FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 13366

FusionGeneSummary for FGF12_LRRC15

check button Fusion gene summary
Fusion gene informationFusion gene name: FGF12_LRRC15
Fusion gene ID: 13366
HgeneTgene
Gene symbol

FGF12

LRRC15

Gene ID

2257

131578

Gene namefibroblast growth factor 12leucine rich repeat containing 15
SynonymsEIEE47|FGF12B|FHF1LIB
Cytomap

3q28-q29

3q29

Type of geneprotein-codingprotein-coding
Descriptionfibroblast growth factor 12fibroblast growth factor 12Bfibroblast growth factor FGF-12bfibroblast growth factor homologous factor 1myocyte-activating factorleucine-rich repeat-containing protein 15hLibleucine-rich repeat protein induced by beta amyloidleucine-rich repeat protein induced by beta-amyloid homolog
Modification date2018051920180523
UniProtAcc

P61328

Q8TF66

Ensembl transtripts involved in fusion geneENST00000445105, ENST00000264730, 
ENST00000454309, ENST00000450716, 
ENST00000430714, ENST00000466144, 
ENST00000439944, ENST00000347624, 
ENST00000428839, 
Fusion gene scores* DoF score6 X 3 X 4=722 X 2 X 2=8
# samples 72
** MAII scorelog2(7/72*10)=-0.0406419844973459
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/8*10)=1.32192809488736
Context

PubMed: FGF12 [Title/Abstract] AND LRRC15 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUSCTCGA-51-6867-01AFGF12chr3

192444970

-LRRC15chr3

194081775

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000445105ENST00000439944FGF12chr3

192444970

-LRRC15chr3

194081775

-
5CDS-5UTRENST00000445105ENST00000347624FGF12chr3

192444970

-LRRC15chr3

194081775

-
5CDS-5UTRENST00000445105ENST00000428839FGF12chr3

192444970

-LRRC15chr3

194081775

-
Frame-shitENST00000264730ENST00000439944FGF12chr3

192444970

-LRRC15chr3

194081775

-
5CDS-5UTRENST00000264730ENST00000347624FGF12chr3

192444970

-LRRC15chr3

194081775

-
5CDS-5UTRENST00000264730ENST00000428839FGF12chr3

192444970

-LRRC15chr3

194081775

-
intron-3CDSENST00000454309ENST00000439944FGF12chr3

192444970

-LRRC15chr3

194081775

-
intron-5UTRENST00000454309ENST00000347624FGF12chr3

192444970

-LRRC15chr3

194081775

-
intron-5UTRENST00000454309ENST00000428839FGF12chr3

192444970

-LRRC15chr3

194081775

-
In-frameENST00000450716ENST00000439944FGF12chr3

192444970

-LRRC15chr3

194081775

-
5CDS-5UTRENST00000450716ENST00000347624FGF12chr3

192444970

-LRRC15chr3

194081775

-
5CDS-5UTRENST00000450716ENST00000428839FGF12chr3

192444970

-LRRC15chr3

194081775

-
Frame-shitENST00000430714ENST00000439944FGF12chr3

192444970

-LRRC15chr3

194081775

-
5CDS-5UTRENST00000430714ENST00000347624FGF12chr3

192444970

-LRRC15chr3

194081775

-
5CDS-5UTRENST00000430714ENST00000428839FGF12chr3

192444970

-LRRC15chr3

194081775

-
5UTR-3CDSENST00000466144ENST00000439944FGF12chr3

192444970

-LRRC15chr3

194081775

-
5UTR-5UTRENST00000466144ENST00000347624FGF12chr3

192444970

-LRRC15chr3

194081775

-
5UTR-5UTRENST00000466144ENST00000428839FGF12chr3

192444970

-LRRC15chr3

194081775

-

Top

FusionProtFeatures for FGF12_LRRC15


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
FGF12

P61328

LRRC15

Q8TF66

Involved in nervous system development and function.Involved in the positive regulation of voltage-gated sodiumchannel activity. Promotes neuronal excitability by elevating thevoltage dependence of neuronal sodium channel SCN8A fastinactivation. {ECO:0000269|PubMed:27164707}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for FGF12_LRRC15


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_FGF12_ENST00000450716_chr3_192444970_-_LRRC15_ENST00000439944_chr3_194081775_-_587aa
MESKGTATEALSPFAGGLPSLGCRVGLPWLP_RVYLLQGLPGGVHRGTHCGSAHPSALERHEPADPQHAHH_TQ_VPVPQTLSPHRPED_
EE_AVAHHAWGLPKPGLAALSQPRQQQAAGSAHRPLPGPGQPRVSPSVQ_PAVADPAGPLLPVQQPQGAAVARQPPGIHP_RSLRPPGRT
HEAQSGQE_PHPHLTQGLPAPGQPPGPPAV_EQAHGTPHGHF_WAC_PAGTGSAAEPDWTALPWSLPQQPQPPETLPVQQPHLPAATQRL
HAAAPAQPSYSLWEFPEGALSGDLRAHAQPAGALAL_QPHLFSTRQCLQQPPPVAGPDS_PQSDQLHLPGCLQRANGASGAVPPHQRTAG
PGRERLPHVGQPAEHLPAEQPPQTAPRETLRQRQWPHGHPAAEQPAGELAPRHLRSPGETV_AAAV_QSLEV_LRHPSAPQLAPAQPA_V
RDGHCTCVFQPSQCPRPVPHTHQCQRCCSKRPCPRGA_LPRNTMVPRHTQLP_HHIRLFYH_ANQPCGRLH_SDYHSGH__PQRLGHDPG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_FGF12_ENST00000450716_chr3_192444970_-_LRRC15_ENST00000439944_chr3_194081775_-_1762nt
ATGGAGAGCAAAGGCTATGCCACTGAAGCATTATCTCCTTTTGCTGGTGGGCTGCCAAGCCTGGGGTGCAGGGTTGGCCTACCATGGCTG
CCCTAGCGAGTGTACCTGCTCCAGGGCCTCCCAGGTGGAGTGCACCGGGGCACGCATTGTGGCAGTGCCCACCCCTCTGCCCTGGAACGC
CATGAGCCTGCAGATCCTCAACACGCACATCACTGAACTCAATGAGTCCCCGTTCCTCAATATCTCAGCCCTCATCGCCCTGAGGATTGA
GAAGAATGAGCTGTCGCGCATCACGCCTGGGGCCTTCCGAAACCTGGGCTCGCTGCGCTATCTCAGCCTCGCCAACAACAAGCTGCAGGT
TCTGCCCATCGGCCTCTTCCAGGGCCTGGACAGCCTCGAGTCTCTCCTTCTGTCCAGTAACCAGCTGTTGCAGATCCAGCCGGCCCACTT
CTCCCAGTGCAGCAACCTCAAGGAGCTGCAGTTGCACGGCAACCACCTGGAATACATCCCTGACGGAGCCTTCGACCACCTGGTAGGACT
CACGAAGCTCAATCTGGGCAAGAATAGCCTCACCCACATCTCACCCAGGGTCTTCCAGCACCTGGGCAACCTCCAGGTCCTCCGGCTGTA
TGAGAACAGGCTCACGGATATCCCCATGGGCACTTTTGATGGGCTTGTTAACCTGCAGGAACTGGCTCTGCAGCAGAACCAGATTGGACT
GCTCTCCCCTGGTCTCTTCCACAACAACCACAACCTCCAGAGACTCTACCTGTCCAACAACCACATCTCCCAGCTGCCACCCAGCGTCTT
CATGCAGCTGCCCCAGCTCAACCGTCTTACTCTCTTTGGGAATTCCCTGAAGGAGCTCTCTCCGGGGATCTTCGGGCCCATGCCCAACCT
GCGGGAGCTTTGGCTCTATGACAACCACATCTCTTCTCTACCCGACAATGTCTTCAGCAACCTCCGCCAGTTGCAGGTCCTGATTCTTAG
CCGCAATCAGATCAGCTTCATCTCCCCGGGTGCCTTCAACGGGCTAACGGAGCTTCGGGAGCTGTCCCTCCACACCAACGCACTGCAGGA
CCTGGACGGGAACGTCTTCCGCATGTTGGCCAACCTGCAGAACATCTCCCTGCAGAACAACCGCCTCAGACAGCTCCCAGGGAATATCTT
CGCCAACGTCAATGGCCTCATGGCCATCCAGCTGCAGAACAACCAGCTGGAGAACTTGCCCCTCGGCATCTTCGATCACCTGGGGAAACT
GTGTGAGCTGCGGCTGTATGACAATCCCTGGAGGTGTGACTCAGACATCCTTCCGCTCCGCAACTGGCTCCTGCTCAACCAGCCTAGGTT
AGGGACGGACACTGTACCTGTGTGTTTCAGCCCAGCCAATGTCCGAGGCCAGTCCCTCATTATCATCAATGTCAACGTTGCTGTTCCAAG
CGTCCATGTCCCCGAGGTGCCTAGTTACCCAGAAACACCATGGTACCCAGACACACCCAGTTACCCTGACACCACATCCGTCTCTTCTAC
CACTGAGCTAACCAGCCCTGTGGAAGACTACACTGATCTGACTACCATTCAGGTCACTGATGACCGCAGCGTTTGGGGCATGACCCAGGC
CCAGAGCGGGCTGGCCATTGCCGCCATTGTAATTGGCATTGTCGCCCTGGCCTGCTCCCTGGCTGCCTGCGTCGGCTGTTGCTGCTGCAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_FGF12_ENST00000450716_chr3_192444970_-_LRRC15_ENST00000439944_chr3_194081775_-_6004nt
TTAAAGCAGGAGCCTTGAGAGCCTGATAAGCTGTTGACACAAGTGCTTTTGAGAATAGCAGGAAGCCTGAGGGGAAGGAAGGAAGTACGG
GCGAAATCATCAGATTGGCTTCCCAGATTTGGGAATCTGAAGCGGGCCCACATCTTCCGGCCAACTTCCATTGAACTTCCCAGCACTCGA
AAGGGACCGAAATGGAGAGCAAAGGCTATGCCACTGAAGCATTATCTCCTTTTGCTGGTGGGCTGCCAAGCCTGGGGTGCAGGGTTGGCC
TACCATGGCTGCCCTAGCGAGTGTACCTGCTCCAGGGCCTCCCAGGTGGAGTGCACCGGGGCACGCATTGTGGCAGTGCCCACCCCTCTG
CCCTGGAACGCCATGAGCCTGCAGATCCTCAACACGCACATCACTGAACTCAATGAGTCCCCGTTCCTCAATATCTCAGCCCTCATCGCC
CTGAGGATTGAGAAGAATGAGCTGTCGCGCATCACGCCTGGGGCCTTCCGAAACCTGGGCTCGCTGCGCTATCTCAGCCTCGCCAACAAC
AAGCTGCAGGTTCTGCCCATCGGCCTCTTCCAGGGCCTGGACAGCCTCGAGTCTCTCCTTCTGTCCAGTAACCAGCTGTTGCAGATCCAG
CCGGCCCACTTCTCCCAGTGCAGCAACCTCAAGGAGCTGCAGTTGCACGGCAACCACCTGGAATACATCCCTGACGGAGCCTTCGACCAC
CTGGTAGGACTCACGAAGCTCAATCTGGGCAAGAATAGCCTCACCCACATCTCACCCAGGGTCTTCCAGCACCTGGGCAACCTCCAGGTC
CTCCGGCTGTATGAGAACAGGCTCACGGATATCCCCATGGGCACTTTTGATGGGCTTGTTAACCTGCAGGAACTGGCTCTGCAGCAGAAC
CAGATTGGACTGCTCTCCCCTGGTCTCTTCCACAACAACCACAACCTCCAGAGACTCTACCTGTCCAACAACCACATCTCCCAGCTGCCA
CCCAGCGTCTTCATGCAGCTGCCCCAGCTCAACCGTCTTACTCTCTTTGGGAATTCCCTGAAGGAGCTCTCTCCGGGGATCTTCGGGCCC
ATGCCCAACCTGCGGGAGCTTTGGCTCTATGACAACCACATCTCTTCTCTACCCGACAATGTCTTCAGCAACCTCCGCCAGTTGCAGGTC
CTGATTCTTAGCCGCAATCAGATCAGCTTCATCTCCCCGGGTGCCTTCAACGGGCTAACGGAGCTTCGGGAGCTGTCCCTCCACACCAAC
GCACTGCAGGACCTGGACGGGAACGTCTTCCGCATGTTGGCCAACCTGCAGAACATCTCCCTGCAGAACAACCGCCTCAGACAGCTCCCA
GGGAATATCTTCGCCAACGTCAATGGCCTCATGGCCATCCAGCTGCAGAACAACCAGCTGGAGAACTTGCCCCTCGGCATCTTCGATCAC
CTGGGGAAACTGTGTGAGCTGCGGCTGTATGACAATCCCTGGAGGTGTGACTCAGACATCCTTCCGCTCCGCAACTGGCTCCTGCTCAAC
CAGCCTAGGTTAGGGACGGACACTGTACCTGTGTGTTTCAGCCCAGCCAATGTCCGAGGCCAGTCCCTCATTATCATCAATGTCAACGTT
GCTGTTCCAAGCGTCCATGTCCCCGAGGTGCCTAGTTACCCAGAAACACCATGGTACCCAGACACACCCAGTTACCCTGACACCACATCC
GTCTCTTCTACCACTGAGCTAACCAGCCCTGTGGAAGACTACACTGATCTGACTACCATTCAGGTCACTGATGACCGCAGCGTTTGGGGC
ATGACCCAGGCCCAGAGCGGGCTGGCCATTGCCGCCATTGTAATTGGCATTGTCGCCCTGGCCTGCTCCCTGGCTGCCTGCGTCGGCTGT
TGCTGCTGCAAGAAGAGGAGCCAAGCTGTCCTGATGCAGATGAAGGCACCCAATGAGTGTTAAAGAGGCAGGCTGGAGCAGGGCTGGGGA
ATGATGGGACTGGAGGACCTGGGAATTTCATCTTTCTGCCTCCACCCCTGGGTCCATGGAGCTTTCCCGTGATTGCTCTTTCTGGCCCCA
GAGAAAGGTGAGCCTACCTCTTCCTGACTTGCCTGATTCTCCCGTAGAGAAGCAGGTCGTGCCGGACCTTCCTACAATCAGGAAGATAGA
TCCAACTGGCCATGGCAAAAGCCCTGGGGATTTCCGATTCATACCCCTGGGCTTCCTTCGAGAGGGCTCTTCCTCCAAATCCTCCCCACC
TGTCCTCCAAGAACAGCCTTCCCTGCGCCCAGGCCCCCTCCGGGCCTCTGTAGACTCAGTTAGTCCACAGCCTGCTCACTTCGTGGGAAT
AGTTCTCCGCTGAGATAGCCCCTCTCGCCTAAGTATTATGTAAGTTGATTTCCCTTCTTTTGTTTCTCTTGTTTGTGCTACGGCTTGACC
CAGCATGTCCCCTCAAATGAAAGTTCTCCCCTTGATTTTCTGCTCCTGAAGGCAGGGTGAGTTCTCTCCTCAAAGAAGACTTCAAACCAT
TTAACTGGTTTCTTAAGAGCCGTCAATCAGCCTGGTTTTGGGGATGCTATGAAAGAGAGAAGGAAAATCATGCCGCTCAGTTCCTGGAGA
CAGAAGAGCCGTCATCAGTGTCTCACTTGTGATTTTTATCTGGAAAAGGAAGAAACACCCCAGCACAGCAAGCTCAGCCTTTTAGAGAAG
GATATTTCCAAACTGCAAACTTTGCTTTGAAAAGTTTAGCCCTTTAAGGAATGAAATCATGTAGAATTTTGGACTTCTAAAAACATTAAA
ATCAGCTTATTAATACGGGATAGAGAAAGAAATCTGGTGCCTGGGGGTCCCTGTGTTCACCCCTAGAGTTTGTTTTAAAATTTTTAATTG
AAGCATGTGAAGTGTACGTGCAGAAAAGTGGGAACATGATAGTGTATGGCTTGGTGGATTTTCACAAACTGAACATACCTGTGTAATCAG
CATCTAGACCCAGACCCAGAGCATCACAAATATCCCCCATCCTGGGCTTTTCCCAGAGGAGATGGGGGCTTCTGAAGATGGACTTACCTG
GGACCTGCCCCCCATGAGCCAGGACGGTCCCCCCACAGTCAGCCTGTGCAAAGGCCCCGTGGCCAGGGGTGGAGGAGAATATGTGGGTGT
GGACAGGATGGGAGACTGTGGCCTGAACAGGAGATTTTATTATATCTGGAGACCCTGAGAGACCCTGAGACCTGGGGCACCATGGCTGGC
CAGGTCAGAAGCATCCTGACTGCAGAGGTCCGTGCAGCCACACCCTCTTCCCTGCCAGCAAGCTGTCTGCGGCTCATCGGAGGCCCCTCC
GCCTGGAGCCTTCTATGGACGTGATATGCCTGTATCTGTTTTTAATTTTCATTCTTCACTTAGGGGAAGTGAAATCGCTCAGAGATGAGA
TCCTTTAATTGAAAACGAAGTGTAACGGAATCTAGTGTCTTTCTAATGTGGTAAAATTCTCCATCAACATCACAGTCAGCTGGCAGCTGA
ACTTCAGAATCTCACTTACAGCAGGCGACACGGGGGTACACCGATGGGTCACACTGGGTCTGGGGGCTCCCTGGAGCTCCTCCTGCGTGT
GGTCTGGTTAGGAGTTGAGTTGTTTGCTCCAGGGTTATTCTCCTCCTCGAGTCACAGTCACACGAATACCTGCCTTCTCTGGCTTTCCTG
CTATACACATATTCACATGGCGCTCAAGAAGTTAGGCTCATGGCAACGTGTGTCTTTCTCTGGACAACTGGCCCAGTTTACAGTGAAATG
GAGAATTTCAGGTCTCCACGTCTGCCCAGGAAAGAACTTCAGCTGACTCCACGGGGATCTGGAAATCCACGACCAATCCCGATCGGCTCT
TATTAGCTCCCCGCTCCACAAGACACCTGTGCTTTGGAAATCCACCACCAATCCCGATCGGCTCTTATTAGCTCCCCGCTCCACAAGACA
CCTGTGATCTGGAAATCTACCACCAATCCCGATCGGCTCTTATTAGCTCCCCGCTCCACAAGACACCTGTGACATCCTCCAGGGCCACAG
GAGCACGTGCTGACCAGTTTTCCCTTCCAGTTCCTGCACAAAAAGTGTCCAGAGGGCTGTTTGCAAACACTAGTGCACTTTGTAGCTTTT
CACCCTCTGTCCCAGGGAATCTAGGAGAGATGAGGCCCGTCAGAGTCAAGAGATGTCATCCCCCCAGGGTCTCCAAGGCATTTCCACACT
ATTGGTGGCACCTGGAGGACATGCACCAAGGCTTGCCAGAGCCAACAGGAAGTGAGCCCAGAGCATGGCACATGAGCATCACCCGCTGAT
GGTGGCCTGCTGTGCCTGGTGCCAACAGGGGCATCCCGGCCCGTACCCCTCCAGACAGGAAGCATGGGTTTGCCCACAGACCTGTCGGGT
GCTCCTGTGAGTGGCCTCCAGATGTCTTTGTGCATAGGCACAAGTGGGCCAGGGCTGGAGGGAGGTGGGAAACCTCATCATCCGGTGGGC
CCTGCCAATCTTAACCCAGAACCCTTAGGTATTCCTGGCAGTAGCCATGACATTGGAGCACCTTCCTCTCCAGCCAGAGGCTGACCTGAG
GGCCACTGTCCTCAGATGACACCACCCAGGAGCACCCTAGGTGAGGGGTGAGGGCCCCCTTATGTGAACCTCTTGCCTCTTCCTTTCTCC
CATCAGAGTGGTTGGATGGAGCCATTGGCCTCCTTTTCTTCAGCGGGCCCTTCAACCTCTCTGCACCATGTTGTCTGGCTGAGGAGCTAC
TAGAAAAGCTGAGTGGAGTCTCCTTTCCAACAGGATGATGCATTTGCTCAATTCTCAGGGCTGGAATGAGCCGGCTGGTCCCCCAGAAAG
CTGGAGTGGGGTACAGAGTTCAGTTTTCCTCTCTGTTTACAGCTCCTTGACAGTCCCACGCCCATCTGGAGTGGGAGCTGGGAGTCAGTG
TTGGAGAAGAAACAACAAAAGCCAATTAGAACCACTATTTTTAAAAAGTGCTTACTGTGCACAGATACTCTTCAAGCACTGGACGTGGAT
TCTCTCTCTAGCCCTCAGCACCCCTGCGGTAGGAGTGCCGCCTCTACCCACTTGTGATGGGGTACAGAGGCACTTGCTCTTCTGCATGGT
GTTCAATAGGCTGGGAGTTTTATTTATCTCTTCAAACTTTGTACAAGAGCTCATGGCTTGTCTTGGGCTTTCGTCATTAAACCAAAGGAA
ATGGAAGCCATTCCCCTGTTGCTCTCCTTAGTCTTGGTCATCAGAACCTCACTTGGTACCATATAGATCAAAAGCTTTGTAACCACAGGA
AAAAATAAACTCTTCCATCCCTTAAAGAATAGAATAGTTTGTCCCTCTCATGGGAATTGGGCTGTATGTATATTGTTCTTCCTCCTTAGA
ATTTAGAGATACAAGAGTTCTACTTAGAACTTTTCATGGACACAATTTCCACAACCTTTCAGATGCTGATGTAGAGCTATTGGGAAAGAA
CTTCCAAACTCAGGAAGTTTGCAGAGAGCAGACAGCTAGAGATAACTCGGGACCCAGAGTTGGTCGACAGATGTTAGATGTATCCTAGCT
TTTAGCTATAAACCACTCAAAGATTCAGCCCCCAGATCCCACAGTCAGAACTGAATCTGCGTTGTTGGGAAGCCAGCAGTGGCCTTGGGA
AGGAAGCCATGGCTGTGGTTCAGAGAGGGTGGGCTGGCAAGCCACTTCCGGGGAAAACTCCTTCCGCCCCAGGTTTCTTCTTCTCTTAAG
GAGAGATTGTTCTCACCAACCCGCTGCCTTCATGCTGCCTTCAAAGCTAGATCATGTTTGCCTTGCTTAGAGAATTACTGCAAATCAGCC
CCAGTGCTTGGCGATGCATTTACAGATTTCTAGGCCCTCAGGGTTTTGTAGAGTGTGAGCCCTGGTGGGCAGGGTTGGGGGGTCTGTCTT


Top

FusionGenePPI for FGF12_LRRC15


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
FGF12MAPK13, MAPK8IP2, NEDD4, NEDD4L, APP, SRPK2, SRPK1, DACH1, DCTD, COIL, IKZF1, ZNF460, LZTS2, DPPA2, SMURF1, YWHAELRRC15USP15, KHDRBS2, TARDBP, TEX35, COASY, PMM1, ELMOD1, OTULIN, B3GALNT1, MRPS27, RAB40AL, DNASE1L1, PSMD7, ANXA5, RAB11B, OR51E2, P2RY8, TFG, DOLPP1, SGOL2, MAPK9, LACC1, PYHIN1, SMARCD1, RPS6KB2, CLEC11A, GDF5, C1GALT1, IL31RA, FBXL4, FMOD, MRPL38, DFFB, GSC, TBC1D14, OAZ3, CCDC173, KIF3A, DDIT4L, SLC27A6, HEATR1, CPLX3, SYT16, GPBP1, SETDB2, RPN2, USP1, FOXP2, RAB11FIP4, ZMAT4, C1R, POPDC2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for FGF12_LRRC15


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for FGF12_LRRC15


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource