGCGAAGGGGGTGATCCG
GCCTTGCCCCGACCCCGGCTGTATCCTGCAGCTCCTGCTATGCCCAGCCCAGATGTGGTATACGGGGCCTTACCGCCACCAGGCTGTGAC
CCCAGTGGGCTTGGGGAAGCACTGCCCGCCCAGAGCCGCCCATCTCCCTTCCGACCAGCAGCCCCCAAAGCCGGGCCCCCAGGCCTGGTG
CACCCTCTCTTCTCACCAAGCCACCTCACCAGCAAGACACCACCCCCACTGTACCTGCCGACGGAAGGGCGGAGGTCAGACCTGCCTGGT
GGCCTGGCTGGGCCCCGAGGGGGACTAAACACCTCCAGAAGCCTCTACAGTGGCCTGCAGAACCCCTGCTCCACTGCAACTCCCGGACCC
CCACTGGGGAGCTTCCCCTTCCTCCCCGGAGGCCCCCCAGTGGGGGCCGAAGCCTGGGCGAGGAGGGTCCCCCAACCCGCGGCGCCTCCC
CGCCGACCCCCCCAGTCAGCATCAAGTCTGAGCGCCTCTCTCCGGCCCCCGGGGGCCCCGGCGACTTTCCTAAGACCTTCCCCTATCCCT
TGCTCCTCGCCCGGTCCCTGGCAGAGCCTCTGCGGCCTGGGCCCGCCCTGCGCCGGCTGCCCTTGGCCGACGGCTGGCCCCGGTAGGAGA
TCACCCGGTGGCACCAGCCCAGAGCGCTCGCCAGGTACGGCGAGGGCACGTGGGGACCCCACCTCCCTCCAGGCCTCTTCAGAGAAGACC
CAACAGTGACGCCCCCCTCCGCGGTGGGGGCTTGGAGGTGGGCGGCTGGACTCAATCCACCCTGGGGGGCTCCTTTCCTTCTTCCTATTT

>In-frame_FKBP8_ENST00000596558_chr19_18649026_-_MEF2B_ENST00000409447_chr19_19258641_-_1686nt
GAATTGTGCGGGCGCGGGGAATTATGGGGGTGGGGGCTGGGAGGGTCTCTCAAAGTGGGGCTCCGAGCCCGGGAGGAGCAGGCAGGGCCA
ATTCCTGTCCCCCCAGCAGCATGGCATCGTGTGCTGAACCCTCTGAGCCCTCTGCCCCACTGCCCGCCGGGGTCCCACCGCTCGAGGACT
TCGAGGTACTGGATGGGGTTGAGGATGCAGAGGGTGAGGAGGAAGAGGAGGAGGAAGAGGAGGAAGAGGATGACCTGAGTGAGCTGCCAC
CGCTGGAGGACATGGGACAACCCCCGGCGGAGGAGGCTGAGCAGCCTGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCATGGAGCCCGAGC
CCGCCCCAGCCCCGGCCCCAGAAGAGTGGCTGGACATTCTGGGGAACGGGCTGTTGAGGAAGAAGACGCTGGTCCCAGGGCCGCCAGGTT
CGAGCCGCCCGGTCAAGGGCCAGGTGGTCACCGTACATCTGCAGACGTCGCTGGAGAATGGCACACGGGTGCAGGAGGAGCCGGAGCTGG
TGTTCACTCTGGGTGACTGTGACGTCATCCAGGCCCTGGATCTCAGTGTCCCACTCATGGACGTGGGGGAGACGGCCATGGTCACTGCTG
ACTCCAAGTACTGCTACGGCCCCCAAGGCAGGAGCCCATACATCCCCCCGCACGCGGCCCTGTGCCTGGAGGTGACCCTGAAGACGGCTG
TGGACGGGCCTGACCTGGAGATGCTCACGGGGCAGGAGCGCGTGGCCCTGGCCAACCGGAAGCGGGAGTGCGGCAACGCCCACTACCAGC
GGGCGGACTTCGTCCTGGCCGCCAACTCCTACGACCTCGCCATCAAGGCTATCACCTCCAGCGCCAAAGACGCTGAAGCGGAGGGGCATT
GGCCTCGATGGGCCAGAGCTGGAGCCGGATGAAGGGCCTGAGGAGCCAGGAGAGAAGTTTCGGAGGCTGGCAGGCGAAGGGGGTGATCCG
GCCTTGCCCCGACCCCGGCTGTATCCTGCAGCTCCTGCTATGCCCAGCCCAGATGTGGTATACGGGGCCTTACCGCCACCAGGCTGTGAC
CCCAGTGGGCTTGGGGAAGCACTGCCCGCCCAGAGCCGCCCATCTCCCTTCCGACCAGCAGCCCCCAAAGCCGGGCCCCCAGAGAAGCCT
CTACAGTGGCCTGCAGAACCCCTGCTCCACTGCAACTCCCGGACCCCCACTGGGGAGCTTCCCCTTCCTCCCCGGAGGCCCCCCAGTGGG
GGCCGAAGCCTGGGCGAGGAGGGTCCCCCAACCCGCGGCGCCTCCCCGCCGACCCCCCCAGTCAGCATCAAGTCTGAGCGCCTCTCTCCG
GCCCCCGGGGGCCCCGGCGACTTTCCTAAGACCTTCCCCTATCCCTTGCTCCTCGCCCGGTCCCTGGCAGAGCCTCTGCGGCCTGGGCCC
GCCCTGCGCCGGCTGCCCTTGGCCGACGGCTGGCCCCGGTAGGAGATCACCCGGTGGCACCAGCCCAGAGCGCTCGCCAGGTACGGCGAG
GGCACGTGGGGACCCCACCTCCCTCCAGGCCTCTTCAGAGAAGACCCAACAGTGACGCCCCCCTCCGCGGTGGGGGCTTGGAGGTGGGCG

>In-frame_FKBP8_ENST00000596558_chr19_18649026_-_MEF2B_ENST00000162023_chr19_19258641_-_1772nt
GAATTGTGCGGGCGCGGGGAATTATGGGGGTGGGGGCTGGGAGGGTCTCTCAAAGTGGGGCTCCGAGCCCGGGAGGAGCAGGCAGGGCCA
ATTCCTGTCCCCCCAGCAGCATGGCATCGTGTGCTGAACCCTCTGAGCCCTCTGCCCCACTGCCCGCCGGGGTCCCACCGCTCGAGGACT
TCGAGGTACTGGATGGGGTTGAGGATGCAGAGGGTGAGGAGGAAGAGGAGGAGGAAGAGGAGGAAGAGGATGACCTGAGTGAGCTGCCAC
CGCTGGAGGACATGGGACAACCCCCGGCGGAGGAGGCTGAGCAGCCTGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCATGGAGCCCGAGC
CCGCCCCAGCCCCGGCCCCAGAAGAGTGGCTGGACATTCTGGGGAACGGGCTGTTGAGGAAGAAGACGCTGGTCCCAGGGCCGCCAGGTT
CGAGCCGCCCGGTCAAGGGCCAGGTGGTCACCGTACATCTGCAGACGTCGCTGGAGAATGGCACACGGGTGCAGGAGGAGCCGGAGCTGG
TGTTCACTCTGGGTGACTGTGACGTCATCCAGGCCCTGGATCTCAGTGTCCCACTCATGGACGTGGGGGAGACGGCCATGGTCACTGCTG
ACTCCAAGTACTGCTACGGCCCCCAAGGCAGGAGCCCATACATCCCCCCGCACGCGGCCCTGTGCCTGGAGGTGACCCTGAAGACGGCTG
TGGACGGGCCTGACCTGGAGATGCTCACGGGGCAGGAGCGCGTGGCCCTGGCCAACCGGAAGCGGGAGTGCGGCAACGCCCACTACCAGC
GGGCGGACTTCGTCCTGGCCGCCAACTCCTACGACCTCGCCATCAAGGCTATCACCTCCAGCGCCAAAGACGCTGAAGCGGAGGGGCATT
GGCCTCGATGGGCCAGAGCTGGAGCCGGATGAAGGGCCTGAGGAGCCAGGAGAGAAGTTTCGGAGGCTGGCAGGCGAAGGGGGTGATCCG
GCCTTGCCCCGACCCCGGCTGTATCCTGCAGCTCCTGCTATGCCCAGCCCAGATGTGGTATACGGGGCCTTACCGCCACCAGGCTGTGAC
CCCAGTGGGCTTGGGGAAGCACTGCCCGCCCAGAGCCGCCCATCTCCCTTCCGACCAGCAGCCCCCAAAGCCGGGCCCCCAGGCCTGGTG
CACCCTCTCTTCTCACCAAGCCACCTCACCAGCAAGACACCACCCCCACTGTACCTGCCGACGGAAGGGCGGAGGTCAGACCTGCCTGGT
GGCCTGGCTGGGCCCCGAGGGGGACTAAACACCTCCAGAAGCCTCTACAGTGGCCTGCAGAACCCCTGCTCCACTGCAACTCCCGGACCC
CCACTGGGGAGCTTCCCCTTCCTCCCCGGAGGCCCCCCAGAATATGGCCTGGGAGACCCTCCACCGCCCCCTGGCTTGTTGCAGCCCCCC
ACCCTGGCCCCCTGGCAGCCCTCGAGGGGTGATGGGCCCCCCGCCGTGTCCTCCCAGCCCAGTGGGGGCCGAAGCCTGGGCGAGGAGGGT
CCCCCAACCCGCGGCGCCTCCCCGCCGACCCCCCCAGTCAGCATCAAGTCTGAGCGCCTCTCTCCGGCCCCCGGGGGCCCCGGCGACTTT
CCTAAGACCTTCCCCTATCCCTTGCTCCTCGCCCGGTCCCTGGCAGAGCCTCTGCGGCCTGGGCCCGCCCTGCGCCGGCTGCCCTTGGCC


Top

FusionGenePPI for FKBP8_MEF2B


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
FKBP8BCL2, BCL2L1, USP19, BRE, EGFR, HSP90AA1, CALM1, PSMC1, PSMC2, PSMC3, PSMC4, PSMC5, PSMC6, PSMD1, PSMD2, PSMD3, PSMD4, PSMD6, PSMD7, PSMD11, PSMD12, PSMD13, PSMD14, PSMA1, PSMA2, PSMA3, PSMA4, PSMA5, PSMA6, PSMA7, PSMB1, PSMB2, PSMB3, PSMB5, PSMB7, ADRM1, PTPRK, UBC, TERF1, EGLN1, CUL3, VHL, ATP13A2, SURF1, MRPL11, YME1L1, UQCRC1, UQCRC2, MRPL15, SSR1, UQCRFS1, PGRMC1, DHODH, NDUFB10, TOMM22, ABCC1, NNT, KCNH2, FKBP8, CAMK2A, CLN3, ADRB2, BNIPL, ARHGEF5, CDK20, PDCL, SUGT1, PTGES3, CACYBP, HSPBP1, RHEB, MTOR, MLST8, RPTOR, RICTOR, CCDC8, RPS6KB2, ABCB7, TCTN2, TCTN3, EVC2, TMEM216, MLH1, XRCC3, VAPA, ATP6AP2, COQ9, TMEM258, CLCN1, CUL4A, CUL4B, MTMR11, PTPMT1, ANKMY2MEF2BHDAC9, CABIN1, HDAC6, MEF2A, MEF2BNB-MEF2B, MEF2D, MEF2C, UBN2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for FKBP8_MEF2B


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for FKBP8_MEF2B


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource