FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 13432

FusionGeneSummary for FGG_HP

check button Fusion gene summary
Fusion gene informationFusion gene name: FGG_HP
Fusion gene ID: 13432
HgeneTgene
Gene symbol

FGG

HP

Gene ID

2266

10395

Gene namefibrinogen gamma chainDLC1 Rho GTPase activating protein
Synonyms-ARHGAP7|HP|STARD12|p122-RhoGAP
Cytomap

4q32.1

8p22

Type of geneprotein-codingprotein-coding
Descriptionfibrinogen gamma chainfibrinogen, gamma polypeptidetesticular tissue protein Li 70rho GTPase-activating protein 7Rho-GTPase-activating protein 7START domain-containing protein 12StAR-related lipid transfer (START) domain containing 12deleted in liver cancer 1 proteindeleted in liver cancer 1 variant 2deleted in liver cancer varia
Modification date2018051920180519
UniProtAcc

P02679

P00738

Ensembl transtripts involved in fusion geneENST00000404648, ENST00000405164, 
ENST00000336098, ENST00000407946, 
ENST00000570083, ENST00000355906, 
ENST00000398131, ENST00000569639, 
ENST00000357763, ENST00000562526, 
ENST00000565574, 
Fusion gene scores* DoF score4 X 4 X 2=326 X 4 X 1=24
# samples 46
** MAII scorelog2(4/32*10)=0.321928094887362
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(6/24*10)=1.32192809488736
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: FGG [Title/Abstract] AND HP [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneFGG

GO:0007160

cell-matrix adhesion

10903502

HgeneFGG

GO:0031639

plasminogen activation

16846481

HgeneFGG

GO:0034116

positive regulation of heterotypic cell-cell adhesion

8100742

HgeneFGG

GO:0034622

cellular protein-containing complex assembly

8910396

HgeneFGG

GO:0042730

fibrinolysis

16846481

HgeneFGG

GO:0045907

positive regulation of vasoconstriction

15739255

HgeneFGG

GO:0045921

positive regulation of exocytosis

19193866

HgeneFGG

GO:0050714

positive regulation of protein secretion

19193866

HgeneFGG

GO:0051592

response to calcium ion

6777381

HgeneFGG

GO:0070374

positive regulation of ERK1 and ERK2 cascade

10903502|19193866

HgeneFGG

GO:0070527

platelet aggregation

6281794

HgeneFGG

GO:0072378

blood coagulation, fibrin clot formation

16846481

HgeneFGG

GO:0090277

positive regulation of peptide hormone secretion

19193866

HgeneFGG

GO:1902042

negative regulation of extrinsic apoptotic signaling pathway via death domain receptors

10903502

HgeneFGG

GO:2000352

negative regulation of endothelial cell apoptotic process

10903502

TgeneHP

GO:0006915

apoptotic process

17292327

TgeneHP

GO:0006919

activation of cysteine-type endopeptidase activity involved in apoptotic process

17888903

TgeneHP

GO:0008285

negative regulation of cell proliferation

12545165|17932950

TgeneHP

GO:0030336

negative regulation of cell migration

17932950|19158340

TgeneHP

GO:0035307

positive regulation of protein dephosphorylation

17292327

TgeneHP

GO:0051497

negative regulation of stress fiber assembly

17932950

TgeneHP

GO:0051895

negative regulation of focal adhesion assembly

19158340

TgeneHP

GO:1900119

positive regulation of execution phase of apoptosis

17888903


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDLIHCTCGA-BD-A3ER-01AFGGchr4

155527857

-HPchr16

72094131

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shiftENST00000404648ENST00000570083FGGchr4

155527857

-HPchr16

72094131

+
In-frameENST00000404648ENST00000355906FGGchr4

155527857

-HPchr16

72094131

+
In-frameENST00000404648ENST00000398131FGGchr4

155527857

-HPchr16

72094131

+
5CDS-intronENST00000404648ENST00000569639FGGchr4

155527857

-HPchr16

72094131

+
5CDS-intronENST00000404648ENST00000357763FGGchr4

155527857

-HPchr16

72094131

+
5CDS-intronENST00000404648ENST00000562526FGGchr4

155527857

-HPchr16

72094131

+
5CDS-intronENST00000404648ENST00000565574FGGchr4

155527857

-HPchr16

72094131

+
Frame-shiftENST00000405164ENST00000570083FGGchr4

155527857

-HPchr16

72094131

+
In-frameENST00000405164ENST00000355906FGGchr4

155527857

-HPchr16

72094131

+
In-frameENST00000405164ENST00000398131FGGchr4

155527857

-HPchr16

72094131

+
5CDS-intronENST00000405164ENST00000569639FGGchr4

155527857

-HPchr16

72094131

+
5CDS-intronENST00000405164ENST00000357763FGGchr4

155527857

-HPchr16

72094131

+
5CDS-intronENST00000405164ENST00000562526FGGchr4

155527857

-HPchr16

72094131

+
5CDS-intronENST00000405164ENST00000565574FGGchr4

155527857

-HPchr16

72094131

+
Frame-shiftENST00000336098ENST00000570083FGGchr4

155527857

-HPchr16

72094131

+
In-frameENST00000336098ENST00000355906FGGchr4

155527857

-HPchr16

72094131

+
In-frameENST00000336098ENST00000398131FGGchr4

155527857

-HPchr16

72094131

+
5CDS-intronENST00000336098ENST00000569639FGGchr4

155527857

-HPchr16

72094131

+
5CDS-intronENST00000336098ENST00000357763FGGchr4

155527857

-HPchr16

72094131

+
5CDS-intronENST00000336098ENST00000562526FGGchr4

155527857

-HPchr16

72094131

+
5CDS-intronENST00000336098ENST00000565574FGGchr4

155527857

-HPchr16

72094131

+
Frame-shiftENST00000407946ENST00000570083FGGchr4

155527857

-HPchr16

72094131

+
In-frameENST00000407946ENST00000355906FGGchr4

155527857

-HPchr16

72094131

+
In-frameENST00000407946ENST00000398131FGGchr4

155527857

-HPchr16

72094131

+
5CDS-intronENST00000407946ENST00000569639FGGchr4

155527857

-HPchr16

72094131

+
5CDS-intronENST00000407946ENST00000357763FGGchr4

155527857

-HPchr16

72094131

+
5CDS-intronENST00000407946ENST00000562526FGGchr4

155527857

-HPchr16

72094131

+
5CDS-intronENST00000407946ENST00000565574FGGchr4

155527857

-HPchr16

72094131

+

Top

FusionProtFeatures for FGG_HP


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
FGG

P02679

HP

P00738


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for FGG_HP


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_FGG_ENST00000404648_chr4_155527857_-_HP_ENST00000355906_chr16_72094131_+_431aa
MSWSLHPRNLILYFYALLFLSSTCVAYVATRDNCCILDERFGSYCPTTCGIADFLSTYQTKVDKDLQSLEDILHQVENKTSEVKQLIKAI
QLTYNPDESSKPNMIDAATLKSRKMLEEIMKYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQ
DIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPY
ALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGW

>In-frame_FGG_ENST00000404648_chr4_155527857_-_HP_ENST00000398131_chr16_72094131_+_431aa
MSWSLHPRNLILYFYALLFLSSTCVAYVATRDNCCILDERFGSYCPTTCGIADFLSTYQTKVDKDLQSLEDILHQVENKTSEVKQLIKAI
QLTYNPDESSKPNMIDAATLKSRKMLEEIMKYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQ
DIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPY
ALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGW

>In-frame_FGG_ENST00000405164_chr4_155527857_-_HP_ENST00000355906_chr16_72094131_+_439aa
MSWSLHPRNLILYFYALLFLSSTCVAYVATRDNCCILDERFGSYCPTTCGIADFLSTYQTKVDKDLQSLEDILHQVENKTSEVKQLIKAI
QLTYNPDESSKPNMIDAATLKSRKMLEEIMKYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKVKV
DSPSLDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLI
STQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNC

>In-frame_FGG_ENST00000405164_chr4_155527857_-_HP_ENST00000398131_chr16_72094131_+_439aa
MSWSLHPRNLILYFYALLFLSSTCVAYVATRDNCCILDERFGSYCPTTCGIADFLSTYQTKVDKDLQSLEDILHQVENKTSEVKQLIKAI
QLTYNPDESSKPNMIDAATLKSRKMLEEIMKYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKVKV
DSPSLDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLI
STQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNC

>In-frame_FGG_ENST00000336098_chr4_155527857_-_HP_ENST00000355906_chr16_72094131_+_431aa
MSWSLHPRNLILYFYALLFLSSTCVAYVATRDNCCILDERFGSYCPTTCGIADFLSTYQTKVDKDLQSLEDILHQVENKTSEVKQLIKAI
QLTYNPDESSKPNMIDAATLKSRKMLEEIMKYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQ
DIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPY
ALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGW

>In-frame_FGG_ENST00000336098_chr4_155527857_-_HP_ENST00000398131_chr16_72094131_+_431aa
MSWSLHPRNLILYFYALLFLSSTCVAYVATRDNCCILDERFGSYCPTTCGIADFLSTYQTKVDKDLQSLEDILHQVENKTSEVKQLIKAI
QLTYNPDESSKPNMIDAATLKSRKMLEEIMKYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKDCQ
DIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISTQSAIPY
ALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNCAEQDGSGW

>In-frame_FGG_ENST00000407946_chr4_155527857_-_HP_ENST00000355906_chr16_72094131_+_439aa
MSWSLHPRNLILYFYALLFLSSTCVAYVATRDNCCILDERFGSYCPTTCGIADFLSTYQTKVDKDLQSLEDILHQVENKTSEVKQLIKAI
QLTYNPDESSKPNMIDAATLKSRKMLEEIMKYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKVKV
DSPSLDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLI
STQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNC

>In-frame_FGG_ENST00000407946_chr4_155527857_-_HP_ENST00000398131_chr16_72094131_+_439aa
MSWSLHPRNLILYFYALLFLSSTCVAYVATRDNCCILDERFGSYCPTTCGIADFLSTYQTKVDKDLQSLEDILHQVENKTSEVKQLIKAI
QLTYNPDESSKPNMIDAATLKSRKMLEEIMKYEASILTHDSSIRYLQEIYNSNNQKIVNLKEKVAQLEAQCQEPCKDTVQIHDITGKVKV
DSPSLDCQDIANKGAKQSGLYFIKPLKANQQFLVYCEIDGSGNGWTVFQKRLDGSVDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLI
STQSAIPYALRVELEDWNGRTSTADYAMFKVGPEADKYRLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEGNC


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_FGG_ENST00000404648_chr4_155527857_-_HP_ENST00000355906_chr16_72094131_+_1293nt
ATGAGTTGGTCCTTGCACCCCCGGAATTTAATTCTCTACTTCTATGCTCTTTTATTTCTCTCTTCAACATGTGTAGCATATGTTGCTACC
AGAGACAACTGCTGCATCTTAGATGAAAGATTCGGTAGTTATTGTCCAACTACCTGTGGCATTGCAGATTTCCTGTCTACTTATCAAACC
AAAGTAGACAAGGATCTACAGTCTTTGGAAGACATCTTACATCAAGTTGAAAACAAAACATCAGAAGTCAAACAGCTGATAAAAGCAATC
CAACTCACTTATAATCCTGATGAATCATCAAAACCAAATATGATAGACGCTGCTACTTTGAAGTCCAGGAAAATGTTAGAAGAAATTATG
AAATATGAAGCATCGATTTTAACACATGACTCAAGTATTCGATATTTGCAGGAAATATATAATTCAAATAATCAAAAGATTGTTAACCTG
AAAGAGAAGGTAGCCCAGCTTGAAGCACAGTGCCAGGAACCTTGCAAAGACACGGTGCAAATCCATGATATCACTGGGAAAGATTGTCAA
GACATTGCCAATAAGGGAGCTAAACAGAGCGGGCTTTACTTTATTAAACCTCTGAAAGCTAACCAGCAATTCTTAGTCTACTGTGAAATC
GATGGGTCTGGAAATGGATGGACTGTGTTTCAGAAGAGACTTGATGGCAGTGTAGATTTCAAGAAAAACTGGATTCAATATAAAGAAGGA
TTTGGACATCTGTCTCCTACTGGCACAACAGAATTTTGGCTGGGAAATGAGAAGATTCATTTGATAAGCACACAGTCTGCCATCCCATAT
GCATTAAGAGTGGAACTGGAAGACTGGAATGGCAGAACCAGTACTGCAGACTATGCCATGTTCAAGGTGGGACCTGAAGCTGACAAGTAC
CGCCTAACATATGCCTACTTCGCTGGTGGGGATGCTGGAGATGCCTTTGATGGCTTTGATTTTGGCGATGATCCTAGTGACAAGTTTTTC
ACATCCCATAATGGCATGCAGTTCAGTACCTGGGACAATGACAATGATAAGTTTGAAGGCAACTGTGCTGAACAGGATGGATCTGGTTGG
TGGATGAACAAGTGTCACGCTGGCCATCTCAATGGAGTTTATTACCAAGTGCAAGGCTGGCCGGAAGCCCTTGCCTGAAAGCAAGATTTC
AGCCTGGAAGAGGGCAAAGTGGACGGGAGTGGACAGGAGTGGATGCGATAAGATGTGGTTTGAAGCTGATGGGTGCCAGCCCTGCATTGC

>In-frame_FGG_ENST00000404648_chr4_155527857_-_HP_ENST00000398131_chr16_72094131_+_1293nt
ATGAGTTGGTCCTTGCACCCCCGGAATTTAATTCTCTACTTCTATGCTCTTTTATTTCTCTCTTCAACATGTGTAGCATATGTTGCTACC
AGAGACAACTGCTGCATCTTAGATGAAAGATTCGGTAGTTATTGTCCAACTACCTGTGGCATTGCAGATTTCCTGTCTACTTATCAAACC
AAAGTAGACAAGGATCTACAGTCTTTGGAAGACATCTTACATCAAGTTGAAAACAAAACATCAGAAGTCAAACAGCTGATAAAAGCAATC
CAACTCACTTATAATCCTGATGAATCATCAAAACCAAATATGATAGACGCTGCTACTTTGAAGTCCAGGAAAATGTTAGAAGAAATTATG
AAATATGAAGCATCGATTTTAACACATGACTCAAGTATTCGATATTTGCAGGAAATATATAATTCAAATAATCAAAAGATTGTTAACCTG
AAAGAGAAGGTAGCCCAGCTTGAAGCACAGTGCCAGGAACCTTGCAAAGACACGGTGCAAATCCATGATATCACTGGGAAAGATTGTCAA
GACATTGCCAATAAGGGAGCTAAACAGAGCGGGCTTTACTTTATTAAACCTCTGAAAGCTAACCAGCAATTCTTAGTCTACTGTGAAATC
GATGGGTCTGGAAATGGATGGACTGTGTTTCAGAAGAGACTTGATGGCAGTGTAGATTTCAAGAAAAACTGGATTCAATATAAAGAAGGA
TTTGGACATCTGTCTCCTACTGGCACAACAGAATTTTGGCTGGGAAATGAGAAGATTCATTTGATAAGCACACAGTCTGCCATCCCATAT
GCATTAAGAGTGGAACTGGAAGACTGGAATGGCAGAACCAGTACTGCAGACTATGCCATGTTCAAGGTGGGACCTGAAGCTGACAAGTAC
CGCCTAACATATGCCTACTTCGCTGGTGGGGATGCTGGAGATGCCTTTGATGGCTTTGATTTTGGCGATGATCCTAGTGACAAGTTTTTC
ACATCCCATAATGGCATGCAGTTCAGTACCTGGGACAATGACAATGATAAGTTTGAAGGCAACTGTGCTGAACAGGATGGATCTGGTTGG
TGGATGAACAAGTGTCACGCTGGCCATCTCAATGGAGTTTATTACCAAGTGCAAGGCTGGCCGGAAGCCCTTGCCTGAAAGCAAGATTTC
AGCCTGGAAGAGGGCAAAGTGGACGGGAGTGGACAGGAGTGGATGCGATAAGATGTGGTTTGAAGCTGATGGGTGCCAGCCCTGCATTGC

>In-frame_FGG_ENST00000405164_chr4_155527857_-_HP_ENST00000355906_chr16_72094131_+_1317nt
ATGAGTTGGTCCTTGCACCCCCGGAATTTAATTCTCTACTTCTATGCTCTTTTATTTCTCTCTTCAACATGTGTAGCATATGTTGCTACC
AGAGACAACTGCTGCATCTTAGATGAAAGATTCGGTAGTTATTGTCCAACTACCTGTGGCATTGCAGATTTCCTGTCTACTTATCAAACC
AAAGTAGACAAGGATCTACAGTCTTTGGAAGACATCTTACATCAAGTTGAAAACAAAACATCAGAAGTCAAACAGCTGATAAAAGCAATC
CAACTCACTTATAATCCTGATGAATCATCAAAACCAAATATGATAGACGCTGCTACTTTGAAGTCCAGGAAAATGTTAGAAGAAATTATG
AAATATGAAGCATCGATTTTAACACATGACTCAAGTATTCGATATTTGCAGGAAATATATAATTCAAATAATCAAAAGATTGTTAACCTG
AAAGAGAAGGTAGCCCAGCTTGAAGCACAGTGCCAGGAACCTTGCAAAGACACGGTGCAAATCCATGATATCACTGGGAAAGTAAAAGTC
GATTCTCCTTCTCTAGATTGTCAAGACATTGCCAATAAGGGAGCTAAACAGAGCGGGCTTTACTTTATTAAACCTCTGAAAGCTAACCAG
CAATTCTTAGTCTACTGTGAAATCGATGGGTCTGGAAATGGATGGACTGTGTTTCAGAAGAGACTTGATGGCAGTGTAGATTTCAAGAAA
AACTGGATTCAATATAAAGAAGGATTTGGACATCTGTCTCCTACTGGCACAACAGAATTTTGGCTGGGAAATGAGAAGATTCATTTGATA
AGCACACAGTCTGCCATCCCATATGCATTAAGAGTGGAACTGGAAGACTGGAATGGCAGAACCAGTACTGCAGACTATGCCATGTTCAAG
GTGGGACCTGAAGCTGACAAGTACCGCCTAACATATGCCTACTTCGCTGGTGGGGATGCTGGAGATGCCTTTGATGGCTTTGATTTTGGC
GATGATCCTAGTGACAAGTTTTTCACATCCCATAATGGCATGCAGTTCAGTACCTGGGACAATGACAATGATAAGTTTGAAGGCAACTGT
GCTGAACAGGATGGATCTGGTTGGTGGATGAACAAGTGTCACGCTGGCCATCTCAATGGAGTTTATTACCAAGTGCAAGGCTGGCCGGAA
GCCCTTGCCTGAAAGCAAGATTTCAGCCTGGAAGAGGGCAAAGTGGACGGGAGTGGACAGGAGTGGATGCGATAAGATGTGGTTTGAAGC

>In-frame_FGG_ENST00000405164_chr4_155527857_-_HP_ENST00000398131_chr16_72094131_+_1317nt
ATGAGTTGGTCCTTGCACCCCCGGAATTTAATTCTCTACTTCTATGCTCTTTTATTTCTCTCTTCAACATGTGTAGCATATGTTGCTACC
AGAGACAACTGCTGCATCTTAGATGAAAGATTCGGTAGTTATTGTCCAACTACCTGTGGCATTGCAGATTTCCTGTCTACTTATCAAACC
AAAGTAGACAAGGATCTACAGTCTTTGGAAGACATCTTACATCAAGTTGAAAACAAAACATCAGAAGTCAAACAGCTGATAAAAGCAATC
CAACTCACTTATAATCCTGATGAATCATCAAAACCAAATATGATAGACGCTGCTACTTTGAAGTCCAGGAAAATGTTAGAAGAAATTATG
AAATATGAAGCATCGATTTTAACACATGACTCAAGTATTCGATATTTGCAGGAAATATATAATTCAAATAATCAAAAGATTGTTAACCTG
AAAGAGAAGGTAGCCCAGCTTGAAGCACAGTGCCAGGAACCTTGCAAAGACACGGTGCAAATCCATGATATCACTGGGAAAGTAAAAGTC
GATTCTCCTTCTCTAGATTGTCAAGACATTGCCAATAAGGGAGCTAAACAGAGCGGGCTTTACTTTATTAAACCTCTGAAAGCTAACCAG
CAATTCTTAGTCTACTGTGAAATCGATGGGTCTGGAAATGGATGGACTGTGTTTCAGAAGAGACTTGATGGCAGTGTAGATTTCAAGAAA
AACTGGATTCAATATAAAGAAGGATTTGGACATCTGTCTCCTACTGGCACAACAGAATTTTGGCTGGGAAATGAGAAGATTCATTTGATA
AGCACACAGTCTGCCATCCCATATGCATTAAGAGTGGAACTGGAAGACTGGAATGGCAGAACCAGTACTGCAGACTATGCCATGTTCAAG
GTGGGACCTGAAGCTGACAAGTACCGCCTAACATATGCCTACTTCGCTGGTGGGGATGCTGGAGATGCCTTTGATGGCTTTGATTTTGGC
GATGATCCTAGTGACAAGTTTTTCACATCCCATAATGGCATGCAGTTCAGTACCTGGGACAATGACAATGATAAGTTTGAAGGCAACTGT
GCTGAACAGGATGGATCTGGTTGGTGGATGAACAAGTGTCACGCTGGCCATCTCAATGGAGTTTATTACCAAGTGCAAGGCTGGCCGGAA
GCCCTTGCCTGAAAGCAAGATTTCAGCCTGGAAGAGGGCAAAGTGGACGGGAGTGGACAGGAGTGGATGCGATAAGATGTGGTTTGAAGC

>In-frame_FGG_ENST00000336098_chr4_155527857_-_HP_ENST00000355906_chr16_72094131_+_1293nt
ATGAGTTGGTCCTTGCACCCCCGGAATTTAATTCTCTACTTCTATGCTCTTTTATTTCTCTCTTCAACATGTGTAGCATATGTTGCTACC
AGAGACAACTGCTGCATCTTAGATGAAAGATTCGGTAGTTATTGTCCAACTACCTGTGGCATTGCAGATTTCCTGTCTACTTATCAAACC
AAAGTAGACAAGGATCTACAGTCTTTGGAAGACATCTTACATCAAGTTGAAAACAAAACATCAGAAGTCAAACAGCTGATAAAAGCAATC
CAACTCACTTATAATCCTGATGAATCATCAAAACCAAATATGATAGACGCTGCTACTTTGAAGTCCAGGAAAATGTTAGAAGAAATTATG
AAATATGAAGCATCGATTTTAACACATGACTCAAGTATTCGATATTTGCAGGAAATATATAATTCAAATAATCAAAAGATTGTTAACCTG
AAAGAGAAGGTAGCCCAGCTTGAAGCACAGTGCCAGGAACCTTGCAAAGACACGGTGCAAATCCATGATATCACTGGGAAAGATTGTCAA
GACATTGCCAATAAGGGAGCTAAACAGAGCGGGCTTTACTTTATTAAACCTCTGAAAGCTAACCAGCAATTCTTAGTCTACTGTGAAATC
GATGGGTCTGGAAATGGATGGACTGTGTTTCAGAAGAGACTTGATGGCAGTGTAGATTTCAAGAAAAACTGGATTCAATATAAAGAAGGA
TTTGGACATCTGTCTCCTACTGGCACAACAGAATTTTGGCTGGGAAATGAGAAGATTCATTTGATAAGCACACAGTCTGCCATCCCATAT
GCATTAAGAGTGGAACTGGAAGACTGGAATGGCAGAACCAGTACTGCAGACTATGCCATGTTCAAGGTGGGACCTGAAGCTGACAAGTAC
CGCCTAACATATGCCTACTTCGCTGGTGGGGATGCTGGAGATGCCTTTGATGGCTTTGATTTTGGCGATGATCCTAGTGACAAGTTTTTC
ACATCCCATAATGGCATGCAGTTCAGTACCTGGGACAATGACAATGATAAGTTTGAAGGCAACTGTGCTGAACAGGATGGATCTGGTTGG
TGGATGAACAAGTGTCACGCTGGCCATCTCAATGGAGTTTATTACCAAGTGCAAGGCTGGCCGGAAGCCCTTGCCTGAAAGCAAGATTTC
AGCCTGGAAGAGGGCAAAGTGGACGGGAGTGGACAGGAGTGGATGCGATAAGATGTGGTTTGAAGCTGATGGGTGCCAGCCCTGCATTGC

>In-frame_FGG_ENST00000336098_chr4_155527857_-_HP_ENST00000398131_chr16_72094131_+_1293nt
ATGAGTTGGTCCTTGCACCCCCGGAATTTAATTCTCTACTTCTATGCTCTTTTATTTCTCTCTTCAACATGTGTAGCATATGTTGCTACC
AGAGACAACTGCTGCATCTTAGATGAAAGATTCGGTAGTTATTGTCCAACTACCTGTGGCATTGCAGATTTCCTGTCTACTTATCAAACC
AAAGTAGACAAGGATCTACAGTCTTTGGAAGACATCTTACATCAAGTTGAAAACAAAACATCAGAAGTCAAACAGCTGATAAAAGCAATC
CAACTCACTTATAATCCTGATGAATCATCAAAACCAAATATGATAGACGCTGCTACTTTGAAGTCCAGGAAAATGTTAGAAGAAATTATG
AAATATGAAGCATCGATTTTAACACATGACTCAAGTATTCGATATTTGCAGGAAATATATAATTCAAATAATCAAAAGATTGTTAACCTG
AAAGAGAAGGTAGCCCAGCTTGAAGCACAGTGCCAGGAACCTTGCAAAGACACGGTGCAAATCCATGATATCACTGGGAAAGATTGTCAA
GACATTGCCAATAAGGGAGCTAAACAGAGCGGGCTTTACTTTATTAAACCTCTGAAAGCTAACCAGCAATTCTTAGTCTACTGTGAAATC
GATGGGTCTGGAAATGGATGGACTGTGTTTCAGAAGAGACTTGATGGCAGTGTAGATTTCAAGAAAAACTGGATTCAATATAAAGAAGGA
TTTGGACATCTGTCTCCTACTGGCACAACAGAATTTTGGCTGGGAAATGAGAAGATTCATTTGATAAGCACACAGTCTGCCATCCCATAT
GCATTAAGAGTGGAACTGGAAGACTGGAATGGCAGAACCAGTACTGCAGACTATGCCATGTTCAAGGTGGGACCTGAAGCTGACAAGTAC
CGCCTAACATATGCCTACTTCGCTGGTGGGGATGCTGGAGATGCCTTTGATGGCTTTGATTTTGGCGATGATCCTAGTGACAAGTTTTTC
ACATCCCATAATGGCATGCAGTTCAGTACCTGGGACAATGACAATGATAAGTTTGAAGGCAACTGTGCTGAACAGGATGGATCTGGTTGG
TGGATGAACAAGTGTCACGCTGGCCATCTCAATGGAGTTTATTACCAAGTGCAAGGCTGGCCGGAAGCCCTTGCCTGAAAGCAAGATTTC
AGCCTGGAAGAGGGCAAAGTGGACGGGAGTGGACAGGAGTGGATGCGATAAGATGTGGTTTGAAGCTGATGGGTGCCAGCCCTGCATTGC

>In-frame_FGG_ENST00000407946_chr4_155527857_-_HP_ENST00000355906_chr16_72094131_+_1317nt
ATGAGTTGGTCCTTGCACCCCCGGAATTTAATTCTCTACTTCTATGCTCTTTTATTTCTCTCTTCAACATGTGTAGCATATGTTGCTACC
AGAGACAACTGCTGCATCTTAGATGAAAGATTCGGTAGTTATTGTCCAACTACCTGTGGCATTGCAGATTTCCTGTCTACTTATCAAACC
AAAGTAGACAAGGATCTACAGTCTTTGGAAGACATCTTACATCAAGTTGAAAACAAAACATCAGAAGTCAAACAGCTGATAAAAGCAATC
CAACTCACTTATAATCCTGATGAATCATCAAAACCAAATATGATAGACGCTGCTACTTTGAAGTCCAGGAAAATGTTAGAAGAAATTATG
AAATATGAAGCATCGATTTTAACACATGACTCAAGTATTCGATATTTGCAGGAAATATATAATTCAAATAATCAAAAGATTGTTAACCTG
AAAGAGAAGGTAGCCCAGCTTGAAGCACAGTGCCAGGAACCTTGCAAAGACACGGTGCAAATCCATGATATCACTGGGAAAGTAAAAGTC
GATTCTCCTTCTCTAGATTGTCAAGACATTGCCAATAAGGGAGCTAAACAGAGCGGGCTTTACTTTATTAAACCTCTGAAAGCTAACCAG
CAATTCTTAGTCTACTGTGAAATCGATGGGTCTGGAAATGGATGGACTGTGTTTCAGAAGAGACTTGATGGCAGTGTAGATTTCAAGAAA
AACTGGATTCAATATAAAGAAGGATTTGGACATCTGTCTCCTACTGGCACAACAGAATTTTGGCTGGGAAATGAGAAGATTCATTTGATA
AGCACACAGTCTGCCATCCCATATGCATTAAGAGTGGAACTGGAAGACTGGAATGGCAGAACCAGTACTGCAGACTATGCCATGTTCAAG
GTGGGACCTGAAGCTGACAAGTACCGCCTAACATATGCCTACTTCGCTGGTGGGGATGCTGGAGATGCCTTTGATGGCTTTGATTTTGGC
GATGATCCTAGTGACAAGTTTTTCACATCCCATAATGGCATGCAGTTCAGTACCTGGGACAATGACAATGATAAGTTTGAAGGCAACTGT
GCTGAACAGGATGGATCTGGTTGGTGGATGAACAAGTGTCACGCTGGCCATCTCAATGGAGTTTATTACCAAGTGCAAGGCTGGCCGGAA
GCCCTTGCCTGAAAGCAAGATTTCAGCCTGGAAGAGGGCAAAGTGGACGGGAGTGGACAGGAGTGGATGCGATAAGATGTGGTTTGAAGC

>In-frame_FGG_ENST00000407946_chr4_155527857_-_HP_ENST00000398131_chr16_72094131_+_1317nt
ATGAGTTGGTCCTTGCACCCCCGGAATTTAATTCTCTACTTCTATGCTCTTTTATTTCTCTCTTCAACATGTGTAGCATATGTTGCTACC
AGAGACAACTGCTGCATCTTAGATGAAAGATTCGGTAGTTATTGTCCAACTACCTGTGGCATTGCAGATTTCCTGTCTACTTATCAAACC
AAAGTAGACAAGGATCTACAGTCTTTGGAAGACATCTTACATCAAGTTGAAAACAAAACATCAGAAGTCAAACAGCTGATAAAAGCAATC
CAACTCACTTATAATCCTGATGAATCATCAAAACCAAATATGATAGACGCTGCTACTTTGAAGTCCAGGAAAATGTTAGAAGAAATTATG
AAATATGAAGCATCGATTTTAACACATGACTCAAGTATTCGATATTTGCAGGAAATATATAATTCAAATAATCAAAAGATTGTTAACCTG
AAAGAGAAGGTAGCCCAGCTTGAAGCACAGTGCCAGGAACCTTGCAAAGACACGGTGCAAATCCATGATATCACTGGGAAAGTAAAAGTC
GATTCTCCTTCTCTAGATTGTCAAGACATTGCCAATAAGGGAGCTAAACAGAGCGGGCTTTACTTTATTAAACCTCTGAAAGCTAACCAG
CAATTCTTAGTCTACTGTGAAATCGATGGGTCTGGAAATGGATGGACTGTGTTTCAGAAGAGACTTGATGGCAGTGTAGATTTCAAGAAA
AACTGGATTCAATATAAAGAAGGATTTGGACATCTGTCTCCTACTGGCACAACAGAATTTTGGCTGGGAAATGAGAAGATTCATTTGATA
AGCACACAGTCTGCCATCCCATATGCATTAAGAGTGGAACTGGAAGACTGGAATGGCAGAACCAGTACTGCAGACTATGCCATGTTCAAG
GTGGGACCTGAAGCTGACAAGTACCGCCTAACATATGCCTACTTCGCTGGTGGGGATGCTGGAGATGCCTTTGATGGCTTTGATTTTGGC
GATGATCCTAGTGACAAGTTTTTCACATCCCATAATGGCATGCAGTTCAGTACCTGGGACAATGACAATGATAAGTTTGAAGGCAACTGT
GCTGAACAGGATGGATCTGGTTGGTGGATGAACAAGTGTCACGCTGGCCATCTCAATGGAGTTTATTACCAAGTGCAAGGCTGGCCGGAA
GCCCTTGCCTGAAAGCAAGATTTCAGCCTGGAAGAGGGCAAAGTGGACGGGAGTGGACAGGAGTGGATGCGATAAGATGTGGTTTGAAGC


* Fusion transcript sequences (Full-length transcript).
>In-frame_FGG_ENST00000404648_chr4_155527857_-_HP_ENST00000355906_chr16_72094131_+_2191nt
AAAAAGGAGGAGCTTCAACCTGTGTGCAAAATCTGGGAACCTGACAGTATAGGTTGGGGGCCAGGATGAGGAAAAAGGAACGGGAAAGAC
CTGCCCACCCTTCTGGTAAGGAGGCCCCGTGATCAGCTCCAGCCATTTGCAGTCCTGGCTATCCCAGGAGCTTACATAAAGGGACAATTG
GAGCCTGAGAGGTGACAGTGCTGACACTACAAGGCTCGGAGCTCCGGGCACTCAGACATCATGAGTTGGTCCTTGCACCCCCGGAATTTA
ATTCTCTACTTCTATGCTCTTTTATTTCTCTCTTCAACATGTGTAGCATATGTTGCTACCAGAGACAACTGCTGCATCTTAGATGAAAGA
TTCGGTAGTTATTGTCCAACTACCTGTGGCATTGCAGATTTCCTGTCTACTTATCAAACCAAAGTAGACAAGGATCTACAGTCTTTGGAA
GACATCTTACATCAAGTTGAAAACAAAACATCAGAAGTCAAACAGCTGATAAAAGCAATCCAACTCACTTATAATCCTGATGAATCATCA
AAACCAAATATGATAGACGCTGCTACTTTGAAGTCCAGGAAAATGTTAGAAGAAATTATGAAATATGAAGCATCGATTTTAACACATGAC
TCAAGTATTCGATATTTGCAGGAAATATATAATTCAAATAATCAAAAGATTGTTAACCTGAAAGAGAAGGTAGCCCAGCTTGAAGCACAG
TGCCAGGAACCTTGCAAAGACACGGTGCAAATCCATGATATCACTGGGAAAGATTGTCAAGACATTGCCAATAAGGGAGCTAAACAGAGC
GGGCTTTACTTTATTAAACCTCTGAAAGCTAACCAGCAATTCTTAGTCTACTGTGAAATCGATGGGTCTGGAAATGGATGGACTGTGTTT
CAGAAGAGACTTGATGGCAGTGTAGATTTCAAGAAAAACTGGATTCAATATAAAGAAGGATTTGGACATCTGTCTCCTACTGGCACAACA
GAATTTTGGCTGGGAAATGAGAAGATTCATTTGATAAGCACACAGTCTGCCATCCCATATGCATTAAGAGTGGAACTGGAAGACTGGAAT
GGCAGAACCAGTACTGCAGACTATGCCATGTTCAAGGTGGGACCTGAAGCTGACAAGTACCGCCTAACATATGCCTACTTCGCTGGTGGG
GATGCTGGAGATGCCTTTGATGGCTTTGATTTTGGCGATGATCCTAGTGACAAGTTTTTCACATCCCATAATGGCATGCAGTTCAGTACC
TGGGACAATGACAATGATAAGTTTGAAGGCAACTGTGCTGAACAGGATGGATCTGGTTGGTGGATGAACAAGTGTCACGCTGGCCATCTC
AATGGAGTTTATTACCAAGTGCCACGCTGATCAATGAACAATGGCTGCTGACCACGGCTAAAAATCTCTTCCTGAACCATTCAGAAAATG
CAACAGCGAAAGACATTGCCCCTACTTTAACACTCTATGTGGGGAAAAAGCAGCTTGTAGAGATTGAGAAGGTTGTTCTACACCCTAACT
ACTCCCAGGTAGATATTGGGCTCATCAAACTCAAACAGAAGGTGTCTGTTAATGAGAGAGTGATGCCCATCTGCCTACCTTCAAAGGATT
ATGCAGAAGTAGGGCGTGTGGGTTATGTTTCTGGCTGGGGGCGAAATGCCAATTTTAAATTTACTGACCATCTGAAGTATGTCATGCTGC
CTGTGGCTGACCAAGACCAATGCATAAGGCATTATGAAGGCAGCACAGTCCCCGAAAAGAAGACACCGAAGAGCCCTGTAGGGGTGCAGC
CCATACTGAATGAACACACCTTCTGTGCTGGCATGTCTAAGTACCAAGAAGACACCTGCTATGGCGATGCGGGCAGTGCCTTTGCCGTTC
ACGACCTGGAGGAGGACACCTGGTATGCGACTGGGATCTTAAGCTTTGATAAGAGCTGTGCTGTGGCTGAGTATGGTGTGTATGTGAAGG
TGACTTCCATCCAGGACTGGGTTCAGAAGACCATAGCTGAGAACTAATGCAAGGCTGGCCGGAAGCCCTTGCCTGAAAGCAAGATTTCAG
CCTGGAAGAGGGCAAAGTGGACGGGAGTGGACAGGAGTGGATGCGATAAGATGTGGTTTGAAGCTGATGGGTGCCAGCCCTGCATTGCTG

>In-frame_FGG_ENST00000404648_chr4_155527857_-_HP_ENST00000398131_chr16_72094131_+_2191nt
AAAAAGGAGGAGCTTCAACCTGTGTGCAAAATCTGGGAACCTGACAGTATAGGTTGGGGGCCAGGATGAGGAAAAAGGAACGGGAAAGAC
CTGCCCACCCTTCTGGTAAGGAGGCCCCGTGATCAGCTCCAGCCATTTGCAGTCCTGGCTATCCCAGGAGCTTACATAAAGGGACAATTG
GAGCCTGAGAGGTGACAGTGCTGACACTACAAGGCTCGGAGCTCCGGGCACTCAGACATCATGAGTTGGTCCTTGCACCCCCGGAATTTA
ATTCTCTACTTCTATGCTCTTTTATTTCTCTCTTCAACATGTGTAGCATATGTTGCTACCAGAGACAACTGCTGCATCTTAGATGAAAGA
TTCGGTAGTTATTGTCCAACTACCTGTGGCATTGCAGATTTCCTGTCTACTTATCAAACCAAAGTAGACAAGGATCTACAGTCTTTGGAA
GACATCTTACATCAAGTTGAAAACAAAACATCAGAAGTCAAACAGCTGATAAAAGCAATCCAACTCACTTATAATCCTGATGAATCATCA
AAACCAAATATGATAGACGCTGCTACTTTGAAGTCCAGGAAAATGTTAGAAGAAATTATGAAATATGAAGCATCGATTTTAACACATGAC
TCAAGTATTCGATATTTGCAGGAAATATATAATTCAAATAATCAAAAGATTGTTAACCTGAAAGAGAAGGTAGCCCAGCTTGAAGCACAG
TGCCAGGAACCTTGCAAAGACACGGTGCAAATCCATGATATCACTGGGAAAGATTGTCAAGACATTGCCAATAAGGGAGCTAAACAGAGC
GGGCTTTACTTTATTAAACCTCTGAAAGCTAACCAGCAATTCTTAGTCTACTGTGAAATCGATGGGTCTGGAAATGGATGGACTGTGTTT
CAGAAGAGACTTGATGGCAGTGTAGATTTCAAGAAAAACTGGATTCAATATAAAGAAGGATTTGGACATCTGTCTCCTACTGGCACAACA
GAATTTTGGCTGGGAAATGAGAAGATTCATTTGATAAGCACACAGTCTGCCATCCCATATGCATTAAGAGTGGAACTGGAAGACTGGAAT
GGCAGAACCAGTACTGCAGACTATGCCATGTTCAAGGTGGGACCTGAAGCTGACAAGTACCGCCTAACATATGCCTACTTCGCTGGTGGG
GATGCTGGAGATGCCTTTGATGGCTTTGATTTTGGCGATGATCCTAGTGACAAGTTTTTCACATCCCATAATGGCATGCAGTTCAGTACC
TGGGACAATGACAATGATAAGTTTGAAGGCAACTGTGCTGAACAGGATGGATCTGGTTGGTGGATGAACAAGTGTCACGCTGGCCATCTC
AATGGAGTTTATTACCAAGTGCCACGCTGATCAATGAACAATGGCTGCTGACCACGGCTAAAAATCTCTTCCTGAACCATTCAGAAAATG
CAACAGCGAAAGACATTGCCCCTACTTTAACACTCTATGTGGGGAAAAAGCAGCTTGTAGAGATTGAGAAGGTTGTTCTACACCCTAACT
ACTCCCAGGTAGATATTGGGCTCATCAAACTCAAACAGAAGGTGTCTGTTAATGAGAGAGTGATGCCCATCTGCCTACCTTCAAAGGATT
ATGCAGAAGTAGGGCGTGTGGGTTATGTTTCTGGCTGGGGGCGAAATGCCAATTTTAAATTTACTGACCATCTGAAGTATGTCATGCTGC
CTGTGGCTGACCAAGACCAATGCATAAGGCATTATGAAGGCAGCACAGTCCCCGAAAAGAAGACACCGAAGAGCCCTGTAGGGGTGCAGC
CCATACTGAATGAACACACCTTCTGTGCTGGCATGTCTAAGTACCAAGAAGACACCTGCTATGGCGATGCGGGCAGTGCCTTTGCCGTTC
ACGACCTGGAGGAGGACACCTGGTATGCGACTGGGATCTTAAGCTTTGATAAGAGCTGTGCTGTGGCTGAGTATGGTGTGTATGTGAAGG
TGACTTCCATCCAGGACTGGGTTCAGAAGACCATAGCTGAGAACTAATGCAAGGCTGGCCGGAAGCCCTTGCCTGAAAGCAAGATTTCAG
CCTGGAAGAGGGCAAAGTGGACGGGAGTGGACAGGAGTGGATGCGATAAGATGTGGTTTGAAGCTGATGGGTGCCAGCCCTGCATTGCTG

>In-frame_FGG_ENST00000405164_chr4_155527857_-_HP_ENST00000355906_chr16_72094131_+_2009nt
CTACAAGGCTCGGAGCTCCGGGCACTCAGACATCATGAGTTGGTCCTTGCACCCCCGGAATTTAATTCTCTACTTCTATGCTCTTTTATT
TCTCTCTTCAACATGTGTAGCATATGTTGCTACCAGAGACAACTGCTGCATCTTAGATGAAAGATTCGGTAGTTATTGTCCAACTACCTG
TGGCATTGCAGATTTCCTGTCTACTTATCAAACCAAAGTAGACAAGGATCTACAGTCTTTGGAAGACATCTTACATCAAGTTGAAAACAA
AACATCAGAAGTCAAACAGCTGATAAAAGCAATCCAACTCACTTATAATCCTGATGAATCATCAAAACCAAATATGATAGACGCTGCTAC
TTTGAAGTCCAGGAAAATGTTAGAAGAAATTATGAAATATGAAGCATCGATTTTAACACATGACTCAAGTATTCGATATTTGCAGGAAAT
ATATAATTCAAATAATCAAAAGATTGTTAACCTGAAAGAGAAGGTAGCCCAGCTTGAAGCACAGTGCCAGGAACCTTGCAAAGACACGGT
GCAAATCCATGATATCACTGGGAAAGTAAAAGTCGATTCTCCTTCTCTAGATTGTCAAGACATTGCCAATAAGGGAGCTAAACAGAGCGG
GCTTTACTTTATTAAACCTCTGAAAGCTAACCAGCAATTCTTAGTCTACTGTGAAATCGATGGGTCTGGAAATGGATGGACTGTGTTTCA
GAAGAGACTTGATGGCAGTGTAGATTTCAAGAAAAACTGGATTCAATATAAAGAAGGATTTGGACATCTGTCTCCTACTGGCACAACAGA
ATTTTGGCTGGGAAATGAGAAGATTCATTTGATAAGCACACAGTCTGCCATCCCATATGCATTAAGAGTGGAACTGGAAGACTGGAATGG
CAGAACCAGTACTGCAGACTATGCCATGTTCAAGGTGGGACCTGAAGCTGACAAGTACCGCCTAACATATGCCTACTTCGCTGGTGGGGA
TGCTGGAGATGCCTTTGATGGCTTTGATTTTGGCGATGATCCTAGTGACAAGTTTTTCACATCCCATAATGGCATGCAGTTCAGTACCTG
GGACAATGACAATGATAAGTTTGAAGGCAACTGTGCTGAACAGGATGGATCTGGTTGGTGGATGAACAAGTGTCACGCTGGCCATCTCAA
TGGAGTTTATTACCAAGTGCCACGCTGATCAATGAACAATGGCTGCTGACCACGGCTAAAAATCTCTTCCTGAACCATTCAGAAAATGCA
ACAGCGAAAGACATTGCCCCTACTTTAACACTCTATGTGGGGAAAAAGCAGCTTGTAGAGATTGAGAAGGTTGTTCTACACCCTAACTAC
TCCCAGGTAGATATTGGGCTCATCAAACTCAAACAGAAGGTGTCTGTTAATGAGAGAGTGATGCCCATCTGCCTACCTTCAAAGGATTAT
GCAGAAGTAGGGCGTGTGGGTTATGTTTCTGGCTGGGGGCGAAATGCCAATTTTAAATTTACTGACCATCTGAAGTATGTCATGCTGCCT
GTGGCTGACCAAGACCAATGCATAAGGCATTATGAAGGCAGCACAGTCCCCGAAAAGAAGACACCGAAGAGCCCTGTAGGGGTGCAGCCC
ATACTGAATGAACACACCTTCTGTGCTGGCATGTCTAAGTACCAAGAAGACACCTGCTATGGCGATGCGGGCAGTGCCTTTGCCGTTCAC
GACCTGGAGGAGGACACCTGGTATGCGACTGGGATCTTAAGCTTTGATAAGAGCTGTGCTGTGGCTGAGTATGGTGTGTATGTGAAGGTG
ACTTCCATCCAGGACTGGGTTCAGAAGACCATAGCTGAGAACTAATGCAAGGCTGGCCGGAAGCCCTTGCCTGAAAGCAAGATTTCAGCC
TGGAAGAGGGCAAAGTGGACGGGAGTGGACAGGAGTGGATGCGATAAGATGTGGTTTGAAGCTGATGGGTGCCAGCCCTGCATTGCTGAG

>In-frame_FGG_ENST00000405164_chr4_155527857_-_HP_ENST00000398131_chr16_72094131_+_2009nt
CTACAAGGCTCGGAGCTCCGGGCACTCAGACATCATGAGTTGGTCCTTGCACCCCCGGAATTTAATTCTCTACTTCTATGCTCTTTTATT
TCTCTCTTCAACATGTGTAGCATATGTTGCTACCAGAGACAACTGCTGCATCTTAGATGAAAGATTCGGTAGTTATTGTCCAACTACCTG
TGGCATTGCAGATTTCCTGTCTACTTATCAAACCAAAGTAGACAAGGATCTACAGTCTTTGGAAGACATCTTACATCAAGTTGAAAACAA
AACATCAGAAGTCAAACAGCTGATAAAAGCAATCCAACTCACTTATAATCCTGATGAATCATCAAAACCAAATATGATAGACGCTGCTAC
TTTGAAGTCCAGGAAAATGTTAGAAGAAATTATGAAATATGAAGCATCGATTTTAACACATGACTCAAGTATTCGATATTTGCAGGAAAT
ATATAATTCAAATAATCAAAAGATTGTTAACCTGAAAGAGAAGGTAGCCCAGCTTGAAGCACAGTGCCAGGAACCTTGCAAAGACACGGT
GCAAATCCATGATATCACTGGGAAAGTAAAAGTCGATTCTCCTTCTCTAGATTGTCAAGACATTGCCAATAAGGGAGCTAAACAGAGCGG
GCTTTACTTTATTAAACCTCTGAAAGCTAACCAGCAATTCTTAGTCTACTGTGAAATCGATGGGTCTGGAAATGGATGGACTGTGTTTCA
GAAGAGACTTGATGGCAGTGTAGATTTCAAGAAAAACTGGATTCAATATAAAGAAGGATTTGGACATCTGTCTCCTACTGGCACAACAGA
ATTTTGGCTGGGAAATGAGAAGATTCATTTGATAAGCACACAGTCTGCCATCCCATATGCATTAAGAGTGGAACTGGAAGACTGGAATGG
CAGAACCAGTACTGCAGACTATGCCATGTTCAAGGTGGGACCTGAAGCTGACAAGTACCGCCTAACATATGCCTACTTCGCTGGTGGGGA
TGCTGGAGATGCCTTTGATGGCTTTGATTTTGGCGATGATCCTAGTGACAAGTTTTTCACATCCCATAATGGCATGCAGTTCAGTACCTG
GGACAATGACAATGATAAGTTTGAAGGCAACTGTGCTGAACAGGATGGATCTGGTTGGTGGATGAACAAGTGTCACGCTGGCCATCTCAA
TGGAGTTTATTACCAAGTGCCACGCTGATCAATGAACAATGGCTGCTGACCACGGCTAAAAATCTCTTCCTGAACCATTCAGAAAATGCA
ACAGCGAAAGACATTGCCCCTACTTTAACACTCTATGTGGGGAAAAAGCAGCTTGTAGAGATTGAGAAGGTTGTTCTACACCCTAACTAC
TCCCAGGTAGATATTGGGCTCATCAAACTCAAACAGAAGGTGTCTGTTAATGAGAGAGTGATGCCCATCTGCCTACCTTCAAAGGATTAT
GCAGAAGTAGGGCGTGTGGGTTATGTTTCTGGCTGGGGGCGAAATGCCAATTTTAAATTTACTGACCATCTGAAGTATGTCATGCTGCCT
GTGGCTGACCAAGACCAATGCATAAGGCATTATGAAGGCAGCACAGTCCCCGAAAAGAAGACACCGAAGAGCCCTGTAGGGGTGCAGCCC
ATACTGAATGAACACACCTTCTGTGCTGGCATGTCTAAGTACCAAGAAGACACCTGCTATGGCGATGCGGGCAGTGCCTTTGCCGTTCAC
GACCTGGAGGAGGACACCTGGTATGCGACTGGGATCTTAAGCTTTGATAAGAGCTGTGCTGTGGCTGAGTATGGTGTGTATGTGAAGGTG
ACTTCCATCCAGGACTGGGTTCAGAAGACCATAGCTGAGAACTAATGCAAGGCTGGCCGGAAGCCCTTGCCTGAAAGCAAGATTTCAGCC
TGGAAGAGGGCAAAGTGGACGGGAGTGGACAGGAGTGGATGCGATAAGATGTGGTTTGAAGCTGATGGGTGCCAGCCCTGCATTGCTGAG

>In-frame_FGG_ENST00000336098_chr4_155527857_-_HP_ENST00000355906_chr16_72094131_+_1990nt
TGACACTACAAGGCTCGGAGCTCCGGGCACTCAGACATCATGAGTTGGTCCTTGCACCCCCGGAATTTAATTCTCTACTTCTATGCTCTT
TTATTTCTCTCTTCAACATGTGTAGCATATGTTGCTACCAGAGACAACTGCTGCATCTTAGATGAAAGATTCGGTAGTTATTGTCCAACT
ACCTGTGGCATTGCAGATTTCCTGTCTACTTATCAAACCAAAGTAGACAAGGATCTACAGTCTTTGGAAGACATCTTACATCAAGTTGAA
AACAAAACATCAGAAGTCAAACAGCTGATAAAAGCAATCCAACTCACTTATAATCCTGATGAATCATCAAAACCAAATATGATAGACGCT
GCTACTTTGAAGTCCAGGAAAATGTTAGAAGAAATTATGAAATATGAAGCATCGATTTTAACACATGACTCAAGTATTCGATATTTGCAG
GAAATATATAATTCAAATAATCAAAAGATTGTTAACCTGAAAGAGAAGGTAGCCCAGCTTGAAGCACAGTGCCAGGAACCTTGCAAAGAC
ACGGTGCAAATCCATGATATCACTGGGAAAGATTGTCAAGACATTGCCAATAAGGGAGCTAAACAGAGCGGGCTTTACTTTATTAAACCT
CTGAAAGCTAACCAGCAATTCTTAGTCTACTGTGAAATCGATGGGTCTGGAAATGGATGGACTGTGTTTCAGAAGAGACTTGATGGCAGT
GTAGATTTCAAGAAAAACTGGATTCAATATAAAGAAGGATTTGGACATCTGTCTCCTACTGGCACAACAGAATTTTGGCTGGGAAATGAG
AAGATTCATTTGATAAGCACACAGTCTGCCATCCCATATGCATTAAGAGTGGAACTGGAAGACTGGAATGGCAGAACCAGTACTGCAGAC
TATGCCATGTTCAAGGTGGGACCTGAAGCTGACAAGTACCGCCTAACATATGCCTACTTCGCTGGTGGGGATGCTGGAGATGCCTTTGAT
GGCTTTGATTTTGGCGATGATCCTAGTGACAAGTTTTTCACATCCCATAATGGCATGCAGTTCAGTACCTGGGACAATGACAATGATAAG
TTTGAAGGCAACTGTGCTGAACAGGATGGATCTGGTTGGTGGATGAACAAGTGTCACGCTGGCCATCTCAATGGAGTTTATTACCAAGTG
CCACGCTGATCAATGAACAATGGCTGCTGACCACGGCTAAAAATCTCTTCCTGAACCATTCAGAAAATGCAACAGCGAAAGACATTGCCC
CTACTTTAACACTCTATGTGGGGAAAAAGCAGCTTGTAGAGATTGAGAAGGTTGTTCTACACCCTAACTACTCCCAGGTAGATATTGGGC
TCATCAAACTCAAACAGAAGGTGTCTGTTAATGAGAGAGTGATGCCCATCTGCCTACCTTCAAAGGATTATGCAGAAGTAGGGCGTGTGG
GTTATGTTTCTGGCTGGGGGCGAAATGCCAATTTTAAATTTACTGACCATCTGAAGTATGTCATGCTGCCTGTGGCTGACCAAGACCAAT
GCATAAGGCATTATGAAGGCAGCACAGTCCCCGAAAAGAAGACACCGAAGAGCCCTGTAGGGGTGCAGCCCATACTGAATGAACACACCT
TCTGTGCTGGCATGTCTAAGTACCAAGAAGACACCTGCTATGGCGATGCGGGCAGTGCCTTTGCCGTTCACGACCTGGAGGAGGACACCT
GGTATGCGACTGGGATCTTAAGCTTTGATAAGAGCTGTGCTGTGGCTGAGTATGGTGTGTATGTGAAGGTGACTTCCATCCAGGACTGGG
TTCAGAAGACCATAGCTGAGAACTAATGCAAGGCTGGCCGGAAGCCCTTGCCTGAAAGCAAGATTTCAGCCTGGAAGAGGGCAAAGTGGA
CGGGAGTGGACAGGAGTGGATGCGATAAGATGTGGTTTGAAGCTGATGGGTGCCAGCCCTGCATTGCTGAGTCAATCAATAAAGAGCTTT

>In-frame_FGG_ENST00000336098_chr4_155527857_-_HP_ENST00000398131_chr16_72094131_+_1990nt
TGACACTACAAGGCTCGGAGCTCCGGGCACTCAGACATCATGAGTTGGTCCTTGCACCCCCGGAATTTAATTCTCTACTTCTATGCTCTT
TTATTTCTCTCTTCAACATGTGTAGCATATGTTGCTACCAGAGACAACTGCTGCATCTTAGATGAAAGATTCGGTAGTTATTGTCCAACT
ACCTGTGGCATTGCAGATTTCCTGTCTACTTATCAAACCAAAGTAGACAAGGATCTACAGTCTTTGGAAGACATCTTACATCAAGTTGAA
AACAAAACATCAGAAGTCAAACAGCTGATAAAAGCAATCCAACTCACTTATAATCCTGATGAATCATCAAAACCAAATATGATAGACGCT
GCTACTTTGAAGTCCAGGAAAATGTTAGAAGAAATTATGAAATATGAAGCATCGATTTTAACACATGACTCAAGTATTCGATATTTGCAG
GAAATATATAATTCAAATAATCAAAAGATTGTTAACCTGAAAGAGAAGGTAGCCCAGCTTGAAGCACAGTGCCAGGAACCTTGCAAAGAC
ACGGTGCAAATCCATGATATCACTGGGAAAGATTGTCAAGACATTGCCAATAAGGGAGCTAAACAGAGCGGGCTTTACTTTATTAAACCT
CTGAAAGCTAACCAGCAATTCTTAGTCTACTGTGAAATCGATGGGTCTGGAAATGGATGGACTGTGTTTCAGAAGAGACTTGATGGCAGT
GTAGATTTCAAGAAAAACTGGATTCAATATAAAGAAGGATTTGGACATCTGTCTCCTACTGGCACAACAGAATTTTGGCTGGGAAATGAG
AAGATTCATTTGATAAGCACACAGTCTGCCATCCCATATGCATTAAGAGTGGAACTGGAAGACTGGAATGGCAGAACCAGTACTGCAGAC
TATGCCATGTTCAAGGTGGGACCTGAAGCTGACAAGTACCGCCTAACATATGCCTACTTCGCTGGTGGGGATGCTGGAGATGCCTTTGAT
GGCTTTGATTTTGGCGATGATCCTAGTGACAAGTTTTTCACATCCCATAATGGCATGCAGTTCAGTACCTGGGACAATGACAATGATAAG
TTTGAAGGCAACTGTGCTGAACAGGATGGATCTGGTTGGTGGATGAACAAGTGTCACGCTGGCCATCTCAATGGAGTTTATTACCAAGTG
CCACGCTGATCAATGAACAATGGCTGCTGACCACGGCTAAAAATCTCTTCCTGAACCATTCAGAAAATGCAACAGCGAAAGACATTGCCC
CTACTTTAACACTCTATGTGGGGAAAAAGCAGCTTGTAGAGATTGAGAAGGTTGTTCTACACCCTAACTACTCCCAGGTAGATATTGGGC
TCATCAAACTCAAACAGAAGGTGTCTGTTAATGAGAGAGTGATGCCCATCTGCCTACCTTCAAAGGATTATGCAGAAGTAGGGCGTGTGG
GTTATGTTTCTGGCTGGGGGCGAAATGCCAATTTTAAATTTACTGACCATCTGAAGTATGTCATGCTGCCTGTGGCTGACCAAGACCAAT
GCATAAGGCATTATGAAGGCAGCACAGTCCCCGAAAAGAAGACACCGAAGAGCCCTGTAGGGGTGCAGCCCATACTGAATGAACACACCT
TCTGTGCTGGCATGTCTAAGTACCAAGAAGACACCTGCTATGGCGATGCGGGCAGTGCCTTTGCCGTTCACGACCTGGAGGAGGACACCT
GGTATGCGACTGGGATCTTAAGCTTTGATAAGAGCTGTGCTGTGGCTGAGTATGGTGTGTATGTGAAGGTGACTTCCATCCAGGACTGGG
TTCAGAAGACCATAGCTGAGAACTAATGCAAGGCTGGCCGGAAGCCCTTGCCTGAAAGCAAGATTTCAGCCTGGAAGAGGGCAAAGTGGA
CGGGAGTGGACAGGAGTGGATGCGATAAGATGTGGTTTGAAGCTGATGGGTGCCAGCCCTGCATTGCTGAGTCAATCAATAAAGAGCTTT

>In-frame_FGG_ENST00000407946_chr4_155527857_-_HP_ENST00000355906_chr16_72094131_+_2001nt
CTCGGAGCTCCGGGCACTCAGACATCATGAGTTGGTCCTTGCACCCCCGGAATTTAATTCTCTACTTCTATGCTCTTTTATTTCTCTCTT
CAACATGTGTAGCATATGTTGCTACCAGAGACAACTGCTGCATCTTAGATGAAAGATTCGGTAGTTATTGTCCAACTACCTGTGGCATTG
CAGATTTCCTGTCTACTTATCAAACCAAAGTAGACAAGGATCTACAGTCTTTGGAAGACATCTTACATCAAGTTGAAAACAAAACATCAG
AAGTCAAACAGCTGATAAAAGCAATCCAACTCACTTATAATCCTGATGAATCATCAAAACCAAATATGATAGACGCTGCTACTTTGAAGT
CCAGGAAAATGTTAGAAGAAATTATGAAATATGAAGCATCGATTTTAACACATGACTCAAGTATTCGATATTTGCAGGAAATATATAATT
CAAATAATCAAAAGATTGTTAACCTGAAAGAGAAGGTAGCCCAGCTTGAAGCACAGTGCCAGGAACCTTGCAAAGACACGGTGCAAATCC
ATGATATCACTGGGAAAGTAAAAGTCGATTCTCCTTCTCTAGATTGTCAAGACATTGCCAATAAGGGAGCTAAACAGAGCGGGCTTTACT
TTATTAAACCTCTGAAAGCTAACCAGCAATTCTTAGTCTACTGTGAAATCGATGGGTCTGGAAATGGATGGACTGTGTTTCAGAAGAGAC
TTGATGGCAGTGTAGATTTCAAGAAAAACTGGATTCAATATAAAGAAGGATTTGGACATCTGTCTCCTACTGGCACAACAGAATTTTGGC
TGGGAAATGAGAAGATTCATTTGATAAGCACACAGTCTGCCATCCCATATGCATTAAGAGTGGAACTGGAAGACTGGAATGGCAGAACCA
GTACTGCAGACTATGCCATGTTCAAGGTGGGACCTGAAGCTGACAAGTACCGCCTAACATATGCCTACTTCGCTGGTGGGGATGCTGGAG
ATGCCTTTGATGGCTTTGATTTTGGCGATGATCCTAGTGACAAGTTTTTCACATCCCATAATGGCATGCAGTTCAGTACCTGGGACAATG
ACAATGATAAGTTTGAAGGCAACTGTGCTGAACAGGATGGATCTGGTTGGTGGATGAACAAGTGTCACGCTGGCCATCTCAATGGAGTTT
ATTACCAAGTGCCACGCTGATCAATGAACAATGGCTGCTGACCACGGCTAAAAATCTCTTCCTGAACCATTCAGAAAATGCAACAGCGAA
AGACATTGCCCCTACTTTAACACTCTATGTGGGGAAAAAGCAGCTTGTAGAGATTGAGAAGGTTGTTCTACACCCTAACTACTCCCAGGT
AGATATTGGGCTCATCAAACTCAAACAGAAGGTGTCTGTTAATGAGAGAGTGATGCCCATCTGCCTACCTTCAAAGGATTATGCAGAAGT
AGGGCGTGTGGGTTATGTTTCTGGCTGGGGGCGAAATGCCAATTTTAAATTTACTGACCATCTGAAGTATGTCATGCTGCCTGTGGCTGA
CCAAGACCAATGCATAAGGCATTATGAAGGCAGCACAGTCCCCGAAAAGAAGACACCGAAGAGCCCTGTAGGGGTGCAGCCCATACTGAA
TGAACACACCTTCTGTGCTGGCATGTCTAAGTACCAAGAAGACACCTGCTATGGCGATGCGGGCAGTGCCTTTGCCGTTCACGACCTGGA
GGAGGACACCTGGTATGCGACTGGGATCTTAAGCTTTGATAAGAGCTGTGCTGTGGCTGAGTATGGTGTGTATGTGAAGGTGACTTCCAT
CCAGGACTGGGTTCAGAAGACCATAGCTGAGAACTAATGCAAGGCTGGCCGGAAGCCCTTGCCTGAAAGCAAGATTTCAGCCTGGAAGAG
GGCAAAGTGGACGGGAGTGGACAGGAGTGGATGCGATAAGATGTGGTTTGAAGCTGATGGGTGCCAGCCCTGCATTGCTGAGTCAATCAA

>In-frame_FGG_ENST00000407946_chr4_155527857_-_HP_ENST00000398131_chr16_72094131_+_2001nt
CTCGGAGCTCCGGGCACTCAGACATCATGAGTTGGTCCTTGCACCCCCGGAATTTAATTCTCTACTTCTATGCTCTTTTATTTCTCTCTT
CAACATGTGTAGCATATGTTGCTACCAGAGACAACTGCTGCATCTTAGATGAAAGATTCGGTAGTTATTGTCCAACTACCTGTGGCATTG
CAGATTTCCTGTCTACTTATCAAACCAAAGTAGACAAGGATCTACAGTCTTTGGAAGACATCTTACATCAAGTTGAAAACAAAACATCAG
AAGTCAAACAGCTGATAAAAGCAATCCAACTCACTTATAATCCTGATGAATCATCAAAACCAAATATGATAGACGCTGCTACTTTGAAGT
CCAGGAAAATGTTAGAAGAAATTATGAAATATGAAGCATCGATTTTAACACATGACTCAAGTATTCGATATTTGCAGGAAATATATAATT
CAAATAATCAAAAGATTGTTAACCTGAAAGAGAAGGTAGCCCAGCTTGAAGCACAGTGCCAGGAACCTTGCAAAGACACGGTGCAAATCC
ATGATATCACTGGGAAAGTAAAAGTCGATTCTCCTTCTCTAGATTGTCAAGACATTGCCAATAAGGGAGCTAAACAGAGCGGGCTTTACT
TTATTAAACCTCTGAAAGCTAACCAGCAATTCTTAGTCTACTGTGAAATCGATGGGTCTGGAAATGGATGGACTGTGTTTCAGAAGAGAC
TTGATGGCAGTGTAGATTTCAAGAAAAACTGGATTCAATATAAAGAAGGATTTGGACATCTGTCTCCTACTGGCACAACAGAATTTTGGC
TGGGAAATGAGAAGATTCATTTGATAAGCACACAGTCTGCCATCCCATATGCATTAAGAGTGGAACTGGAAGACTGGAATGGCAGAACCA
GTACTGCAGACTATGCCATGTTCAAGGTGGGACCTGAAGCTGACAAGTACCGCCTAACATATGCCTACTTCGCTGGTGGGGATGCTGGAG
ATGCCTTTGATGGCTTTGATTTTGGCGATGATCCTAGTGACAAGTTTTTCACATCCCATAATGGCATGCAGTTCAGTACCTGGGACAATG
ACAATGATAAGTTTGAAGGCAACTGTGCTGAACAGGATGGATCTGGTTGGTGGATGAACAAGTGTCACGCTGGCCATCTCAATGGAGTTT
ATTACCAAGTGCCACGCTGATCAATGAACAATGGCTGCTGACCACGGCTAAAAATCTCTTCCTGAACCATTCAGAAAATGCAACAGCGAA
AGACATTGCCCCTACTTTAACACTCTATGTGGGGAAAAAGCAGCTTGTAGAGATTGAGAAGGTTGTTCTACACCCTAACTACTCCCAGGT
AGATATTGGGCTCATCAAACTCAAACAGAAGGTGTCTGTTAATGAGAGAGTGATGCCCATCTGCCTACCTTCAAAGGATTATGCAGAAGT
AGGGCGTGTGGGTTATGTTTCTGGCTGGGGGCGAAATGCCAATTTTAAATTTACTGACCATCTGAAGTATGTCATGCTGCCTGTGGCTGA
CCAAGACCAATGCATAAGGCATTATGAAGGCAGCACAGTCCCCGAAAAGAAGACACCGAAGAGCCCTGTAGGGGTGCAGCCCATACTGAA
TGAACACACCTTCTGTGCTGGCATGTCTAAGTACCAAGAAGACACCTGCTATGGCGATGCGGGCAGTGCCTTTGCCGTTCACGACCTGGA
GGAGGACACCTGGTATGCGACTGGGATCTTAAGCTTTGATAAGAGCTGTGCTGTGGCTGAGTATGGTGTGTATGTGAAGGTGACTTCCAT
CCAGGACTGGGTTCAGAAGACCATAGCTGAGAACTAATGCAAGGCTGGCCGGAAGCCCTTGCCTGAAAGCAAGATTTCAGCCTGGAAGAG
GGCAAAGTGGACGGGAGTGGACAGGAGTGGATGCGATAAGATGTGGTTTGAAGCTGATGGGTGCCAGCCCTGCATTGCTGAGTCAATCAA


Top

FusionGenePPI for FGG_HP


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
FGGFGA, FGB, F13B, FGG, KHDRBS2, VKORC1, FN1, ASB6, ASB7, ASB12, CA8, ASCC1, DDX19B, ALDH2, CHD9, NUP93, ICAM1, HIST1H2BJ, MAPK6, RING1, SNX27, CDK15, CCNYL1HPHBB, MIS12, GRB2, RBBP6, ELAVL1, ATP7B, VKORC1, ALB, GADD45G, TGM2, RPL11, LAMC3, SMAD3, TBL1X, TP63, WASL, MVP, GDPD1, DDX19B, ICE2, EXOSC9, SORT1, APOA1, DDX31, SNX27, MAPK6


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for FGG_HP


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneFGGP02679DB00364SucralfateFibrinogen gamma chainsmall moleculeapproved

Top

RelatedDiseases for FGG_HP


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneFGGC0272350Dysfibrinogenemia, Congenital7ORPHANET;UNIPROT
HgeneFGGC0022548Keloid1CTD_human
HgeneFGGC0038356Stomach Neoplasms1CTD_human
HgeneFGGC2584774Congenital hypofibrinogenemia1ORPHANET;UNIPROT
TgeneHPC0041696Unipolar Depression4PSYGENET
TgeneHPC0011570Mental Depression3PSYGENET
TgeneHPC0011581Depressive disorder3PSYGENET
TgeneHPC0027051Myocardial Infarction3CTD_human
TgeneHPC1269683Major Depressive Disorder3PSYGENET
TgeneHPC0024530Malaria2CTD_human
TgeneHPC0525045Mood Disorders2PSYGENET
TgeneHPC0001723Affective Disorders, Psychotic1PSYGENET
TgeneHPC0002871Anemia1CTD_human
TgeneHPC0002895Anemia, Sickle Cell1CTD_human
TgeneHPC0003864Arthritis1CTD_human
TgeneHPC0004153Atherosclerosis1CTD_human
TgeneHPC0004364Autoimmune Diseases1CTD_human
TgeneHPC0007222Cardiovascular Diseases1CTD_human
TgeneHPC0011854Diabetes Mellitus, Insulin-Dependent1CTD_human
TgeneHPC0011860Diabetes Mellitus, Non-Insulin-Dependent1CTD_human
TgeneHPC0011875Diabetic Angiopathies1CTD_human
TgeneHPC0017416Genital Neoplasms, Female1CTD_human
TgeneHPC0018995Hemochromatosis1CTD_human
TgeneHPC0019054Hemolysis (disorder)1CTD_human
TgeneHPC0019163Hepatitis B1CTD_human
TgeneHPC0019693HIV Infections1CTD_human
TgeneHPC0020517Hypersensitivity1CTD_human
TgeneHPC0020538Hypertensive disease1CTD_human
TgeneHPC0023418leukemia1CTD_human
TgeneHPC0035305Retinal Detachment1CTD_human
TgeneHPC0036341Schizophrenia1CTD_human
TgeneHPC0041296Tuberculosis1CTD_human
TgeneHPC0085397Pasteurellaceae Infections1CTD_human
TgeneHPC0242339Dyslipidemias1CTD_human
TgeneHPC0342257Complications of Diabetes Mellitus1CTD_human
TgeneHPC0524909Hepatitis B, Chronic1CTD_human
TgeneHPC0524910Hepatitis C, Chronic1CTD_human
TgeneHPC0679360Foodborne Disease1CTD_human
TgeneHPC0852036Pregnancy associated hypertension1CTD_human
TgeneHPC1458155Mammary Neoplasms1CTD_human
TgeneHPC3279786ANHAPTOGLOBINEMIA1UNIPROT