FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 13535

FusionGeneSummary for FKBP8_HAUS8

check button Fusion gene summary
Fusion gene informationFusion gene name: FKBP8_HAUS8
Fusion gene ID: 13535
HgeneTgene
Gene symbol

FKBP8

HAUS8

Gene ID

23770

93323

Gene nameFK506 binding protein 8HAUS augmin like complex subunit 8
SynonymsFKBP38|FKBPr38DGT4|HICE1|NY-SAR-48
Cytomap

19p13.11

19p13.11

Type of geneprotein-codingprotein-coding
Descriptionpeptidyl-prolyl cis-trans isomerase FKBP838 kDa FK506-binding protein38 kDa FKBPFK506 binding protein 8, 38kDaFKBP-38FKBP-8PPIase FKBP8hFKBP38rotamaseHAUS augmin-like complex subunit 8HEC1/NDC80 interacting, centrosome associated 1HEC1/NDC80-interacting centrosome-associated protein 1Hec1-interacting and centrosome-associated 1sarcoma antigen NY-SAR-48
Modification date2018052220180523
UniProtAcc

Q14318

Q9BT25

Ensembl transtripts involved in fusion geneENST00000597960, ENST00000610101, 
ENST00000596558, ENST00000222308, 
ENST00000608443, ENST00000453489, 
ENST00000253669, ENST00000448593, 
ENST00000593360, 
Fusion gene scores* DoF score10 X 11 X 4=4404 X 4 X 4=64
# samples 114
** MAII scorelog2(11/440*10)=-2
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/64*10)=-0.678071905112638
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: FKBP8 [Title/Abstract] AND HAUS8 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVACCTCGA-OR-A5KX-01AFKBP8chr19

18652489

-HAUS8chr19

17184145

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000597960ENST00000253669FKBP8chr19

18652489

-HAUS8chr19

17184145

-
Frame-shitENST00000597960ENST00000448593FKBP8chr19

18652489

-HAUS8chr19

17184145

-
5CDS-5UTRENST00000597960ENST00000593360FKBP8chr19

18652489

-HAUS8chr19

17184145

-
In-frameENST00000610101ENST00000253669FKBP8chr19

18652489

-HAUS8chr19

17184145

-
In-frameENST00000610101ENST00000448593FKBP8chr19

18652489

-HAUS8chr19

17184145

-
5CDS-5UTRENST00000610101ENST00000593360FKBP8chr19

18652489

-HAUS8chr19

17184145

-
Frame-shitENST00000596558ENST00000253669FKBP8chr19

18652489

-HAUS8chr19

17184145

-
Frame-shitENST00000596558ENST00000448593FKBP8chr19

18652489

-HAUS8chr19

17184145

-
5CDS-5UTRENST00000596558ENST00000593360FKBP8chr19

18652489

-HAUS8chr19

17184145

-
In-frameENST00000222308ENST00000253669FKBP8chr19

18652489

-HAUS8chr19

17184145

-
In-frameENST00000222308ENST00000448593FKBP8chr19

18652489

-HAUS8chr19

17184145

-
5CDS-5UTRENST00000222308ENST00000593360FKBP8chr19

18652489

-HAUS8chr19

17184145

-
In-frameENST00000608443ENST00000253669FKBP8chr19

18652489

-HAUS8chr19

17184145

-
In-frameENST00000608443ENST00000448593FKBP8chr19

18652489

-HAUS8chr19

17184145

-
5CDS-5UTRENST00000608443ENST00000593360FKBP8chr19

18652489

-HAUS8chr19

17184145

-
Frame-shitENST00000453489ENST00000253669FKBP8chr19

18652489

-HAUS8chr19

17184145

-
Frame-shitENST00000453489ENST00000448593FKBP8chr19

18652489

-HAUS8chr19

17184145

-
5CDS-5UTRENST00000453489ENST00000593360FKBP8chr19

18652489

-HAUS8chr19

17184145

-

Top

FusionProtFeatures for FKBP8_HAUS8


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
FKBP8

Q14318

HAUS8

Q9BT25

Constitutively inactive PPiase, which becomes activewhen bound to calmodulin and calcium. Seems to act as a chaperonefor BCL2, targets it to the mitochondria and modulates itsphosphorylation state. The BCL2/FKBP8/calmodulin/calcium complexprobably interferes with the binding of BCL2 to its targets. Theactive form of FKBP8 may therefore play a role in the regulationof apoptosis. {ECO:0000269|PubMed:12510191,ECO:0000269|PubMed:15757646, ECO:0000269|PubMed:16176796}. Contributes to mitotic spindle assembly, maintenance ofcentrosome integrity and completion of cytokinesis as part of theHAUS augmin-like complex. {ECO:0000269|PubMed:18362163,ECO:0000269|PubMed:19369198, ECO:0000269|PubMed:19427217}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for FKBP8_HAUS8


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_FKBP8_ENST00000610101_chr19_18652489_-_HAUS8_ENST00000253669_chr19_17184145_-_498aa
MASCAEPSEPSAPLPAGVPPLEDFEVLDGVEDAEGEEEEEEEEEEEDDLSELPPLEDMGQPPAEEAEQPGALAREFLAAMEPEPAPAPAP
EEWLDILGSLQPAPQILAVPRRRIKEFKVEE_LSPGICSMKRRQPKRLLQEMGHRPEGRCLKVEGNPACSRKAKQIAVGSERVTCSPRCW
KGMAQLHLTWISLLLMTKASSKRRHS_QKQTQRNLSQHHFLPLGKRARITLKQWK_WSLRHYC_RYTP_RWRTILLSLKEGQKRIT__CV
RRRRSYRKRPTS_SAGFSSLRGSGSWQMSWMPRSRCSAPSRQWPHASRSNTGHSPRPWTLPGTSCP_GPSTWREMGSSS_TPCSMNW_PL
SASWENLMLVIRKKMCRCWTY_ANSRT_RRKRTLSSEGALPRCWNSPQRQAKRQPWQTRKSGKRPRAWRPPAGGISIKTVPAENLGEHPR

>In-frame_FKBP8_ENST00000610101_chr19_18652489_-_HAUS8_ENST00000448593_chr19_17184145_-_497aa
MASCAEPSEPSAPLPAGVPPLEDFEVLDGVEDAEGEEEEEEEEEEEDDLSELPPLEDMGQPPAEEAEQPGALAREFLAAMEPEPAPAPAP
EEWLDILGSLQPAPQILAVPRRRIKEFKVEE_LSPGICSMKRRQPKRLLQEMGHRPEGRCLKVEGNPACSRKAKIAVGSERVTCSPRCWK
GMAQLHLTWISLLLMTKASSKRRHS_QKQTQRNLSQHHFLPLGKRARITLKQWK_WSLRHYC_RYTP_RWRTILLSLKEGQKRIT__CVR
RRRSYRKRPTS_SAGFSSLRGSGSWQMSWMPRSRCSAPSRQWPHASRSNTGHSPRPWTLPGTSCP_GPSTWREMGSSS_TPCSMNW_PLS
ASWENLMLVIRKKMCRCWTY_ANSRT_RRKRTLSSEGALPRCWNSPQRQAKRQPWQTRKSGKRPRAWRPPAGGISIKTVPAENLGEHPRT

>In-frame_FKBP8_ENST00000222308_chr19_18652489_-_HAUS8_ENST00000253669_chr19_17184145_-_498aa
MASCAEPSEPSAPLPAGVPPLEDFEVLDGVEDAEGEEEEEEEEEEEDDLSELPPLEDMGQPPAEEAEQPGALAREFLAAMEPEPAPAPAP
EEWLDILGSLQPAPQILAVPRRRIKEFKVEE_LSPGICSMKRRQPKRLLQEMGHRPEGRCLKVEGNPACSRKAKQIAVGSERVTCSPRCW
KGMAQLHLTWISLLLMTKASSKRRHS_QKQTQRNLSQHHFLPLGKRARITLKQWK_WSLRHYC_RYTP_RWRTILLSLKEGQKRIT__CV
RRRRSYRKRPTS_SAGFSSLRGSGSWQMSWMPRSRCSAPSRQWPHASRSNTGHSPRPWTLPGTSCP_GPSTWREMGSSS_TPCSMNW_PL
SASWENLMLVIRKKMCRCWTY_ANSRT_RRKRTLSSEGALPRCWNSPQRQAKRQPWQTRKSGKRPRAWRPPAGGISIKTVPAENLGEHPR

>In-frame_FKBP8_ENST00000222308_chr19_18652489_-_HAUS8_ENST00000448593_chr19_17184145_-_497aa
MASCAEPSEPSAPLPAGVPPLEDFEVLDGVEDAEGEEEEEEEEEEEDDLSELPPLEDMGQPPAEEAEQPGALAREFLAAMEPEPAPAPAP
EEWLDILGSLQPAPQILAVPRRRIKEFKVEE_LSPGICSMKRRQPKRLLQEMGHRPEGRCLKVEGNPACSRKAKIAVGSERVTCSPRCWK
GMAQLHLTWISLLLMTKASSKRRHS_QKQTQRNLSQHHFLPLGKRARITLKQWK_WSLRHYC_RYTP_RWRTILLSLKEGQKRIT__CVR
RRRSYRKRPTS_SAGFSSLRGSGSWQMSWMPRSRCSAPSRQWPHASRSNTGHSPRPWTLPGTSCP_GPSTWREMGSSS_TPCSMNW_PLS
ASWENLMLVIRKKMCRCWTY_ANSRT_RRKRTLSSEGALPRCWNSPQRQAKRQPWQTRKSGKRPRAWRPPAGGISIKTVPAENLGEHPRT

>In-frame_FKBP8_ENST00000608443_chr19_18652489_-_HAUS8_ENST00000253669_chr19_17184145_-_498aa
MASCAEPSEPSAPLPAGVPPLEDFEVLDGVEDAEGEEEEEEEEEEEDDLSELPPLEDMGQPPAEEAEQPGALAREFLAAMEPEPAPAPAP
EEWLDILGSLQPAPQILAVPRRRIKEFKVEE_LSPGICSMKRRQPKRLLQEMGHRPEGRCLKVEGNPACSRKAKQIAVGSERVTCSPRCW
KGMAQLHLTWISLLLMTKASSKRRHS_QKQTQRNLSQHHFLPLGKRARITLKQWK_WSLRHYC_RYTP_RWRTILLSLKEGQKRIT__CV
RRRRSYRKRPTS_SAGFSSLRGSGSWQMSWMPRSRCSAPSRQWPHASRSNTGHSPRPWTLPGTSCP_GPSTWREMGSSS_TPCSMNW_PL
SASWENLMLVIRKKMCRCWTY_ANSRT_RRKRTLSSEGALPRCWNSPQRQAKRQPWQTRKSGKRPRAWRPPAGGISIKTVPAENLGEHPR

>In-frame_FKBP8_ENST00000608443_chr19_18652489_-_HAUS8_ENST00000448593_chr19_17184145_-_497aa
MASCAEPSEPSAPLPAGVPPLEDFEVLDGVEDAEGEEEEEEEEEEEDDLSELPPLEDMGQPPAEEAEQPGALAREFLAAMEPEPAPAPAP
EEWLDILGSLQPAPQILAVPRRRIKEFKVEE_LSPGICSMKRRQPKRLLQEMGHRPEGRCLKVEGNPACSRKAKIAVGSERVTCSPRCWK
GMAQLHLTWISLLLMTKASSKRRHS_QKQTQRNLSQHHFLPLGKRARITLKQWK_WSLRHYC_RYTP_RWRTILLSLKEGQKRIT__CVR
RRRSYRKRPTS_SAGFSSLRGSGSWQMSWMPRSRCSAPSRQWPHASRSNTGHSPRPWTLPGTSCP_GPSTWREMGSSS_TPCSMNW_PLS
ASWENLMLVIRKKMCRCWTY_ANSRT_RRKRTLSSEGALPRCWNSPQRQAKRQPWQTRKSGKRPRAWRPPAGGISIKTVPAENLGEHPRT


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_FKBP8_ENST00000610101_chr19_18652489_-_HAUS8_ENST00000253669_chr19_17184145_-_1496nt
ATGGCATCGTGTGCTGAACCCTCTGAGCCCTCTGCCCCACTGCCCGCCGGGGTCCCACCGCTCGAGGACTTCGAGGTACTGGATGGGGTT
GAGGATGCAGAGGGTGAGGAGGAAGAGGAGGAGGAAGAGGAGGAAGAGGATGACCTGAGTGAGCTGCCACCGCTGGAGGACATGGGACAA
CCCCCGGCGGAGGAGGCTGAGCAGCCTGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCATGGAGCCCGAGCCCGCCCCAGCCCCGGCCCCA
GAAGAGTGGCTGGACATTCTGGGAAGCCTGCAACCGGCCCCACAAATTCTAGCAGTGCCAAGAAGAAGGATAAAAGAGTTCAAGGTGGAA
GAGTGATTGAGTCCCGGTATCTGCAGTATGAAAAGAAGACAACCCAAAAGGCTCCTGCAGGAGATGGGTCACAGACCCGAGGGAAGATGT
CTGAAGGTGGAAGGAAATCCAGCCTGCTCCAGAAAAGCAAAGCAGATAGCAGTGGGGTCGGAAAGGGTGACCTGCAGTCCACGTTGCTGG
AAGGGCATGGCACAGCTCCACCTGACCTGGATCTCTCTGCTATTAATGACAAAAGCATCGTCAAAAAGACGCCACAGTTAGCAAAAACAA
TATCAAAGAAACCTGAGTCAACATCATTTTCTGCCCCTCGGAAAAAGAGCCCGGATTTATCTGAAGCAATGGAAATGATGGAGTCTCAGA
CACTACTGCTGACGCTACTATCCGTAAAGATGGAGAACAATCTTGCTGAGTTTGAAAGAAGGGCAGAAAAGAATTTATTAATAATGTGTA
AGGAGAAGGAGAAGCTACAGAAAAAGGCCCACGAGCTGAAGCGCAGGCTTCTCCTCTCTCAGAGGAAGCGGGAGCTGGCAGATGTCCTGG
ATGCCCAGATCGAGATGCTCAGCCCCTTCGAGGCAGTGGCCACACGCTTCAAGGAGCAATACAGGACATTCGCCACGGCCCTGGACACTA
CCAGGCACGAGCTGCCCGTGAGGTCCATCCACCTGGAGGGAGATGGGCAGCAGCTCTTAGACGCCCTGCAGCATGAACTGGTGACCACTC
AGCGCCTCCTGGGAGAACTTGATGTTGGTGATTCGGAAGAAAATGTGCAGGTGCTGGACTTACTGAGCGAACTCAAGGACGTGACGGCGA
AAAAGGACCTTGAGCTCCGAAGGAGCTTTGCCCAGGTGCTGGAACTCTCCGCAGAGGCAAGCAAAGAGGCAGCCTTGGCAAACCAGGAAG
TCTGGGAAGAGACCCAGGGCATGGCGCCCCCCAGCCGGTGGTATTTCAATCAAGACAGTGCCTGCAGAGAATCTGGGGGAGCACCCAAGA
ACACGCCCCTGTCTGAGGACGACAACCCGGGTGCCTCGTCAGCCCCCGCTCAGGCCACGTTCATCAGCCCAAGCGAAGATTTTTCTTCAA

>In-frame_FKBP8_ENST00000610101_chr19_18652489_-_HAUS8_ENST00000448593_chr19_17184145_-_1493nt
ATGGCATCGTGTGCTGAACCCTCTGAGCCCTCTGCCCCACTGCCCGCCGGGGTCCCACCGCTCGAGGACTTCGAGGTACTGGATGGGGTT
GAGGATGCAGAGGGTGAGGAGGAAGAGGAGGAGGAAGAGGAGGAAGAGGATGACCTGAGTGAGCTGCCACCGCTGGAGGACATGGGACAA
CCCCCGGCGGAGGAGGCTGAGCAGCCTGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCATGGAGCCCGAGCCCGCCCCAGCCCCGGCCCCA
GAAGAGTGGCTGGACATTCTGGGAAGCCTGCAACCGGCCCCACAAATTCTAGCAGTGCCAAGAAGAAGGATAAAAGAGTTCAAGGTGGAA
GAGTGATTGAGTCCCGGTATCTGCAGTATGAAAAGAAGACAACCCAAAAGGCTCCTGCAGGAGATGGGTCACAGACCCGAGGGAAGATGT
CTGAAGGTGGAAGGAAATCCAGCCTGCTCCAGAAAAGCAAAGATAGCAGTGGGGTCGGAAAGGGTGACCTGCAGTCCACGTTGCTGGAAG
GGCATGGCACAGCTCCACCTGACCTGGATCTCTCTGCTATTAATGACAAAAGCATCGTCAAAAAGACGCCACAGTTAGCAAAAACAATAT
CAAAGAAACCTGAGTCAACATCATTTTCTGCCCCTCGGAAAAAGAGCCCGGATTTATCTGAAGCAATGGAAATGATGGAGTCTCAGACAC
TACTGCTGACGCTACTATCCGTAAAGATGGAGAACAATCTTGCTGAGTTTGAAAGAAGGGCAGAAAAGAATTTATTAATAATGTGTAAGG
AGAAGGAGAAGCTACAGAAAAAGGCCCACGAGCTGAAGCGCAGGCTTCTCCTCTCTCAGAGGAAGCGGGAGCTGGCAGATGTCCTGGATG
CCCAGATCGAGATGCTCAGCCCCTTCGAGGCAGTGGCCACACGCTTCAAGGAGCAATACAGGACATTCGCCACGGCCCTGGACACTACCA
GGCACGAGCTGCCCGTGAGGTCCATCCACCTGGAGGGAGATGGGCAGCAGCTCTTAGACGCCCTGCAGCATGAACTGGTGACCACTCAGC
GCCTCCTGGGAGAACTTGATGTTGGTGATTCGGAAGAAAATGTGCAGGTGCTGGACTTACTGAGCGAACTCAAGGACGTGACGGCGAAAA
AGGACCTTGAGCTCCGAAGGAGCTTTGCCCAGGTGCTGGAACTCTCCGCAGAGGCAAGCAAAGAGGCAGCCTTGGCAAACCAGGAAGTCT
GGGAAGAGACCCAGGGCATGGCGCCCCCCAGCCGGTGGTATTTCAATCAAGACAGTGCCTGCAGAGAATCTGGGGGAGCACCCAAGAACA
CGCCCCTGTCTGAGGACGACAACCCGGGTGCCTCGTCAGCCCCCGCTCAGGCCACGTTCATCAGCCCAAGCGAAGATTTTTCTTCAAGCA

>In-frame_FKBP8_ENST00000222308_chr19_18652489_-_HAUS8_ENST00000253669_chr19_17184145_-_1496nt
ATGGCATCGTGTGCTGAACCCTCTGAGCCCTCTGCCCCACTGCCCGCCGGGGTCCCACCGCTCGAGGACTTCGAGGTACTGGATGGGGTT
GAGGATGCAGAGGGTGAGGAGGAAGAGGAGGAGGAAGAGGAGGAAGAGGATGACCTGAGTGAGCTGCCACCGCTGGAGGACATGGGACAA
CCCCCGGCGGAGGAGGCTGAGCAGCCTGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCATGGAGCCCGAGCCCGCCCCAGCCCCGGCCCCA
GAAGAGTGGCTGGACATTCTGGGAAGCCTGCAACCGGCCCCACAAATTCTAGCAGTGCCAAGAAGAAGGATAAAAGAGTTCAAGGTGGAA
GAGTGATTGAGTCCCGGTATCTGCAGTATGAAAAGAAGACAACCCAAAAGGCTCCTGCAGGAGATGGGTCACAGACCCGAGGGAAGATGT
CTGAAGGTGGAAGGAAATCCAGCCTGCTCCAGAAAAGCAAAGCAGATAGCAGTGGGGTCGGAAAGGGTGACCTGCAGTCCACGTTGCTGG
AAGGGCATGGCACAGCTCCACCTGACCTGGATCTCTCTGCTATTAATGACAAAAGCATCGTCAAAAAGACGCCACAGTTAGCAAAAACAA
TATCAAAGAAACCTGAGTCAACATCATTTTCTGCCCCTCGGAAAAAGAGCCCGGATTTATCTGAAGCAATGGAAATGATGGAGTCTCAGA
CACTACTGCTGACGCTACTATCCGTAAAGATGGAGAACAATCTTGCTGAGTTTGAAAGAAGGGCAGAAAAGAATTTATTAATAATGTGTA
AGGAGAAGGAGAAGCTACAGAAAAAGGCCCACGAGCTGAAGCGCAGGCTTCTCCTCTCTCAGAGGAAGCGGGAGCTGGCAGATGTCCTGG
ATGCCCAGATCGAGATGCTCAGCCCCTTCGAGGCAGTGGCCACACGCTTCAAGGAGCAATACAGGACATTCGCCACGGCCCTGGACACTA
CCAGGCACGAGCTGCCCGTGAGGTCCATCCACCTGGAGGGAGATGGGCAGCAGCTCTTAGACGCCCTGCAGCATGAACTGGTGACCACTC
AGCGCCTCCTGGGAGAACTTGATGTTGGTGATTCGGAAGAAAATGTGCAGGTGCTGGACTTACTGAGCGAACTCAAGGACGTGACGGCGA
AAAAGGACCTTGAGCTCCGAAGGAGCTTTGCCCAGGTGCTGGAACTCTCCGCAGAGGCAAGCAAAGAGGCAGCCTTGGCAAACCAGGAAG
TCTGGGAAGAGACCCAGGGCATGGCGCCCCCCAGCCGGTGGTATTTCAATCAAGACAGTGCCTGCAGAGAATCTGGGGGAGCACCCAAGA
ACACGCCCCTGTCTGAGGACGACAACCCGGGTGCCTCGTCAGCCCCCGCTCAGGCCACGTTCATCAGCCCAAGCGAAGATTTTTCTTCAA

>In-frame_FKBP8_ENST00000222308_chr19_18652489_-_HAUS8_ENST00000448593_chr19_17184145_-_1493nt
ATGGCATCGTGTGCTGAACCCTCTGAGCCCTCTGCCCCACTGCCCGCCGGGGTCCCACCGCTCGAGGACTTCGAGGTACTGGATGGGGTT
GAGGATGCAGAGGGTGAGGAGGAAGAGGAGGAGGAAGAGGAGGAAGAGGATGACCTGAGTGAGCTGCCACCGCTGGAGGACATGGGACAA
CCCCCGGCGGAGGAGGCTGAGCAGCCTGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCATGGAGCCCGAGCCCGCCCCAGCCCCGGCCCCA
GAAGAGTGGCTGGACATTCTGGGAAGCCTGCAACCGGCCCCACAAATTCTAGCAGTGCCAAGAAGAAGGATAAAAGAGTTCAAGGTGGAA
GAGTGATTGAGTCCCGGTATCTGCAGTATGAAAAGAAGACAACCCAAAAGGCTCCTGCAGGAGATGGGTCACAGACCCGAGGGAAGATGT
CTGAAGGTGGAAGGAAATCCAGCCTGCTCCAGAAAAGCAAAGATAGCAGTGGGGTCGGAAAGGGTGACCTGCAGTCCACGTTGCTGGAAG
GGCATGGCACAGCTCCACCTGACCTGGATCTCTCTGCTATTAATGACAAAAGCATCGTCAAAAAGACGCCACAGTTAGCAAAAACAATAT
CAAAGAAACCTGAGTCAACATCATTTTCTGCCCCTCGGAAAAAGAGCCCGGATTTATCTGAAGCAATGGAAATGATGGAGTCTCAGACAC
TACTGCTGACGCTACTATCCGTAAAGATGGAGAACAATCTTGCTGAGTTTGAAAGAAGGGCAGAAAAGAATTTATTAATAATGTGTAAGG
AGAAGGAGAAGCTACAGAAAAAGGCCCACGAGCTGAAGCGCAGGCTTCTCCTCTCTCAGAGGAAGCGGGAGCTGGCAGATGTCCTGGATG
CCCAGATCGAGATGCTCAGCCCCTTCGAGGCAGTGGCCACACGCTTCAAGGAGCAATACAGGACATTCGCCACGGCCCTGGACACTACCA
GGCACGAGCTGCCCGTGAGGTCCATCCACCTGGAGGGAGATGGGCAGCAGCTCTTAGACGCCCTGCAGCATGAACTGGTGACCACTCAGC
GCCTCCTGGGAGAACTTGATGTTGGTGATTCGGAAGAAAATGTGCAGGTGCTGGACTTACTGAGCGAACTCAAGGACGTGACGGCGAAAA
AGGACCTTGAGCTCCGAAGGAGCTTTGCCCAGGTGCTGGAACTCTCCGCAGAGGCAAGCAAAGAGGCAGCCTTGGCAAACCAGGAAGTCT
GGGAAGAGACCCAGGGCATGGCGCCCCCCAGCCGGTGGTATTTCAATCAAGACAGTGCCTGCAGAGAATCTGGGGGAGCACCCAAGAACA
CGCCCCTGTCTGAGGACGACAACCCGGGTGCCTCGTCAGCCCCCGCTCAGGCCACGTTCATCAGCCCAAGCGAAGATTTTTCTTCAAGCA

>In-frame_FKBP8_ENST00000608443_chr19_18652489_-_HAUS8_ENST00000253669_chr19_17184145_-_1496nt
ATGGCATCGTGTGCTGAACCCTCTGAGCCCTCTGCCCCACTGCCCGCCGGGGTCCCACCGCTCGAGGACTTCGAGGTACTGGATGGGGTT
GAGGATGCAGAGGGTGAGGAGGAAGAGGAGGAGGAAGAGGAGGAAGAGGATGACCTGAGTGAGCTGCCACCGCTGGAGGACATGGGACAA
CCCCCGGCGGAGGAGGCTGAGCAGCCTGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCATGGAGCCCGAGCCCGCCCCAGCCCCGGCCCCA
GAAGAGTGGCTGGACATTCTGGGAAGCCTGCAACCGGCCCCACAAATTCTAGCAGTGCCAAGAAGAAGGATAAAAGAGTTCAAGGTGGAA
GAGTGATTGAGTCCCGGTATCTGCAGTATGAAAAGAAGACAACCCAAAAGGCTCCTGCAGGAGATGGGTCACAGACCCGAGGGAAGATGT
CTGAAGGTGGAAGGAAATCCAGCCTGCTCCAGAAAAGCAAAGCAGATAGCAGTGGGGTCGGAAAGGGTGACCTGCAGTCCACGTTGCTGG
AAGGGCATGGCACAGCTCCACCTGACCTGGATCTCTCTGCTATTAATGACAAAAGCATCGTCAAAAAGACGCCACAGTTAGCAAAAACAA
TATCAAAGAAACCTGAGTCAACATCATTTTCTGCCCCTCGGAAAAAGAGCCCGGATTTATCTGAAGCAATGGAAATGATGGAGTCTCAGA
CACTACTGCTGACGCTACTATCCGTAAAGATGGAGAACAATCTTGCTGAGTTTGAAAGAAGGGCAGAAAAGAATTTATTAATAATGTGTA
AGGAGAAGGAGAAGCTACAGAAAAAGGCCCACGAGCTGAAGCGCAGGCTTCTCCTCTCTCAGAGGAAGCGGGAGCTGGCAGATGTCCTGG
ATGCCCAGATCGAGATGCTCAGCCCCTTCGAGGCAGTGGCCACACGCTTCAAGGAGCAATACAGGACATTCGCCACGGCCCTGGACACTA
CCAGGCACGAGCTGCCCGTGAGGTCCATCCACCTGGAGGGAGATGGGCAGCAGCTCTTAGACGCCCTGCAGCATGAACTGGTGACCACTC
AGCGCCTCCTGGGAGAACTTGATGTTGGTGATTCGGAAGAAAATGTGCAGGTGCTGGACTTACTGAGCGAACTCAAGGACGTGACGGCGA
AAAAGGACCTTGAGCTCCGAAGGAGCTTTGCCCAGGTGCTGGAACTCTCCGCAGAGGCAAGCAAAGAGGCAGCCTTGGCAAACCAGGAAG
TCTGGGAAGAGACCCAGGGCATGGCGCCCCCCAGCCGGTGGTATTTCAATCAAGACAGTGCCTGCAGAGAATCTGGGGGAGCACCCAAGA
ACACGCCCCTGTCTGAGGACGACAACCCGGGTGCCTCGTCAGCCCCCGCTCAGGCCACGTTCATCAGCCCAAGCGAAGATTTTTCTTCAA

>In-frame_FKBP8_ENST00000608443_chr19_18652489_-_HAUS8_ENST00000448593_chr19_17184145_-_1493nt
ATGGCATCGTGTGCTGAACCCTCTGAGCCCTCTGCCCCACTGCCCGCCGGGGTCCCACCGCTCGAGGACTTCGAGGTACTGGATGGGGTT
GAGGATGCAGAGGGTGAGGAGGAAGAGGAGGAGGAAGAGGAGGAAGAGGATGACCTGAGTGAGCTGCCACCGCTGGAGGACATGGGACAA
CCCCCGGCGGAGGAGGCTGAGCAGCCTGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCATGGAGCCCGAGCCCGCCCCAGCCCCGGCCCCA
GAAGAGTGGCTGGACATTCTGGGAAGCCTGCAACCGGCCCCACAAATTCTAGCAGTGCCAAGAAGAAGGATAAAAGAGTTCAAGGTGGAA
GAGTGATTGAGTCCCGGTATCTGCAGTATGAAAAGAAGACAACCCAAAAGGCTCCTGCAGGAGATGGGTCACAGACCCGAGGGAAGATGT
CTGAAGGTGGAAGGAAATCCAGCCTGCTCCAGAAAAGCAAAGATAGCAGTGGGGTCGGAAAGGGTGACCTGCAGTCCACGTTGCTGGAAG
GGCATGGCACAGCTCCACCTGACCTGGATCTCTCTGCTATTAATGACAAAAGCATCGTCAAAAAGACGCCACAGTTAGCAAAAACAATAT
CAAAGAAACCTGAGTCAACATCATTTTCTGCCCCTCGGAAAAAGAGCCCGGATTTATCTGAAGCAATGGAAATGATGGAGTCTCAGACAC
TACTGCTGACGCTACTATCCGTAAAGATGGAGAACAATCTTGCTGAGTTTGAAAGAAGGGCAGAAAAGAATTTATTAATAATGTGTAAGG
AGAAGGAGAAGCTACAGAAAAAGGCCCACGAGCTGAAGCGCAGGCTTCTCCTCTCTCAGAGGAAGCGGGAGCTGGCAGATGTCCTGGATG
CCCAGATCGAGATGCTCAGCCCCTTCGAGGCAGTGGCCACACGCTTCAAGGAGCAATACAGGACATTCGCCACGGCCCTGGACACTACCA
GGCACGAGCTGCCCGTGAGGTCCATCCACCTGGAGGGAGATGGGCAGCAGCTCTTAGACGCCCTGCAGCATGAACTGGTGACCACTCAGC
GCCTCCTGGGAGAACTTGATGTTGGTGATTCGGAAGAAAATGTGCAGGTGCTGGACTTACTGAGCGAACTCAAGGACGTGACGGCGAAAA
AGGACCTTGAGCTCCGAAGGAGCTTTGCCCAGGTGCTGGAACTCTCCGCAGAGGCAAGCAAAGAGGCAGCCTTGGCAAACCAGGAAGTCT
GGGAAGAGACCCAGGGCATGGCGCCCCCCAGCCGGTGGTATTTCAATCAAGACAGTGCCTGCAGAGAATCTGGGGGAGCACCCAAGAACA
CGCCCCTGTCTGAGGACGACAACCCGGGTGCCTCGTCAGCCCCCGCTCAGGCCACGTTCATCAGCCCAAGCGAAGATTTTTCTTCAAGCA


* Fusion transcript sequences (Full-length transcript).
>In-frame_FKBP8_ENST00000610101_chr19_18652489_-_HAUS8_ENST00000253669_chr19_17184145_-_1753nt
GGCCGAACCTGGTTCCCGAGGCGCGGCGGCCGCGGCTGGGGGCGGGGAGGGGGGCGCAGGACCCCAAGTGGGGGTCCCGGAGCCAGAGGG
CCAATTCCTGTCCCCCCAGCAGCATGGCATCGTGTGCTGAACCCTCTGAGCCCTCTGCCCCACTGCCCGCCGGGGTCCCACCGCTCGAGG
ACTTCGAGGTACTGGATGGGGTTGAGGATGCAGAGGGTGAGGAGGAAGAGGAGGAGGAAGAGGAGGAAGAGGATGACCTGAGTGAGCTGC
CACCGCTGGAGGACATGGGACAACCCCCGGCGGAGGAGGCTGAGCAGCCTGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCATGGAGCCCG
AGCCCGCCCCAGCCCCGGCCCCAGAAGAGTGGCTGGACATTCTGGGAAGCCTGCAACCGGCCCCACAAATTCTAGCAGTGCCAAGAAGAA
GGATAAAAGAGTTCAAGGTGGAAGAGTGATTGAGTCCCGGTATCTGCAGTATGAAAAGAAGACAACCCAAAAGGCTCCTGCAGGAGATGG
GTCACAGACCCGAGGGAAGATGTCTGAAGGTGGAAGGAAATCCAGCCTGCTCCAGAAAAGCAAAGCAGATAGCAGTGGGGTCGGAAAGGG
TGACCTGCAGTCCACGTTGCTGGAAGGGCATGGCACAGCTCCACCTGACCTGGATCTCTCTGCTATTAATGACAAAAGCATCGTCAAAAA
GACGCCACAGTTAGCAAAAACAATATCAAAGAAACCTGAGTCAACATCATTTTCTGCCCCTCGGAAAAAGAGCCCGGATTTATCTGAAGC
AATGGAAATGATGGAGTCTCAGACACTACTGCTGACGCTACTATCCGTAAAGATGGAGAACAATCTTGCTGAGTTTGAAAGAAGGGCAGA
AAAGAATTTATTAATAATGTGTAAGGAGAAGGAGAAGCTACAGAAAAAGGCCCACGAGCTGAAGCGCAGGCTTCTCCTCTCTCAGAGGAA
GCGGGAGCTGGCAGATGTCCTGGATGCCCAGATCGAGATGCTCAGCCCCTTCGAGGCAGTGGCCACACGCTTCAAGGAGCAATACAGGAC
ATTCGCCACGGCCCTGGACACTACCAGGCACGAGCTGCCCGTGAGGTCCATCCACCTGGAGGGAGATGGGCAGCAGCTCTTAGACGCCCT
GCAGCATGAACTGGTGACCACTCAGCGCCTCCTGGGAGAACTTGATGTTGGTGATTCGGAAGAAAATGTGCAGGTGCTGGACTTACTGAG
CGAACTCAAGGACGTGACGGCGAAAAAGGACCTTGAGCTCCGAAGGAGCTTTGCCCAGGTGCTGGAACTCTCCGCAGAGGCAAGCAAAGA
GGCAGCCTTGGCAAACCAGGAAGTCTGGGAAGAGACCCAGGGCATGGCGCCCCCCAGCCGGTGGTATTTCAATCAAGACAGTGCCTGCAG
AGAATCTGGGGGAGCACCCAAGAACACGCCCCTGTCTGAGGACGACAACCCGGGTGCCTCGTCAGCCCCCGCTCAGGCCACGTTCATCAG
CCCAAGCGAAGATTTTTCTTCAAGCAGCCAGGCAGAAGTCCCGCCCTCTCTCTCTCGTTCAGGGAGGGACTTGTCATGACTCATGGTTAC
ATTCAGGATACTTGAGCACTTTATATACTACCGTAGCACTGTAGCTATTTTTTATGTGATAATCTTGTTTGATAAAAAAGTAAACCTGTT

>In-frame_FKBP8_ENST00000610101_chr19_18652489_-_HAUS8_ENST00000448593_chr19_17184145_-_1718nt
GGCCGAACCTGGTTCCCGAGGCGCGGCGGCCGCGGCTGGGGGCGGGGAGGGGGGCGCAGGACCCCAAGTGGGGGTCCCGGAGCCAGAGGG
CCAATTCCTGTCCCCCCAGCAGCATGGCATCGTGTGCTGAACCCTCTGAGCCCTCTGCCCCACTGCCCGCCGGGGTCCCACCGCTCGAGG
ACTTCGAGGTACTGGATGGGGTTGAGGATGCAGAGGGTGAGGAGGAAGAGGAGGAGGAAGAGGAGGAAGAGGATGACCTGAGTGAGCTGC
CACCGCTGGAGGACATGGGACAACCCCCGGCGGAGGAGGCTGAGCAGCCTGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCATGGAGCCCG
AGCCCGCCCCAGCCCCGGCCCCAGAAGAGTGGCTGGACATTCTGGGAAGCCTGCAACCGGCCCCACAAATTCTAGCAGTGCCAAGAAGAA
GGATAAAAGAGTTCAAGGTGGAAGAGTGATTGAGTCCCGGTATCTGCAGTATGAAAAGAAGACAACCCAAAAGGCTCCTGCAGGAGATGG
GTCACAGACCCGAGGGAAGATGTCTGAAGGTGGAAGGAAATCCAGCCTGCTCCAGAAAAGCAAAGATAGCAGTGGGGTCGGAAAGGGTGA
CCTGCAGTCCACGTTGCTGGAAGGGCATGGCACAGCTCCACCTGACCTGGATCTCTCTGCTATTAATGACAAAAGCATCGTCAAAAAGAC
GCCACAGTTAGCAAAAACAATATCAAAGAAACCTGAGTCAACATCATTTTCTGCCCCTCGGAAAAAGAGCCCGGATTTATCTGAAGCAAT
GGAAATGATGGAGTCTCAGACACTACTGCTGACGCTACTATCCGTAAAGATGGAGAACAATCTTGCTGAGTTTGAAAGAAGGGCAGAAAA
GAATTTATTAATAATGTGTAAGGAGAAGGAGAAGCTACAGAAAAAGGCCCACGAGCTGAAGCGCAGGCTTCTCCTCTCTCAGAGGAAGCG
GGAGCTGGCAGATGTCCTGGATGCCCAGATCGAGATGCTCAGCCCCTTCGAGGCAGTGGCCACACGCTTCAAGGAGCAATACAGGACATT
CGCCACGGCCCTGGACACTACCAGGCACGAGCTGCCCGTGAGGTCCATCCACCTGGAGGGAGATGGGCAGCAGCTCTTAGACGCCCTGCA
GCATGAACTGGTGACCACTCAGCGCCTCCTGGGAGAACTTGATGTTGGTGATTCGGAAGAAAATGTGCAGGTGCTGGACTTACTGAGCGA
ACTCAAGGACGTGACGGCGAAAAAGGACCTTGAGCTCCGAAGGAGCTTTGCCCAGGTGCTGGAACTCTCCGCAGAGGCAAGCAAAGAGGC
AGCCTTGGCAAACCAGGAAGTCTGGGAAGAGACCCAGGGCATGGCGCCCCCCAGCCGGTGGTATTTCAATCAAGACAGTGCCTGCAGAGA
ATCTGGGGGAGCACCCAAGAACACGCCCCTGTCTGAGGACGACAACCCGGGTGCCTCGTCAGCCCCCGCTCAGGCCACGTTCATCAGCCC
AAGCGAAGATTTTTCTTCAAGCAGCCAGGCAGAAGTCCCGCCCTCTCTCTCTCGTTCAGGGAGGGACTTGTCATGACTCATGGTTACATT
CAGGATACTTGAGCACTTTATATACTACCGTAGCACTGTAGCTATTTTTTATGTGATAATCTTGTTTGATAAAAAAGTAAACCTGTTTTG

>In-frame_FKBP8_ENST00000222308_chr19_18652489_-_HAUS8_ENST00000253669_chr19_17184145_-_1704nt
GGGGGCGCAGGACCCCAAGTGGGGGTCCCGGAGCCAGAGGGCCAATTCCTGTCCCCCCAGCAGCATGGCATCGTGTGCTGAACCCTCTGA
GCCCTCTGCCCCACTGCCCGCCGGGGTCCCACCGCTCGAGGACTTCGAGGTACTGGATGGGGTTGAGGATGCAGAGGGTGAGGAGGAAGA
GGAGGAGGAAGAGGAGGAAGAGGATGACCTGAGTGAGCTGCCACCGCTGGAGGACATGGGACAACCCCCGGCGGAGGAGGCTGAGCAGCC
TGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCATGGAGCCCGAGCCCGCCCCAGCCCCGGCCCCAGAAGAGTGGCTGGACATTCTGGGAAG
CCTGCAACCGGCCCCACAAATTCTAGCAGTGCCAAGAAGAAGGATAAAAGAGTTCAAGGTGGAAGAGTGATTGAGTCCCGGTATCTGCAG
TATGAAAAGAAGACAACCCAAAAGGCTCCTGCAGGAGATGGGTCACAGACCCGAGGGAAGATGTCTGAAGGTGGAAGGAAATCCAGCCTG
CTCCAGAAAAGCAAAGCAGATAGCAGTGGGGTCGGAAAGGGTGACCTGCAGTCCACGTTGCTGGAAGGGCATGGCACAGCTCCACCTGAC
CTGGATCTCTCTGCTATTAATGACAAAAGCATCGTCAAAAAGACGCCACAGTTAGCAAAAACAATATCAAAGAAACCTGAGTCAACATCA
TTTTCTGCCCCTCGGAAAAAGAGCCCGGATTTATCTGAAGCAATGGAAATGATGGAGTCTCAGACACTACTGCTGACGCTACTATCCGTA
AAGATGGAGAACAATCTTGCTGAGTTTGAAAGAAGGGCAGAAAAGAATTTATTAATAATGTGTAAGGAGAAGGAGAAGCTACAGAAAAAG
GCCCACGAGCTGAAGCGCAGGCTTCTCCTCTCTCAGAGGAAGCGGGAGCTGGCAGATGTCCTGGATGCCCAGATCGAGATGCTCAGCCCC
TTCGAGGCAGTGGCCACACGCTTCAAGGAGCAATACAGGACATTCGCCACGGCCCTGGACACTACCAGGCACGAGCTGCCCGTGAGGTCC
ATCCACCTGGAGGGAGATGGGCAGCAGCTCTTAGACGCCCTGCAGCATGAACTGGTGACCACTCAGCGCCTCCTGGGAGAACTTGATGTT
GGTGATTCGGAAGAAAATGTGCAGGTGCTGGACTTACTGAGCGAACTCAAGGACGTGACGGCGAAAAAGGACCTTGAGCTCCGAAGGAGC
TTTGCCCAGGTGCTGGAACTCTCCGCAGAGGCAAGCAAAGAGGCAGCCTTGGCAAACCAGGAAGTCTGGGAAGAGACCCAGGGCATGGCG
CCCCCCAGCCGGTGGTATTTCAATCAAGACAGTGCCTGCAGAGAATCTGGGGGAGCACCCAAGAACACGCCCCTGTCTGAGGACGACAAC
CCGGGTGCCTCGTCAGCCCCCGCTCAGGCCACGTTCATCAGCCCAAGCGAAGATTTTTCTTCAAGCAGCCAGGCAGAAGTCCCGCCCTCT
CTCTCTCGTTCAGGGAGGGACTTGTCATGACTCATGGTTACATTCAGGATACTTGAGCACTTTATATACTACCGTAGCACTGTAGCTATT

>In-frame_FKBP8_ENST00000222308_chr19_18652489_-_HAUS8_ENST00000448593_chr19_17184145_-_1669nt
GGGGGCGCAGGACCCCAAGTGGGGGTCCCGGAGCCAGAGGGCCAATTCCTGTCCCCCCAGCAGCATGGCATCGTGTGCTGAACCCTCTGA
GCCCTCTGCCCCACTGCCCGCCGGGGTCCCACCGCTCGAGGACTTCGAGGTACTGGATGGGGTTGAGGATGCAGAGGGTGAGGAGGAAGA
GGAGGAGGAAGAGGAGGAAGAGGATGACCTGAGTGAGCTGCCACCGCTGGAGGACATGGGACAACCCCCGGCGGAGGAGGCTGAGCAGCC
TGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCATGGAGCCCGAGCCCGCCCCAGCCCCGGCCCCAGAAGAGTGGCTGGACATTCTGGGAAG
CCTGCAACCGGCCCCACAAATTCTAGCAGTGCCAAGAAGAAGGATAAAAGAGTTCAAGGTGGAAGAGTGATTGAGTCCCGGTATCTGCAG
TATGAAAAGAAGACAACCCAAAAGGCTCCTGCAGGAGATGGGTCACAGACCCGAGGGAAGATGTCTGAAGGTGGAAGGAAATCCAGCCTG
CTCCAGAAAAGCAAAGATAGCAGTGGGGTCGGAAAGGGTGACCTGCAGTCCACGTTGCTGGAAGGGCATGGCACAGCTCCACCTGACCTG
GATCTCTCTGCTATTAATGACAAAAGCATCGTCAAAAAGACGCCACAGTTAGCAAAAACAATATCAAAGAAACCTGAGTCAACATCATTT
TCTGCCCCTCGGAAAAAGAGCCCGGATTTATCTGAAGCAATGGAAATGATGGAGTCTCAGACACTACTGCTGACGCTACTATCCGTAAAG
ATGGAGAACAATCTTGCTGAGTTTGAAAGAAGGGCAGAAAAGAATTTATTAATAATGTGTAAGGAGAAGGAGAAGCTACAGAAAAAGGCC
CACGAGCTGAAGCGCAGGCTTCTCCTCTCTCAGAGGAAGCGGGAGCTGGCAGATGTCCTGGATGCCCAGATCGAGATGCTCAGCCCCTTC
GAGGCAGTGGCCACACGCTTCAAGGAGCAATACAGGACATTCGCCACGGCCCTGGACACTACCAGGCACGAGCTGCCCGTGAGGTCCATC
CACCTGGAGGGAGATGGGCAGCAGCTCTTAGACGCCCTGCAGCATGAACTGGTGACCACTCAGCGCCTCCTGGGAGAACTTGATGTTGGT
GATTCGGAAGAAAATGTGCAGGTGCTGGACTTACTGAGCGAACTCAAGGACGTGACGGCGAAAAAGGACCTTGAGCTCCGAAGGAGCTTT
GCCCAGGTGCTGGAACTCTCCGCAGAGGCAAGCAAAGAGGCAGCCTTGGCAAACCAGGAAGTCTGGGAAGAGACCCAGGGCATGGCGCCC
CCCAGCCGGTGGTATTTCAATCAAGACAGTGCCTGCAGAGAATCTGGGGGAGCACCCAAGAACACGCCCCTGTCTGAGGACGACAACCCG
GGTGCCTCGTCAGCCCCCGCTCAGGCCACGTTCATCAGCCCAAGCGAAGATTTTTCTTCAAGCAGCCAGGCAGAAGTCCCGCCCTCTCTC
TCTCGTTCAGGGAGGGACTTGTCATGACTCATGGTTACATTCAGGATACTTGAGCACTTTATATACTACCGTAGCACTGTAGCTATTTTT

>In-frame_FKBP8_ENST00000608443_chr19_18652489_-_HAUS8_ENST00000253669_chr19_17184145_-_1840nt
ACGCCCGGGACGGACGTCTGCATGAGCCAACGGGTGCGGCAGTCGCGGCAGCGGCGGCCAATGGGCACGGCAGGGGCGGGGCCAAGCGGC
CGAACCTGGTTCCCGAGGCGCGGCGGCCGCGGCTGGGGGCGGGGAGGGGGGCGCAGGACCCCAAGTGGGGGTCCCGGAGCCAGAGGGCCA
ATTCCTGTCCCCCCAGCAGCATGGCATCGTGTGCTGAACCCTCTGAGCCCTCTGCCCCACTGCCCGCCGGGGTCCCACCGCTCGAGGACT
TCGAGGTACTGGATGGGGTTGAGGATGCAGAGGGTGAGGAGGAAGAGGAGGAGGAAGAGGAGGAAGAGGATGACCTGAGTGAGCTGCCAC
CGCTGGAGGACATGGGACAACCCCCGGCGGAGGAGGCTGAGCAGCCTGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCATGGAGCCCGAGC
CCGCCCCAGCCCCGGCCCCAGAAGAGTGGCTGGACATTCTGGGAAGCCTGCAACCGGCCCCACAAATTCTAGCAGTGCCAAGAAGAAGGA
TAAAAGAGTTCAAGGTGGAAGAGTGATTGAGTCCCGGTATCTGCAGTATGAAAAGAAGACAACCCAAAAGGCTCCTGCAGGAGATGGGTC
ACAGACCCGAGGGAAGATGTCTGAAGGTGGAAGGAAATCCAGCCTGCTCCAGAAAAGCAAAGCAGATAGCAGTGGGGTCGGAAAGGGTGA
CCTGCAGTCCACGTTGCTGGAAGGGCATGGCACAGCTCCACCTGACCTGGATCTCTCTGCTATTAATGACAAAAGCATCGTCAAAAAGAC
GCCACAGTTAGCAAAAACAATATCAAAGAAACCTGAGTCAACATCATTTTCTGCCCCTCGGAAAAAGAGCCCGGATTTATCTGAAGCAAT
GGAAATGATGGAGTCTCAGACACTACTGCTGACGCTACTATCCGTAAAGATGGAGAACAATCTTGCTGAGTTTGAAAGAAGGGCAGAAAA
GAATTTATTAATAATGTGTAAGGAGAAGGAGAAGCTACAGAAAAAGGCCCACGAGCTGAAGCGCAGGCTTCTCCTCTCTCAGAGGAAGCG
GGAGCTGGCAGATGTCCTGGATGCCCAGATCGAGATGCTCAGCCCCTTCGAGGCAGTGGCCACACGCTTCAAGGAGCAATACAGGACATT
CGCCACGGCCCTGGACACTACCAGGCACGAGCTGCCCGTGAGGTCCATCCACCTGGAGGGAGATGGGCAGCAGCTCTTAGACGCCCTGCA
GCATGAACTGGTGACCACTCAGCGCCTCCTGGGAGAACTTGATGTTGGTGATTCGGAAGAAAATGTGCAGGTGCTGGACTTACTGAGCGA
ACTCAAGGACGTGACGGCGAAAAAGGACCTTGAGCTCCGAAGGAGCTTTGCCCAGGTGCTGGAACTCTCCGCAGAGGCAAGCAAAGAGGC
AGCCTTGGCAAACCAGGAAGTCTGGGAAGAGACCCAGGGCATGGCGCCCCCCAGCCGGTGGTATTTCAATCAAGACAGTGCCTGCAGAGA
ATCTGGGGGAGCACCCAAGAACACGCCCCTGTCTGAGGACGACAACCCGGGTGCCTCGTCAGCCCCCGCTCAGGCCACGTTCATCAGCCC
AAGCGAAGATTTTTCTTCAAGCAGCCAGGCAGAAGTCCCGCCCTCTCTCTCTCGTTCAGGGAGGGACTTGTCATGACTCATGGTTACATT
CAGGATACTTGAGCACTTTATATACTACCGTAGCACTGTAGCTATTTTTTATGTGATAATCTTGTTTGATAAAAAAGTAAACCTGTTTTG

>In-frame_FKBP8_ENST00000608443_chr19_18652489_-_HAUS8_ENST00000448593_chr19_17184145_-_1805nt
ACGCCCGGGACGGACGTCTGCATGAGCCAACGGGTGCGGCAGTCGCGGCAGCGGCGGCCAATGGGCACGGCAGGGGCGGGGCCAAGCGGC
CGAACCTGGTTCCCGAGGCGCGGCGGCCGCGGCTGGGGGCGGGGAGGGGGGCGCAGGACCCCAAGTGGGGGTCCCGGAGCCAGAGGGCCA
ATTCCTGTCCCCCCAGCAGCATGGCATCGTGTGCTGAACCCTCTGAGCCCTCTGCCCCACTGCCCGCCGGGGTCCCACCGCTCGAGGACT
TCGAGGTACTGGATGGGGTTGAGGATGCAGAGGGTGAGGAGGAAGAGGAGGAGGAAGAGGAGGAAGAGGATGACCTGAGTGAGCTGCCAC
CGCTGGAGGACATGGGACAACCCCCGGCGGAGGAGGCTGAGCAGCCTGGGGCCCTGGCCCGAGAGTTCCTTGCTGCCATGGAGCCCGAGC
CCGCCCCAGCCCCGGCCCCAGAAGAGTGGCTGGACATTCTGGGAAGCCTGCAACCGGCCCCACAAATTCTAGCAGTGCCAAGAAGAAGGA
TAAAAGAGTTCAAGGTGGAAGAGTGATTGAGTCCCGGTATCTGCAGTATGAAAAGAAGACAACCCAAAAGGCTCCTGCAGGAGATGGGTC
ACAGACCCGAGGGAAGATGTCTGAAGGTGGAAGGAAATCCAGCCTGCTCCAGAAAAGCAAAGATAGCAGTGGGGTCGGAAAGGGTGACCT
GCAGTCCACGTTGCTGGAAGGGCATGGCACAGCTCCACCTGACCTGGATCTCTCTGCTATTAATGACAAAAGCATCGTCAAAAAGACGCC
ACAGTTAGCAAAAACAATATCAAAGAAACCTGAGTCAACATCATTTTCTGCCCCTCGGAAAAAGAGCCCGGATTTATCTGAAGCAATGGA
AATGATGGAGTCTCAGACACTACTGCTGACGCTACTATCCGTAAAGATGGAGAACAATCTTGCTGAGTTTGAAAGAAGGGCAGAAAAGAA
TTTATTAATAATGTGTAAGGAGAAGGAGAAGCTACAGAAAAAGGCCCACGAGCTGAAGCGCAGGCTTCTCCTCTCTCAGAGGAAGCGGGA
GCTGGCAGATGTCCTGGATGCCCAGATCGAGATGCTCAGCCCCTTCGAGGCAGTGGCCACACGCTTCAAGGAGCAATACAGGACATTCGC
CACGGCCCTGGACACTACCAGGCACGAGCTGCCCGTGAGGTCCATCCACCTGGAGGGAGATGGGCAGCAGCTCTTAGACGCCCTGCAGCA
TGAACTGGTGACCACTCAGCGCCTCCTGGGAGAACTTGATGTTGGTGATTCGGAAGAAAATGTGCAGGTGCTGGACTTACTGAGCGAACT
CAAGGACGTGACGGCGAAAAAGGACCTTGAGCTCCGAAGGAGCTTTGCCCAGGTGCTGGAACTCTCCGCAGAGGCAAGCAAAGAGGCAGC
CTTGGCAAACCAGGAAGTCTGGGAAGAGACCCAGGGCATGGCGCCCCCCAGCCGGTGGTATTTCAATCAAGACAGTGCCTGCAGAGAATC
TGGGGGAGCACCCAAGAACACGCCCCTGTCTGAGGACGACAACCCGGGTGCCTCGTCAGCCCCCGCTCAGGCCACGTTCATCAGCCCAAG
CGAAGATTTTTCTTCAAGCAGCCAGGCAGAAGTCCCGCCCTCTCTCTCTCGTTCAGGGAGGGACTTGTCATGACTCATGGTTACATTCAG
GATACTTGAGCACTTTATATACTACCGTAGCACTGTAGCTATTTTTTATGTGATAATCTTGTTTGATAAAAAAGTAAACCTGTTTTGCAA


Top

FusionGenePPI for FKBP8_HAUS8


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
FKBP8BCL2, BCL2L1, USP19, BRE, EGFR, HSP90AA1, CALM1, PSMC1, PSMC2, PSMC3, PSMC4, PSMC5, PSMC6, PSMD1, PSMD2, PSMD3, PSMD4, PSMD6, PSMD7, PSMD11, PSMD12, PSMD13, PSMD14, PSMA1, PSMA2, PSMA3, PSMA4, PSMA5, PSMA6, PSMA7, PSMB1, PSMB2, PSMB3, PSMB5, PSMB7, ADRM1, PTPRK, UBC, TERF1, EGLN1, CUL3, VHL, ATP13A2, SURF1, MRPL11, YME1L1, UQCRC1, UQCRC2, MRPL15, SSR1, UQCRFS1, PGRMC1, DHODH, NDUFB10, TOMM22, ABCC1, NNT, KCNH2, FKBP8, CAMK2A, CLN3, ADRB2, BNIPL, ARHGEF5, CDK20, PDCL, SUGT1, PTGES3, CACYBP, HSPBP1, RHEB, MTOR, MLST8, RPTOR, RICTOR, CCDC8, RPS6KB2, ABCB7, TCTN2, TCTN3, EVC2, TMEM216, MLH1, XRCC3, VAPA, ATP6AP2, COQ9, TMEM258, CLCN1, CUL4A, CUL4B, MTMR11, PTPMT1, ANKMY2HAUS8HAUS6, HAUS5, APP, MLF1, HAUS7, DNM3, VPS28, HSPB1, CCDC14, MED4, AHI1, SSX2IP, OFD1, PCM1, MKS1, CC2D2A, CEP97, CEP170, KIAA0753, CEP104, CEP162, CEP290, CEP120, CEP152, FGFR1OP, SPICE1, CEP128, CEP135, CEP44, CEP63, CEP89, CNTRL, FBF1, NIN, ODF2, RPGRIP1L, DCTN1, POC5, LCA5, SASS6, RPGRIP1, CENPJ, XPO1, HAUS2, CDC16, BNIP1, MTMR12, HYLS1, OLFM2, RANBP10


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for FKBP8_HAUS8


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for FKBP8_HAUS8


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource