FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 12760

FusionGeneSummary for FAM219A_PAX5

check button Fusion gene summary
Fusion gene informationFusion gene name: FAM219A_PAX5
Fusion gene ID: 12760
HgeneTgene
Gene symbol

FAM219A

PAX5

Gene ID

203259

5079

Gene namefamily with sequence similarity 219 member Apaired box 5
SynonymsC9orf25ALL3|BSAP
Cytomap

9p13.3

9p13.2

Type of geneprotein-codingprotein-coding
Descriptionprotein FAM219Auncharacterized protein C9orf25paired box protein Pax-5B-cell lineage specific activatorpaired box homeotic gene 5paired domain gene 5transcription factor PAX 5
Modification date2018051920180520
UniProtAcc

Q8IW50

Q02548

Ensembl transtripts involved in fusion geneENST00000379081, ENST00000379087, 
ENST00000379080, ENST00000379084, 
ENST00000379089, ENST00000445726, 
ENST00000297620, ENST00000379078, 
ENST00000358127, ENST00000523241, 
ENST00000520154, ENST00000377852, 
ENST00000377853, ENST00000522003, 
ENST00000520281, ENST00000414447, 
ENST00000523145, ENST00000446742, 
ENST00000377847, 
Fusion gene scores* DoF score6 X 4 X 4=967 X 5 X 5=175
# samples 77
** MAII scorelog2(7/96*10)=-0.45567948377619
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(7/175*10)=-1.32192809488736
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: FAM219A [Title/Abstract] AND PAX5 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-A7-A13D-01AFAM219Achr9

34458202

-PAX5chr9

36923481

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
intron-3CDSENST00000379081ENST00000358127FAM219Achr9

34458202

-PAX5chr9

36923481

-
intron-intronENST00000379081ENST00000523241FAM219Achr9

34458202

-PAX5chr9

36923481

-
intron-intronENST00000379081ENST00000520154FAM219Achr9

34458202

-PAX5chr9

36923481

-
intron-intronENST00000379081ENST00000377852FAM219Achr9

34458202

-PAX5chr9

36923481

-
intron-intronENST00000379081ENST00000377853FAM219Achr9

34458202

-PAX5chr9

36923481

-
intron-intronENST00000379081ENST00000522003FAM219Achr9

34458202

-PAX5chr9

36923481

-
intron-intronENST00000379081ENST00000520281FAM219Achr9

34458202

-PAX5chr9

36923481

-
intron-intronENST00000379081ENST00000414447FAM219Achr9

34458202

-PAX5chr9

36923481

-
intron-intronENST00000379081ENST00000523145FAM219Achr9

34458202

-PAX5chr9

36923481

-
intron-intronENST00000379081ENST00000446742FAM219Achr9

34458202

-PAX5chr9

36923481

-
intron-intronENST00000379081ENST00000377847FAM219Achr9

34458202

-PAX5chr9

36923481

-
In-frameENST00000379087ENST00000358127FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000379087ENST00000523241FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000379087ENST00000520154FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000379087ENST00000377852FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000379087ENST00000377853FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000379087ENST00000522003FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000379087ENST00000520281FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000379087ENST00000414447FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000379087ENST00000523145FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000379087ENST00000446742FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000379087ENST00000377847FAM219Achr9

34458202

-PAX5chr9

36923481

-
intron-3CDSENST00000379080ENST00000358127FAM219Achr9

34458202

-PAX5chr9

36923481

-
intron-intronENST00000379080ENST00000523241FAM219Achr9

34458202

-PAX5chr9

36923481

-
intron-intronENST00000379080ENST00000520154FAM219Achr9

34458202

-PAX5chr9

36923481

-
intron-intronENST00000379080ENST00000377852FAM219Achr9

34458202

-PAX5chr9

36923481

-
intron-intronENST00000379080ENST00000377853FAM219Achr9

34458202

-PAX5chr9

36923481

-
intron-intronENST00000379080ENST00000522003FAM219Achr9

34458202

-PAX5chr9

36923481

-
intron-intronENST00000379080ENST00000520281FAM219Achr9

34458202

-PAX5chr9

36923481

-
intron-intronENST00000379080ENST00000414447FAM219Achr9

34458202

-PAX5chr9

36923481

-
intron-intronENST00000379080ENST00000523145FAM219Achr9

34458202

-PAX5chr9

36923481

-
intron-intronENST00000379080ENST00000446742FAM219Achr9

34458202

-PAX5chr9

36923481

-
intron-intronENST00000379080ENST00000377847FAM219Achr9

34458202

-PAX5chr9

36923481

-
In-frameENST00000379084ENST00000358127FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000379084ENST00000523241FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000379084ENST00000520154FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000379084ENST00000377852FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000379084ENST00000377853FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000379084ENST00000522003FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000379084ENST00000520281FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000379084ENST00000414447FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000379084ENST00000523145FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000379084ENST00000446742FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000379084ENST00000377847FAM219Achr9

34458202

-PAX5chr9

36923481

-
In-frameENST00000379089ENST00000358127FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000379089ENST00000523241FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000379089ENST00000520154FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000379089ENST00000377852FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000379089ENST00000377853FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000379089ENST00000522003FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000379089ENST00000520281FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000379089ENST00000414447FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000379089ENST00000523145FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000379089ENST00000446742FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000379089ENST00000377847FAM219Achr9

34458202

-PAX5chr9

36923481

-
In-frameENST00000445726ENST00000358127FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000445726ENST00000523241FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000445726ENST00000520154FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000445726ENST00000377852FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000445726ENST00000377853FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000445726ENST00000522003FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000445726ENST00000520281FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000445726ENST00000414447FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000445726ENST00000523145FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000445726ENST00000446742FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000445726ENST00000377847FAM219Achr9

34458202

-PAX5chr9

36923481

-
In-frameENST00000297620ENST00000358127FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000297620ENST00000523241FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000297620ENST00000520154FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000297620ENST00000377852FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000297620ENST00000377853FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000297620ENST00000522003FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000297620ENST00000520281FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000297620ENST00000414447FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000297620ENST00000523145FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000297620ENST00000446742FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000297620ENST00000377847FAM219Achr9

34458202

-PAX5chr9

36923481

-
In-frameENST00000379078ENST00000358127FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000379078ENST00000523241FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000379078ENST00000520154FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000379078ENST00000377852FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000379078ENST00000377853FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000379078ENST00000522003FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000379078ENST00000520281FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000379078ENST00000414447FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000379078ENST00000523145FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000379078ENST00000446742FAM219Achr9

34458202

-PAX5chr9

36923481

-
5CDS-intronENST00000379078ENST00000377847FAM219Achr9

34458202

-PAX5chr9

36923481

-

Top

FusionProtFeatures for FAM219A_PAX5


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
FAM219A

Q8IW50

PAX5

Q02548


check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for FAM219A_PAX5


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_FAM219A_ENST00000379087_chr9_34458202_-_PAX5_ENST00000358127_chr9_36923481_-_151aa
MEEIDRFQVPTAHSEMQPLTTETSAMASLAGGLDDMKANLASPTPADIGSSVPGPQSYPIVTGRDLASTTLPGYPPHVPPAGQGSYSAPT

>In-frame_FAM219A_ENST00000379084_chr9_34458202_-_PAX5_ENST00000358127_chr9_36923481_-_151aa
MEEIDRFQVPTAHSEMQPLTTETSAMASLAGGLDDMKANLASPTPADIGSSVPGPQSYPIVTGRDLASTTLPGYPPHVPPAGQGSYSAPT

>In-frame_FAM219A_ENST00000379089_chr9_34458202_-_PAX5_ENST00000358127_chr9_36923481_-_151aa
MEEIDRFQVPTAHSEMQPLTTETSAMASLAGGLDDMKANLASPTPADIGSSVPGPQSYPIVTGRDLASTTLPGYPPHVPPAGQGSYSAPT

>In-frame_FAM219A_ENST00000445726_chr9_34458202_-_PAX5_ENST00000358127_chr9_36923481_-_152aa
MMEEIDRFQVPTAHSEMQPLTTETSAMASLAGGLDDMKANLASPTPADIGSSVPGPQSYPIVTGRDLASTTLPGYPPHVPPAGQGSYSAP

>In-frame_FAM219A_ENST00000297620_chr9_34458202_-_PAX5_ENST00000358127_chr9_36923481_-_152aa
MMEEIDRFQVPTAHSEMQPLTTETSAMASLAGGLDDMKANLASPTPADIGSSVPGPQSYPIVTGRDLASTTLPGYPPHVPPAGQGSYSAP

>In-frame_FAM219A_ENST00000379078_chr9_34458202_-_PAX5_ENST00000358127_chr9_36923481_-_151aa
MEEIDRFQVPTAHSEMQPLTTETSAMASLAGGLDDMKANLASPTPADIGSSVPGPQSYPIVTGRDLASTTLPGYPPHVPPAGQGSYSAPT


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_FAM219A_ENST00000379087_chr9_34458202_-_PAX5_ENST00000358127_chr9_36923481_-_453nt
ATGGAGGAGATCGACCGGTTCCAGGTGCCCACCGCGCACTCGGAGATGCAGCCGCTGACCACAGAGTATTCAGCCATGGCCTCGCTGGCT
GGTGGGCTGGACGACATGAAGGCCAATCTGGCCAGCCCCACCCCTGCTGACATCGGGAGCAGTGTGCCAGGCCCGCAGTCCTACCCCATT
GTGACAGGCCGTGACTTGGCGAGCACGACCCTCCCCGGGTACCCTCCACACGTCCCCCCCGCTGGACAGGGCAGCTACTCAGCACCGACG
CTGACAGGGATGGTGCCTGGGAGTGAGTTTTCCGGGAGTCCCTACAGCCACCCTCAGTATTCCTCGTACAACGACTCCTGGAGGTTCCCC
AACCCGGGGCTGCTTGGCTCCCCCTACTATTATAGCGCTGCCGCCCGAGGAGCCGCCCCACCTGCAGCCGCCACTGCCTATGACCGTCAC

>In-frame_FAM219A_ENST00000379084_chr9_34458202_-_PAX5_ENST00000358127_chr9_36923481_-_453nt
ATGGAGGAGATCGACCGGTTCCAGGTGCCCACCGCGCACTCGGAGATGCAGCCGCTGACCACAGAGTATTCAGCCATGGCCTCGCTGGCT
GGTGGGCTGGACGACATGAAGGCCAATCTGGCCAGCCCCACCCCTGCTGACATCGGGAGCAGTGTGCCAGGCCCGCAGTCCTACCCCATT
GTGACAGGCCGTGACTTGGCGAGCACGACCCTCCCCGGGTACCCTCCACACGTCCCCCCCGCTGGACAGGGCAGCTACTCAGCACCGACG
CTGACAGGGATGGTGCCTGGGAGTGAGTTTTCCGGGAGTCCCTACAGCCACCCTCAGTATTCCTCGTACAACGACTCCTGGAGGTTCCCC
AACCCGGGGCTGCTTGGCTCCCCCTACTATTATAGCGCTGCCGCCCGAGGAGCCGCCCCACCTGCAGCCGCCACTGCCTATGACCGTCAC

>In-frame_FAM219A_ENST00000379089_chr9_34458202_-_PAX5_ENST00000358127_chr9_36923481_-_453nt
ATGGAGGAGATCGACCGGTTCCAGGTGCCCACCGCGCACTCGGAGATGCAGCCGCTGACCACAGAGTATTCAGCCATGGCCTCGCTGGCT
GGTGGGCTGGACGACATGAAGGCCAATCTGGCCAGCCCCACCCCTGCTGACATCGGGAGCAGTGTGCCAGGCCCGCAGTCCTACCCCATT
GTGACAGGCCGTGACTTGGCGAGCACGACCCTCCCCGGGTACCCTCCACACGTCCCCCCCGCTGGACAGGGCAGCTACTCAGCACCGACG
CTGACAGGGATGGTGCCTGGGAGTGAGTTTTCCGGGAGTCCCTACAGCCACCCTCAGTATTCCTCGTACAACGACTCCTGGAGGTTCCCC
AACCCGGGGCTGCTTGGCTCCCCCTACTATTATAGCGCTGCCGCCCGAGGAGCCGCCCCACCTGCAGCCGCCACTGCCTATGACCGTCAC

>In-frame_FAM219A_ENST00000445726_chr9_34458202_-_PAX5_ENST00000358127_chr9_36923481_-_456nt
ATGATGGAGGAGATCGACCGGTTCCAGGTGCCCACCGCGCACTCGGAGATGCAGCCGCTGACCACAGAGTATTCAGCCATGGCCTCGCTG
GCTGGTGGGCTGGACGACATGAAGGCCAATCTGGCCAGCCCCACCCCTGCTGACATCGGGAGCAGTGTGCCAGGCCCGCAGTCCTACCCC
ATTGTGACAGGCCGTGACTTGGCGAGCACGACCCTCCCCGGGTACCCTCCACACGTCCCCCCCGCTGGACAGGGCAGCTACTCAGCACCG
ACGCTGACAGGGATGGTGCCTGGGAGTGAGTTTTCCGGGAGTCCCTACAGCCACCCTCAGTATTCCTCGTACAACGACTCCTGGAGGTTC
CCCAACCCGGGGCTGCTTGGCTCCCCCTACTATTATAGCGCTGCCGCCCGAGGAGCCGCCCCACCTGCAGCCGCCACTGCCTATGACCGT

>In-frame_FAM219A_ENST00000297620_chr9_34458202_-_PAX5_ENST00000358127_chr9_36923481_-_456nt
ATGATGGAGGAGATCGACCGGTTCCAGGTGCCCACCGCGCACTCGGAGATGCAGCCGCTGACCACAGAGTATTCAGCCATGGCCTCGCTG
GCTGGTGGGCTGGACGACATGAAGGCCAATCTGGCCAGCCCCACCCCTGCTGACATCGGGAGCAGTGTGCCAGGCCCGCAGTCCTACCCC
ATTGTGACAGGCCGTGACTTGGCGAGCACGACCCTCCCCGGGTACCCTCCACACGTCCCCCCCGCTGGACAGGGCAGCTACTCAGCACCG
ACGCTGACAGGGATGGTGCCTGGGAGTGAGTTTTCCGGGAGTCCCTACAGCCACCCTCAGTATTCCTCGTACAACGACTCCTGGAGGTTC
CCCAACCCGGGGCTGCTTGGCTCCCCCTACTATTATAGCGCTGCCGCCCGAGGAGCCGCCCCACCTGCAGCCGCCACTGCCTATGACCGT

>In-frame_FAM219A_ENST00000379078_chr9_34458202_-_PAX5_ENST00000358127_chr9_36923481_-_453nt
ATGGAGGAGATCGACCGGTTCCAGGTGCCCACCGCGCACTCGGAGATGCAGCCGCTGACCACAGAGTATTCAGCCATGGCCTCGCTGGCT
GGTGGGCTGGACGACATGAAGGCCAATCTGGCCAGCCCCACCCCTGCTGACATCGGGAGCAGTGTGCCAGGCCCGCAGTCCTACCCCATT
GTGACAGGCCGTGACTTGGCGAGCACGACCCTCCCCGGGTACCCTCCACACGTCCCCCCCGCTGGACAGGGCAGCTACTCAGCACCGACG
CTGACAGGGATGGTGCCTGGGAGTGAGTTTTCCGGGAGTCCCTACAGCCACCCTCAGTATTCCTCGTACAACGACTCCTGGAGGTTCCCC
AACCCGGGGCTGCTTGGCTCCCCCTACTATTATAGCGCTGCCGCCCGAGGAGCCGCCCCACCTGCAGCCGCCACTGCCTATGACCGTCAC


* Fusion transcript sequences (Full-length transcript).
>In-frame_FAM219A_ENST00000379087_chr9_34458202_-_PAX5_ENST00000358127_chr9_36923481_-_8030nt
AGCTGCTGACAGGAGGCGGCAGCGGAGTAGGAGGCGAGGCAAGACCTGCGGCTCGGCCCGGCCACAGCCGCGGTAGTGCTAGGCAAGCCC
ACGGAGTCACGCCGGCCTCAGCCAGTCTGCGAACCTCTCGCCCCCGCCCACCCCTGCATCCGCCCGGCCCCTGCCCGCCCGAGTGGTCCG
GGGAGGCCTAGTCTGCACCACCCGCCGGGCTCCTGGGGCCGCCGCCCCGCGCGGTCCTGTCGGCGTCCGCGGCCGCGCCCGGCCCCTGGC
CCGCTCGCCCGCCGGCACCATGATGGAGGAGATCGACCGGTTCCAGGTGCCCACCGCGCACTCGGAGATGCAGCCGCTGACCACAGAGTA
TTCAGCCATGGCCTCGCTGGCTGGTGGGCTGGACGACATGAAGGCCAATCTGGCCAGCCCCACCCCTGCTGACATCGGGAGCAGTGTGCC
AGGCCCGCAGTCCTACCCCATTGTGACAGGCCGTGACTTGGCGAGCACGACCCTCCCCGGGTACCCTCCACACGTCCCCCCCGCTGGACA
GGGCAGCTACTCAGCACCGACGCTGACAGGGATGGTGCCTGGGAGTGAGTTTTCCGGGAGTCCCTACAGCCACCCTCAGTATTCCTCGTA
CAACGACTCCTGGAGGTTCCCCAACCCGGGGCTGCTTGGCTCCCCCTACTATTATAGCGCTGCCGCCCGAGGAGCCGCCCCACCTGCAGC
CGCCACTGCCTATGACCGTCACTGACCCTTGGAGCCAGGCGGGCACCAAACACTGATGGCACCTATTGAGGGTGACAGCCACCCAGCCCT
CCTGAAGATAGCCAGAGAGCCCATGAGACCGTCCCCCAGCATCCCCCACTTGCCTGAAGCTCCCCTCTTCCTCTCTTCCTCCAGGGACTC
TGGGGCCCTTTGGTGGGGCCGTTGGACTTCTGGATGCTTGTCTATTTCTAAAAGCCAATCTATGAGCTTCTCCCGATGGCCACTGGGTCT
CTGCAAACCAATAGACTGTCCTGCAAATAACCGCAGCCCCAGCCCAGCCTGCCTGTCCTCCAGCTGTCTGACTATCCATCCATCATAACC
ACCCCAGCCTGGGAAGGAGAGCTTGCTTTTGTTGCTTCAGCAGCACCCATGTAAATACCTTCTTGCTTTTCTGTGGGCCTGAAGGTCCGA
CTGAGAAGACTGCTCCACCCATGATGCATCTCGCACTCTTGGTGCATCACCGGACATCTTAGACCTATGGCAGAGCATCCTCTCTGCCCT
GGGTGACCCTGGCAGGTGCGCTCAGAGCTGTCCTCAAGATGGAGGATGCTGCCCTTGGGCCCCAGCCTCCTGCTCATCCCTCCTTCTTTA
GTATCTTTACGAGGAGTCTCACTGGGCTGGTTGTGCTGCAGGCTCCCCCTGAGGCCCCTCTCCAAGAGGAGCACACTTTGGGGAGATGTC
CTGGTTTCCTGCCTCCATTTCTCTGGGACCGATGCAGTATCAGCAGCTCTTTTCCAGATCAAAGAACTCAAAGAAAACTGTCTGGGAGAT
TCCTCAGCTACTTTTCCGAAGCAGAATGTCATCCGAGGTATTGATTACATTGTGGACTTTGAATGTGAGGGCTGGATGGGACGCAGGAGA
TCATCTGATCCCAGCCAAGGAGGGGCCTGAGGCTCTCCCTACTCCCTCAGCCCCTGGAACGGTGTTTTCTGAGGCATGCCCAGGTTCAGG
TCACTTCGGACACCTGCCATGGACACTTCACCCACCCTCCAGGACCCCAGCAAGTGGATTCTGGGCAAGCCTGTTCCGGTGATGTAGACA
ATAATTAACACAGAGGACTTTCCCCCACACCCAGATCACAAACAGCCTACAGCCAGAACTTCTGAGCATCCTCTCGGGGCAGACCCTCCC
CGTCCTCGTGGAGCTTAGCAGGCAGCTGGGCATGGAGGTGCTGGGGCTGGGGCAGATGCCTAATTTCGCACAATGCATGCCCACCTGTTG
ATCTAAGGGGCCGCGATGGTCAGGGCCACGGCCAAGGGCCACGGGAACTTGGAGAGGGAGCTTGGAGAACTCACTGTGGGCTAGGGTGGT
CAGAGGAAGCCAGCAGGGAAGATCTGGGGGACAGAGGAAGGCCTCCTGAGGGAGGGGCAGGAGAGCAGTGAGGAGCTGCTGTGTGACCTG
GGAGTGATTTTGACATGGGGGTGCCAGGTGCCATCATCTCTTTACCTGGGGCCTTAATTCCTTGCATAGTCTCTCTTGTCAAGTCAGAAC
AGCCAGGTAGAGCCCTTGTCCAAACCTGGGCTGAATGACAGTGATGAGAGGGGGCTTGGCCTTCTTAGGTGACAATGTCCCCCATATCTG
TATGTCACCAGGATGGCAGAGAGCCAGGGCAGAGAGAGACTGGACTTGGGATCAGCAGGCCAGGCAGGTCTTGTCCTGGTCCTGGCCACA
TGTCTTTGCTGTGGGACCTCAGACAAAACCCTGCACCTCTTTGAGCCTTGGCTGCCTTGGTGCAGCAGGGTCATCTGTAGGGCCACCCCA
CAGCTCTTTCCTTCCCCTCCTCTCTCCAGGGAGCCGGGGCTGTGAGAGGATCATCTGGGGCAGGCCCTCCACTTCCAAGCAAGCAGATGG
GGGTGGGCACCTGAGGCCCAATAATATTTGGACCAAGTGGGAAACAAGAACACTCGGAGGGGCGGGAATCAGAAGAGCCTGGAAAAAGAC
CTAGCCCAACTTCCCTTGTGGGAAACTGAGGCCCAGCTTGGGGAAGGCCAGGACCATGCAGGGAGAAAAAGCAGACTTCCTCTGGCCACC
GCTAAGTATTTTGTTCCCTAAGTCCCCCACAGGGTGGTGGAACAGAAGAGAAAACTAAGGCTCAGCAAGGTGGAGTCCTCAAGCAGTGAC
TGGTGGGGGTGGGGCTGGGACTCGGGCTCCTGACCCCCAACCCATGGTGTTCCCTGTCACCCTGGTCTATCCACATCTCCTATTCCTGAG
GAGAGTTGACAGTAAGAGCAGTGAGAGATGGTTCTGGGCCCCATGCCCTAGACAATCAGTCTGTAAGAACTGCCAAGGAAGCCTGGTCAC
CCAGGCCAGGGATGGAGCCCAGCGAGCTCACAGCAGGCACATGCACCCCCGCCCCCACCCAGAACCTGCGGGGCAAAGAAGGGAGGTAGT
TGGGGCCAGAGTCCACCTCCAGGAGCCAGGGTGAGCTGGCTGCAGCTTCCACCTGTCAGGTAAGGTAGGAGAAGGTATGTTACCTGGCAT
CTCTCTCCCTGCCTCCCTCCATTTAGCAGGAAGTGGTGGGGTCAGGGGTCTTCAGCACAGACTTCTTGAGCCTCTGCCCCCTGTCACCCT
TCTTTTGGAATGATGTGTACCCACATCTTTGGATCCTGCCCTCCTTGTGGTTCCAGGCTGTTGGGAGGAGGTCAGCCTCCCCTGAACCAG
CTGCCTGAGGCATGCAGCATCCTTCCTCGGCAAAGCCCACCTGGCTCACAGCGGCCCCCTCTCCCCATCCTGTTCCTCTTCTTGCCCTGT
AATGAGCTCCCCCCATACCTTTCCTCCCTCACCTGAGGCTTTGCTGGTCCTCAGATTGGTTTTGTATTTGTGAGACAACCACTTGACTCC
TGGGCTGCCAGGCGGAAGCACAAGCGCACATGGATGCACACGGATGTTCTCACACACACACGCCCGCTCTCACCAATTCACAGCACCTCG
TGGTCCAGCGGAGCTGCCTGGGAGCTTGGTGAGGATGGCTCCAAAGGACACAAGCCGTTGAGTAGATGCCAGAGAATTCTGAATGGAAAA
CACAAGTCCGGGGCCTCACCAGCATCGTGGCAGAAGGCCTGGGGCATTTCTCCATGGGCCTTCTTCCCTGTGTTCGAGCTCTGACTTTTG
GAAAAGGACATTGTGGATTTTATGAAAATTTCTCATACCATCAGTCTAGCTCCAACCTAGAAAAATTGGATGATATATCAAACCCAACAT
CCCTTTCCCAAGGCACCTTAGTTAAGGCTAGCCCTTCCATAACTGACATTGTACGGTGCTTTGCAATCCTCAACCACTCTGTGGAGCAAA
GAGCATGATGCCTACTTTATAGACGGGGAAATTGACATTTGGGGCTCTCACGGCAACATAGAGGCGAAGTGAATTCTCAGATCTCCAGGC
CCCATTCTCTCTCCACCGAGTTGTGCTCCTGTCATGGGAGTGTATGGCTTAAAGACACTCCCCCACCCCCATTCCCTAGAAATCCCCCAG
ACCCACAATCAGGCAAGAAAGAACAGGGACCCAGAGGCTGGCCTGACCTAGGGGCCTGCAGGTTGGCGGCTTTGTTTCCTAAGAACATTG
AAACCTGCGGAGTCTTTGACCAAATCCACAACAGTGCTTCTGAGGTTTCATCCAGACTCTTTCCCAGCTGTCCCTGAGGTTCAGAGGGTA
TCAGAGTCAATTCAAGGCCATGCCATAATCCCTGACCAGGCCTGGACATGGGTCCAGCCCTGACTCCAGGGGTCCAGGTGCCAAGGTCAT
GTGCTGTCCCCCACTTCCCTTTCTTTGCCTTCGCACTTTGGAACAGGCTCCAGGCCTGGCTGTGACAGTATGCAGGAGTGCCCAAGCCAG
GGCCACCAGGGTGTCCACAGCCCCTGGAAACACAGATCACAATCTCAAGTCCCCTGAATGAACTGCTTCCTGGGTGAACGGGGTGGTGTA
GCCTTGCCACTCGGGCAGCGCACCAGACAGTACGGTGCAGCAGTGCCCGAGATGCCCAGAAGTGTGCCTGCCCCCCTGAGTGGCATTCAA
GTATGAAAACTTGTAAAATTTTCTGTCGGCCTAAAGAAAAATGTCCATGGGCCAAACTTGACCCACTGGGCACCAGCCTGTGAGCCCCAA
TGCCTGTCAATTGCCCCCTTTCTCATTCACCTCCTGTCCTTTGTTGCAGATTTGGAGGAGATGGGAGCCCAGAGAGGTGAGAGATGTGCT
TCAGGGTGTCCAGCAAGGCAGGGGTAGAAACGGGCACGCCCAGAGCCTGCCACTCTCCCAGGCCTCATCTTGGGCTCTTGCAAGTCTTGC
GCTTTGAAGATGGAGTTGGGTGGAAGGTCAGAGGCGCTGGGGACGGGATTGGGGAGCTGCTGGGTTTTCAGGGGAGGTCAGTGCTGCTTG
GGCACCTTTCACATGTGCAGGGAAGAGACTCAGATGTGGCCACAGGGCACTGAGGGGTGAAATCCATTTACCAGAAGTCACGCTCCAGAA
CGACTGCCCAGCCTTGGCAGCCAGTGGCTCCAGCCACCCCCTCCTCATGACATTCAGCCAGAATTGAGCTCCAAGCCAGGGAAGCAAATC
TTAAAAACCAACCAAGCACCCTGACACAGCCCTAGAAACACGATGAGTCTGAAATACAGCTTCCCAGGAGGGGAGTCTAAGATACAGCTT
CCCGGGAGGGTGGAAACCAACTCCTGCCCCACGGCCAGGCCAGGCCCAGGCAGGCATGGGTGGATCCCACAGGGCTCTGAGCTAGACCGG
CTCCACGGTGGCCCCACTACGAGGCCAGTTCTGCAGTCTTGGCCTTGTCACCCATCGAGAGGCTGCTCTGATGGTTCCCAGCCACACACC
AGCTCTCCTGGGGAAACTATTTCTTTCGTTCTTTTGGCCTCGGAGAGGTCCGAGGCAAGTACATTTCTTAAAAGGTAATAAAATGCATTA
TTGGAAAGTTGGACAGTCAGGCCACGACTCCTAGCCCACGGCGTGCCCCACCTCCCAGCAGCCCCTTCAGCCCCTTGCCCCTGTTGCCCC
AAACCTCAGGGTTCCCTCTTGCATATTCATGGGGGAACCACAGTGCTGATGTGTACTTCCCCACTGTCAGCTCGGCTGCACCTCGTGTGG
CGCCAGGTCCCAAGGGCCTCTGCAGAGGCCAGGCTGTGAGCCCCTTGCCTGCCTGCTCCCCTGATGAGGCAACAGCTTCTCTGAAATGAG
CTGCCGGCCAGGAGCAGGCAGGCACCAGCCTGTCTTTCCTTTTCTGGTAATTCCTCAGCACTGAGGCTCCGTTCCTGGGCACCCCAGGAT
TGAAGGGAACCTCAGAATCATGTCACTGCCATTCTAGAGTTTCAATCCAAGGGGTCCCCTTTAGCTCATCTCCAAGATGGGTAAACGTAG
CCACCATTCAGAAAGCCCAGAAATTCTTGTTCCCACATCTTAGACCCCTGAGCAACACAAGGAGAAAATGCAGCTGCTTACCTATTAATA
TCTACTGAGGGACAATCAGCAAAGCCTCAAAGGAGTCGTCTCAGGTAGGGTACTTGGCCTGTGGCAGGAGAGACAGAGGCACAAACCCAC
CCACCCATCAGCTTCCGGTGGCTGATCGGGGCCCAGGGAGGGAAGCAGGTGAAACAGCAGGGTGGGGGTGACTTGGCAGTCGTGCATCTC
CTCCCCGACTCTGAGGCCTGGCAGGAGGAGGCCACACCAGCCTCACCTGCCCTGACCCCCGCCCCCCACCCTGTGACCCTGTGGCTATGG
CCGCTGGTCGCCCTTGTCCCCAAAATCACCATGCCTGTGGCCACGTCCCTCATCTTCTCCAAAAGCATCATTAAGAACAAGTGATTTTGG
ATGATGGATTTTTGATTTACAAACGGCGCATTTCCCTTGGAGTGGAACAGAAAGGAAACCATTTAATGGCGCCCTTCTTTTCAAGCATGA
ATACATTTTAATGAAACTATTTTATTGTATTTGAGGAAATGGAGAGTTGAACATTCCAACCAATCAATAGCCAATTAATTGCTATAAAGC
TAAAAAGAAAATAAATAAATCCTGAGTCTATTTTAAACACTGCAAAAAGTTCAGAGCCTCAGAATCTGGCCTTCCCCTCCATAAGGTGCA
CGAGCATGTAAACACACACACACACACACACACACACACACACACACTCACTCACTCCCCTACACCTCAGACATACTTGAAACTCAGAAA
CAGCACTGAGTCTCCCCATGCCAATTCTTGCCTGCTGTCTTCGACTTGGGTCAGAGAAGGTGAGCAGACCCGGCAGCAGCCTGTCCCGGG
GCTCAGGAAGAGGCAGGCCCATCCCCTGGCCCCAAGCACCCAGCACAACAGAGGGTGGCGGGCAGTGAGGGCCTGGCGTTGCCTGGGCCC
CACTTCTCAGCCCCAGCTGCTGGGCCTCCAAGGTTGGGCTGAGGATGGAGTTTTGGCTCTGGGTTTGCCCTGACTCCTGCTGGAAGACGC
TGCCCTGGTTTTTCACCCTCTAGTGGCCTTGGACATTGAGTATTTGTAGAAATGCAGATTACATTGCAAATGGAAACCTTTGCCAGGAAG
ACACATGCATTTTGCTTTTAATTCTTTGAGACATTTGATTTTGTCTTAGGGACTGACCTTTCAGCATCAAAGAAATACATATCTACTGTA
TCCGCCAAAGTTTGTGATGCCTGCATAGACGCTTACTTGTAAAAAAAAAAAAATACAAAAAAATACAAAAAAACCAACAACAAAAACCAC
AATTGAATTGCCTTTGAAAGTGGGAGATGATCTGTCTCCAACGGATTGAAAAAAAAAAATGCTTCTTAAAAAATGTGTATGTTTTGTATT
CTTTTTTTCTAGTAGAAAATAACTGACTTGAAATATTGGTGGTTTTTTTCTTAGTGACGTGTGTTGCTTTTGTGTGTAATAATATTTGAA
TGTAATTACAGCAGTGCCAATTTGCCAAAGATGTTGGACATATTTTTCTTTTTTGGGGAGGAGGGCAGGGCTAGGGGTGGGACTTGGGAG
AAAACAGGGGTGGGGTTTTGGTTTAATTTTTTTTTTACTTTTTTTTCCTTGTCAAACCTGAAATTTGTGGCTTCCTTTTAAGTTAAATGG
TTGACTGCAACACCTTTATTTTAGATTAGTTGGAGAAACATGCAATAAGATTGGCGTAGTTTCAATATCTGTGTGTCTTTTCATGAGTGG
CTGTTACTTGTGAAGAATTGATTTTATGTAACCTTTATGTGAGATAATTATTTGTAAATATTTGCCATAATTTTATTGGTTCCTAAAATA

>In-frame_FAM219A_ENST00000379084_chr9_34458202_-_PAX5_ENST00000358127_chr9_36923481_-_8030nt
AGCTGCTGACAGGAGGCGGCAGCGGAGTAGGAGGCGAGGCAAGACCTGCGGCTCGGCCCGGCCACAGCCGCGGTAGTGCTAGGCAAGCCC
ACGGAGTCACGCCGGCCTCAGCCAGTCTGCGAACCTCTCGCCCCCGCCCACCCCTGCATCCGCCCGGCCCCTGCCCGCCCGAGTGGTCCG
GGGAGGCCTAGTCTGCACCACCCGCCGGGCTCCTGGGGCCGCCGCCCCGCGCGGTCCTGTCGGCGTCCGCGGCCGCGCCCGGCCCCTGGC
CCGCTCGCCCGCCGGCACCATGATGGAGGAGATCGACCGGTTCCAGGTGCCCACCGCGCACTCGGAGATGCAGCCGCTGACCACAGAGTA
TTCAGCCATGGCCTCGCTGGCTGGTGGGCTGGACGACATGAAGGCCAATCTGGCCAGCCCCACCCCTGCTGACATCGGGAGCAGTGTGCC
AGGCCCGCAGTCCTACCCCATTGTGACAGGCCGTGACTTGGCGAGCACGACCCTCCCCGGGTACCCTCCACACGTCCCCCCCGCTGGACA
GGGCAGCTACTCAGCACCGACGCTGACAGGGATGGTGCCTGGGAGTGAGTTTTCCGGGAGTCCCTACAGCCACCCTCAGTATTCCTCGTA
CAACGACTCCTGGAGGTTCCCCAACCCGGGGCTGCTTGGCTCCCCCTACTATTATAGCGCTGCCGCCCGAGGAGCCGCCCCACCTGCAGC
CGCCACTGCCTATGACCGTCACTGACCCTTGGAGCCAGGCGGGCACCAAACACTGATGGCACCTATTGAGGGTGACAGCCACCCAGCCCT
CCTGAAGATAGCCAGAGAGCCCATGAGACCGTCCCCCAGCATCCCCCACTTGCCTGAAGCTCCCCTCTTCCTCTCTTCCTCCAGGGACTC
TGGGGCCCTTTGGTGGGGCCGTTGGACTTCTGGATGCTTGTCTATTTCTAAAAGCCAATCTATGAGCTTCTCCCGATGGCCACTGGGTCT
CTGCAAACCAATAGACTGTCCTGCAAATAACCGCAGCCCCAGCCCAGCCTGCCTGTCCTCCAGCTGTCTGACTATCCATCCATCATAACC
ACCCCAGCCTGGGAAGGAGAGCTTGCTTTTGTTGCTTCAGCAGCACCCATGTAAATACCTTCTTGCTTTTCTGTGGGCCTGAAGGTCCGA
CTGAGAAGACTGCTCCACCCATGATGCATCTCGCACTCTTGGTGCATCACCGGACATCTTAGACCTATGGCAGAGCATCCTCTCTGCCCT
GGGTGACCCTGGCAGGTGCGCTCAGAGCTGTCCTCAAGATGGAGGATGCTGCCCTTGGGCCCCAGCCTCCTGCTCATCCCTCCTTCTTTA
GTATCTTTACGAGGAGTCTCACTGGGCTGGTTGTGCTGCAGGCTCCCCCTGAGGCCCCTCTCCAAGAGGAGCACACTTTGGGGAGATGTC
CTGGTTTCCTGCCTCCATTTCTCTGGGACCGATGCAGTATCAGCAGCTCTTTTCCAGATCAAAGAACTCAAAGAAAACTGTCTGGGAGAT
TCCTCAGCTACTTTTCCGAAGCAGAATGTCATCCGAGGTATTGATTACATTGTGGACTTTGAATGTGAGGGCTGGATGGGACGCAGGAGA
TCATCTGATCCCAGCCAAGGAGGGGCCTGAGGCTCTCCCTACTCCCTCAGCCCCTGGAACGGTGTTTTCTGAGGCATGCCCAGGTTCAGG
TCACTTCGGACACCTGCCATGGACACTTCACCCACCCTCCAGGACCCCAGCAAGTGGATTCTGGGCAAGCCTGTTCCGGTGATGTAGACA
ATAATTAACACAGAGGACTTTCCCCCACACCCAGATCACAAACAGCCTACAGCCAGAACTTCTGAGCATCCTCTCGGGGCAGACCCTCCC
CGTCCTCGTGGAGCTTAGCAGGCAGCTGGGCATGGAGGTGCTGGGGCTGGGGCAGATGCCTAATTTCGCACAATGCATGCCCACCTGTTG
ATCTAAGGGGCCGCGATGGTCAGGGCCACGGCCAAGGGCCACGGGAACTTGGAGAGGGAGCTTGGAGAACTCACTGTGGGCTAGGGTGGT
CAGAGGAAGCCAGCAGGGAAGATCTGGGGGACAGAGGAAGGCCTCCTGAGGGAGGGGCAGGAGAGCAGTGAGGAGCTGCTGTGTGACCTG
GGAGTGATTTTGACATGGGGGTGCCAGGTGCCATCATCTCTTTACCTGGGGCCTTAATTCCTTGCATAGTCTCTCTTGTCAAGTCAGAAC
AGCCAGGTAGAGCCCTTGTCCAAACCTGGGCTGAATGACAGTGATGAGAGGGGGCTTGGCCTTCTTAGGTGACAATGTCCCCCATATCTG
TATGTCACCAGGATGGCAGAGAGCCAGGGCAGAGAGAGACTGGACTTGGGATCAGCAGGCCAGGCAGGTCTTGTCCTGGTCCTGGCCACA
TGTCTTTGCTGTGGGACCTCAGACAAAACCCTGCACCTCTTTGAGCCTTGGCTGCCTTGGTGCAGCAGGGTCATCTGTAGGGCCACCCCA
CAGCTCTTTCCTTCCCCTCCTCTCTCCAGGGAGCCGGGGCTGTGAGAGGATCATCTGGGGCAGGCCCTCCACTTCCAAGCAAGCAGATGG
GGGTGGGCACCTGAGGCCCAATAATATTTGGACCAAGTGGGAAACAAGAACACTCGGAGGGGCGGGAATCAGAAGAGCCTGGAAAAAGAC
CTAGCCCAACTTCCCTTGTGGGAAACTGAGGCCCAGCTTGGGGAAGGCCAGGACCATGCAGGGAGAAAAAGCAGACTTCCTCTGGCCACC
GCTAAGTATTTTGTTCCCTAAGTCCCCCACAGGGTGGTGGAACAGAAGAGAAAACTAAGGCTCAGCAAGGTGGAGTCCTCAAGCAGTGAC
TGGTGGGGGTGGGGCTGGGACTCGGGCTCCTGACCCCCAACCCATGGTGTTCCCTGTCACCCTGGTCTATCCACATCTCCTATTCCTGAG
GAGAGTTGACAGTAAGAGCAGTGAGAGATGGTTCTGGGCCCCATGCCCTAGACAATCAGTCTGTAAGAACTGCCAAGGAAGCCTGGTCAC
CCAGGCCAGGGATGGAGCCCAGCGAGCTCACAGCAGGCACATGCACCCCCGCCCCCACCCAGAACCTGCGGGGCAAAGAAGGGAGGTAGT
TGGGGCCAGAGTCCACCTCCAGGAGCCAGGGTGAGCTGGCTGCAGCTTCCACCTGTCAGGTAAGGTAGGAGAAGGTATGTTACCTGGCAT
CTCTCTCCCTGCCTCCCTCCATTTAGCAGGAAGTGGTGGGGTCAGGGGTCTTCAGCACAGACTTCTTGAGCCTCTGCCCCCTGTCACCCT
TCTTTTGGAATGATGTGTACCCACATCTTTGGATCCTGCCCTCCTTGTGGTTCCAGGCTGTTGGGAGGAGGTCAGCCTCCCCTGAACCAG
CTGCCTGAGGCATGCAGCATCCTTCCTCGGCAAAGCCCACCTGGCTCACAGCGGCCCCCTCTCCCCATCCTGTTCCTCTTCTTGCCCTGT
AATGAGCTCCCCCCATACCTTTCCTCCCTCACCTGAGGCTTTGCTGGTCCTCAGATTGGTTTTGTATTTGTGAGACAACCACTTGACTCC
TGGGCTGCCAGGCGGAAGCACAAGCGCACATGGATGCACACGGATGTTCTCACACACACACGCCCGCTCTCACCAATTCACAGCACCTCG
TGGTCCAGCGGAGCTGCCTGGGAGCTTGGTGAGGATGGCTCCAAAGGACACAAGCCGTTGAGTAGATGCCAGAGAATTCTGAATGGAAAA
CACAAGTCCGGGGCCTCACCAGCATCGTGGCAGAAGGCCTGGGGCATTTCTCCATGGGCCTTCTTCCCTGTGTTCGAGCTCTGACTTTTG
GAAAAGGACATTGTGGATTTTATGAAAATTTCTCATACCATCAGTCTAGCTCCAACCTAGAAAAATTGGATGATATATCAAACCCAACAT
CCCTTTCCCAAGGCACCTTAGTTAAGGCTAGCCCTTCCATAACTGACATTGTACGGTGCTTTGCAATCCTCAACCACTCTGTGGAGCAAA
GAGCATGATGCCTACTTTATAGACGGGGAAATTGACATTTGGGGCTCTCACGGCAACATAGAGGCGAAGTGAATTCTCAGATCTCCAGGC
CCCATTCTCTCTCCACCGAGTTGTGCTCCTGTCATGGGAGTGTATGGCTTAAAGACACTCCCCCACCCCCATTCCCTAGAAATCCCCCAG
ACCCACAATCAGGCAAGAAAGAACAGGGACCCAGAGGCTGGCCTGACCTAGGGGCCTGCAGGTTGGCGGCTTTGTTTCCTAAGAACATTG
AAACCTGCGGAGTCTTTGACCAAATCCACAACAGTGCTTCTGAGGTTTCATCCAGACTCTTTCCCAGCTGTCCCTGAGGTTCAGAGGGTA
TCAGAGTCAATTCAAGGCCATGCCATAATCCCTGACCAGGCCTGGACATGGGTCCAGCCCTGACTCCAGGGGTCCAGGTGCCAAGGTCAT
GTGCTGTCCCCCACTTCCCTTTCTTTGCCTTCGCACTTTGGAACAGGCTCCAGGCCTGGCTGTGACAGTATGCAGGAGTGCCCAAGCCAG
GGCCACCAGGGTGTCCACAGCCCCTGGAAACACAGATCACAATCTCAAGTCCCCTGAATGAACTGCTTCCTGGGTGAACGGGGTGGTGTA
GCCTTGCCACTCGGGCAGCGCACCAGACAGTACGGTGCAGCAGTGCCCGAGATGCCCAGAAGTGTGCCTGCCCCCCTGAGTGGCATTCAA
GTATGAAAACTTGTAAAATTTTCTGTCGGCCTAAAGAAAAATGTCCATGGGCCAAACTTGACCCACTGGGCACCAGCCTGTGAGCCCCAA
TGCCTGTCAATTGCCCCCTTTCTCATTCACCTCCTGTCCTTTGTTGCAGATTTGGAGGAGATGGGAGCCCAGAGAGGTGAGAGATGTGCT
TCAGGGTGTCCAGCAAGGCAGGGGTAGAAACGGGCACGCCCAGAGCCTGCCACTCTCCCAGGCCTCATCTTGGGCTCTTGCAAGTCTTGC
GCTTTGAAGATGGAGTTGGGTGGAAGGTCAGAGGCGCTGGGGACGGGATTGGGGAGCTGCTGGGTTTTCAGGGGAGGTCAGTGCTGCTTG
GGCACCTTTCACATGTGCAGGGAAGAGACTCAGATGTGGCCACAGGGCACTGAGGGGTGAAATCCATTTACCAGAAGTCACGCTCCAGAA
CGACTGCCCAGCCTTGGCAGCCAGTGGCTCCAGCCACCCCCTCCTCATGACATTCAGCCAGAATTGAGCTCCAAGCCAGGGAAGCAAATC
TTAAAAACCAACCAAGCACCCTGACACAGCCCTAGAAACACGATGAGTCTGAAATACAGCTTCCCAGGAGGGGAGTCTAAGATACAGCTT
CCCGGGAGGGTGGAAACCAACTCCTGCCCCACGGCCAGGCCAGGCCCAGGCAGGCATGGGTGGATCCCACAGGGCTCTGAGCTAGACCGG
CTCCACGGTGGCCCCACTACGAGGCCAGTTCTGCAGTCTTGGCCTTGTCACCCATCGAGAGGCTGCTCTGATGGTTCCCAGCCACACACC
AGCTCTCCTGGGGAAACTATTTCTTTCGTTCTTTTGGCCTCGGAGAGGTCCGAGGCAAGTACATTTCTTAAAAGGTAATAAAATGCATTA
TTGGAAAGTTGGACAGTCAGGCCACGACTCCTAGCCCACGGCGTGCCCCACCTCCCAGCAGCCCCTTCAGCCCCTTGCCCCTGTTGCCCC
AAACCTCAGGGTTCCCTCTTGCATATTCATGGGGGAACCACAGTGCTGATGTGTACTTCCCCACTGTCAGCTCGGCTGCACCTCGTGTGG
CGCCAGGTCCCAAGGGCCTCTGCAGAGGCCAGGCTGTGAGCCCCTTGCCTGCCTGCTCCCCTGATGAGGCAACAGCTTCTCTGAAATGAG
CTGCCGGCCAGGAGCAGGCAGGCACCAGCCTGTCTTTCCTTTTCTGGTAATTCCTCAGCACTGAGGCTCCGTTCCTGGGCACCCCAGGAT
TGAAGGGAACCTCAGAATCATGTCACTGCCATTCTAGAGTTTCAATCCAAGGGGTCCCCTTTAGCTCATCTCCAAGATGGGTAAACGTAG
CCACCATTCAGAAAGCCCAGAAATTCTTGTTCCCACATCTTAGACCCCTGAGCAACACAAGGAGAAAATGCAGCTGCTTACCTATTAATA
TCTACTGAGGGACAATCAGCAAAGCCTCAAAGGAGTCGTCTCAGGTAGGGTACTTGGCCTGTGGCAGGAGAGACAGAGGCACAAACCCAC
CCACCCATCAGCTTCCGGTGGCTGATCGGGGCCCAGGGAGGGAAGCAGGTGAAACAGCAGGGTGGGGGTGACTTGGCAGTCGTGCATCTC
CTCCCCGACTCTGAGGCCTGGCAGGAGGAGGCCACACCAGCCTCACCTGCCCTGACCCCCGCCCCCCACCCTGTGACCCTGTGGCTATGG
CCGCTGGTCGCCCTTGTCCCCAAAATCACCATGCCTGTGGCCACGTCCCTCATCTTCTCCAAAAGCATCATTAAGAACAAGTGATTTTGG
ATGATGGATTTTTGATTTACAAACGGCGCATTTCCCTTGGAGTGGAACAGAAAGGAAACCATTTAATGGCGCCCTTCTTTTCAAGCATGA
ATACATTTTAATGAAACTATTTTATTGTATTTGAGGAAATGGAGAGTTGAACATTCCAACCAATCAATAGCCAATTAATTGCTATAAAGC
TAAAAAGAAAATAAATAAATCCTGAGTCTATTTTAAACACTGCAAAAAGTTCAGAGCCTCAGAATCTGGCCTTCCCCTCCATAAGGTGCA
CGAGCATGTAAACACACACACACACACACACACACACACACACACACTCACTCACTCCCCTACACCTCAGACATACTTGAAACTCAGAAA
CAGCACTGAGTCTCCCCATGCCAATTCTTGCCTGCTGTCTTCGACTTGGGTCAGAGAAGGTGAGCAGACCCGGCAGCAGCCTGTCCCGGG
GCTCAGGAAGAGGCAGGCCCATCCCCTGGCCCCAAGCACCCAGCACAACAGAGGGTGGCGGGCAGTGAGGGCCTGGCGTTGCCTGGGCCC
CACTTCTCAGCCCCAGCTGCTGGGCCTCCAAGGTTGGGCTGAGGATGGAGTTTTGGCTCTGGGTTTGCCCTGACTCCTGCTGGAAGACGC
TGCCCTGGTTTTTCACCCTCTAGTGGCCTTGGACATTGAGTATTTGTAGAAATGCAGATTACATTGCAAATGGAAACCTTTGCCAGGAAG
ACACATGCATTTTGCTTTTAATTCTTTGAGACATTTGATTTTGTCTTAGGGACTGACCTTTCAGCATCAAAGAAATACATATCTACTGTA
TCCGCCAAAGTTTGTGATGCCTGCATAGACGCTTACTTGTAAAAAAAAAAAAATACAAAAAAATACAAAAAAACCAACAACAAAAACCAC
AATTGAATTGCCTTTGAAAGTGGGAGATGATCTGTCTCCAACGGATTGAAAAAAAAAAATGCTTCTTAAAAAATGTGTATGTTTTGTATT
CTTTTTTTCTAGTAGAAAATAACTGACTTGAAATATTGGTGGTTTTTTTCTTAGTGACGTGTGTTGCTTTTGTGTGTAATAATATTTGAA
TGTAATTACAGCAGTGCCAATTTGCCAAAGATGTTGGACATATTTTTCTTTTTTGGGGAGGAGGGCAGGGCTAGGGGTGGGACTTGGGAG
AAAACAGGGGTGGGGTTTTGGTTTAATTTTTTTTTTACTTTTTTTTCCTTGTCAAACCTGAAATTTGTGGCTTCCTTTTAAGTTAAATGG
TTGACTGCAACACCTTTATTTTAGATTAGTTGGAGAAACATGCAATAAGATTGGCGTAGTTTCAATATCTGTGTGTCTTTTCATGAGTGG
CTGTTACTTGTGAAGAATTGATTTTATGTAACCTTTATGTGAGATAATTATTTGTAAATATTTGCCATAATTTTATTGGTTCCTAAAATA

>In-frame_FAM219A_ENST00000379089_chr9_34458202_-_PAX5_ENST00000358127_chr9_36923481_-_8030nt
AGCTGCTGACAGGAGGCGGCAGCGGAGTAGGAGGCGAGGCAAGACCTGCGGCTCGGCCCGGCCACAGCCGCGGTAGTGCTAGGCAAGCCC
ACGGAGTCACGCCGGCCTCAGCCAGTCTGCGAACCTCTCGCCCCCGCCCACCCCTGCATCCGCCCGGCCCCTGCCCGCCCGAGTGGTCCG
GGGAGGCCTAGTCTGCACCACCCGCCGGGCTCCTGGGGCCGCCGCCCCGCGCGGTCCTGTCGGCGTCCGCGGCCGCGCCCGGCCCCTGGC
CCGCTCGCCCGCCGGCACCATGATGGAGGAGATCGACCGGTTCCAGGTGCCCACCGCGCACTCGGAGATGCAGCCGCTGACCACAGAGTA
TTCAGCCATGGCCTCGCTGGCTGGTGGGCTGGACGACATGAAGGCCAATCTGGCCAGCCCCACCCCTGCTGACATCGGGAGCAGTGTGCC
AGGCCCGCAGTCCTACCCCATTGTGACAGGCCGTGACTTGGCGAGCACGACCCTCCCCGGGTACCCTCCACACGTCCCCCCCGCTGGACA
GGGCAGCTACTCAGCACCGACGCTGACAGGGATGGTGCCTGGGAGTGAGTTTTCCGGGAGTCCCTACAGCCACCCTCAGTATTCCTCGTA
CAACGACTCCTGGAGGTTCCCCAACCCGGGGCTGCTTGGCTCCCCCTACTATTATAGCGCTGCCGCCCGAGGAGCCGCCCCACCTGCAGC
CGCCACTGCCTATGACCGTCACTGACCCTTGGAGCCAGGCGGGCACCAAACACTGATGGCACCTATTGAGGGTGACAGCCACCCAGCCCT
CCTGAAGATAGCCAGAGAGCCCATGAGACCGTCCCCCAGCATCCCCCACTTGCCTGAAGCTCCCCTCTTCCTCTCTTCCTCCAGGGACTC
TGGGGCCCTTTGGTGGGGCCGTTGGACTTCTGGATGCTTGTCTATTTCTAAAAGCCAATCTATGAGCTTCTCCCGATGGCCACTGGGTCT
CTGCAAACCAATAGACTGTCCTGCAAATAACCGCAGCCCCAGCCCAGCCTGCCTGTCCTCCAGCTGTCTGACTATCCATCCATCATAACC
ACCCCAGCCTGGGAAGGAGAGCTTGCTTTTGTTGCTTCAGCAGCACCCATGTAAATACCTTCTTGCTTTTCTGTGGGCCTGAAGGTCCGA
CTGAGAAGACTGCTCCACCCATGATGCATCTCGCACTCTTGGTGCATCACCGGACATCTTAGACCTATGGCAGAGCATCCTCTCTGCCCT
GGGTGACCCTGGCAGGTGCGCTCAGAGCTGTCCTCAAGATGGAGGATGCTGCCCTTGGGCCCCAGCCTCCTGCTCATCCCTCCTTCTTTA
GTATCTTTACGAGGAGTCTCACTGGGCTGGTTGTGCTGCAGGCTCCCCCTGAGGCCCCTCTCCAAGAGGAGCACACTTTGGGGAGATGTC
CTGGTTTCCTGCCTCCATTTCTCTGGGACCGATGCAGTATCAGCAGCTCTTTTCCAGATCAAAGAACTCAAAGAAAACTGTCTGGGAGAT
TCCTCAGCTACTTTTCCGAAGCAGAATGTCATCCGAGGTATTGATTACATTGTGGACTTTGAATGTGAGGGCTGGATGGGACGCAGGAGA
TCATCTGATCCCAGCCAAGGAGGGGCCTGAGGCTCTCCCTACTCCCTCAGCCCCTGGAACGGTGTTTTCTGAGGCATGCCCAGGTTCAGG
TCACTTCGGACACCTGCCATGGACACTTCACCCACCCTCCAGGACCCCAGCAAGTGGATTCTGGGCAAGCCTGTTCCGGTGATGTAGACA
ATAATTAACACAGAGGACTTTCCCCCACACCCAGATCACAAACAGCCTACAGCCAGAACTTCTGAGCATCCTCTCGGGGCAGACCCTCCC
CGTCCTCGTGGAGCTTAGCAGGCAGCTGGGCATGGAGGTGCTGGGGCTGGGGCAGATGCCTAATTTCGCACAATGCATGCCCACCTGTTG
ATCTAAGGGGCCGCGATGGTCAGGGCCACGGCCAAGGGCCACGGGAACTTGGAGAGGGAGCTTGGAGAACTCACTGTGGGCTAGGGTGGT
CAGAGGAAGCCAGCAGGGAAGATCTGGGGGACAGAGGAAGGCCTCCTGAGGGAGGGGCAGGAGAGCAGTGAGGAGCTGCTGTGTGACCTG
GGAGTGATTTTGACATGGGGGTGCCAGGTGCCATCATCTCTTTACCTGGGGCCTTAATTCCTTGCATAGTCTCTCTTGTCAAGTCAGAAC
AGCCAGGTAGAGCCCTTGTCCAAACCTGGGCTGAATGACAGTGATGAGAGGGGGCTTGGCCTTCTTAGGTGACAATGTCCCCCATATCTG
TATGTCACCAGGATGGCAGAGAGCCAGGGCAGAGAGAGACTGGACTTGGGATCAGCAGGCCAGGCAGGTCTTGTCCTGGTCCTGGCCACA
TGTCTTTGCTGTGGGACCTCAGACAAAACCCTGCACCTCTTTGAGCCTTGGCTGCCTTGGTGCAGCAGGGTCATCTGTAGGGCCACCCCA
CAGCTCTTTCCTTCCCCTCCTCTCTCCAGGGAGCCGGGGCTGTGAGAGGATCATCTGGGGCAGGCCCTCCACTTCCAAGCAAGCAGATGG
GGGTGGGCACCTGAGGCCCAATAATATTTGGACCAAGTGGGAAACAAGAACACTCGGAGGGGCGGGAATCAGAAGAGCCTGGAAAAAGAC
CTAGCCCAACTTCCCTTGTGGGAAACTGAGGCCCAGCTTGGGGAAGGCCAGGACCATGCAGGGAGAAAAAGCAGACTTCCTCTGGCCACC
GCTAAGTATTTTGTTCCCTAAGTCCCCCACAGGGTGGTGGAACAGAAGAGAAAACTAAGGCTCAGCAAGGTGGAGTCCTCAAGCAGTGAC
TGGTGGGGGTGGGGCTGGGACTCGGGCTCCTGACCCCCAACCCATGGTGTTCCCTGTCACCCTGGTCTATCCACATCTCCTATTCCTGAG
GAGAGTTGACAGTAAGAGCAGTGAGAGATGGTTCTGGGCCCCATGCCCTAGACAATCAGTCTGTAAGAACTGCCAAGGAAGCCTGGTCAC
CCAGGCCAGGGATGGAGCCCAGCGAGCTCACAGCAGGCACATGCACCCCCGCCCCCACCCAGAACCTGCGGGGCAAAGAAGGGAGGTAGT
TGGGGCCAGAGTCCACCTCCAGGAGCCAGGGTGAGCTGGCTGCAGCTTCCACCTGTCAGGTAAGGTAGGAGAAGGTATGTTACCTGGCAT
CTCTCTCCCTGCCTCCCTCCATTTAGCAGGAAGTGGTGGGGTCAGGGGTCTTCAGCACAGACTTCTTGAGCCTCTGCCCCCTGTCACCCT
TCTTTTGGAATGATGTGTACCCACATCTTTGGATCCTGCCCTCCTTGTGGTTCCAGGCTGTTGGGAGGAGGTCAGCCTCCCCTGAACCAG
CTGCCTGAGGCATGCAGCATCCTTCCTCGGCAAAGCCCACCTGGCTCACAGCGGCCCCCTCTCCCCATCCTGTTCCTCTTCTTGCCCTGT
AATGAGCTCCCCCCATACCTTTCCTCCCTCACCTGAGGCTTTGCTGGTCCTCAGATTGGTTTTGTATTTGTGAGACAACCACTTGACTCC
TGGGCTGCCAGGCGGAAGCACAAGCGCACATGGATGCACACGGATGTTCTCACACACACACGCCCGCTCTCACCAATTCACAGCACCTCG
TGGTCCAGCGGAGCTGCCTGGGAGCTTGGTGAGGATGGCTCCAAAGGACACAAGCCGTTGAGTAGATGCCAGAGAATTCTGAATGGAAAA
CACAAGTCCGGGGCCTCACCAGCATCGTGGCAGAAGGCCTGGGGCATTTCTCCATGGGCCTTCTTCCCTGTGTTCGAGCTCTGACTTTTG
GAAAAGGACATTGTGGATTTTATGAAAATTTCTCATACCATCAGTCTAGCTCCAACCTAGAAAAATTGGATGATATATCAAACCCAACAT
CCCTTTCCCAAGGCACCTTAGTTAAGGCTAGCCCTTCCATAACTGACATTGTACGGTGCTTTGCAATCCTCAACCACTCTGTGGAGCAAA
GAGCATGATGCCTACTTTATAGACGGGGAAATTGACATTTGGGGCTCTCACGGCAACATAGAGGCGAAGTGAATTCTCAGATCTCCAGGC
CCCATTCTCTCTCCACCGAGTTGTGCTCCTGTCATGGGAGTGTATGGCTTAAAGACACTCCCCCACCCCCATTCCCTAGAAATCCCCCAG
ACCCACAATCAGGCAAGAAAGAACAGGGACCCAGAGGCTGGCCTGACCTAGGGGCCTGCAGGTTGGCGGCTTTGTTTCCTAAGAACATTG
AAACCTGCGGAGTCTTTGACCAAATCCACAACAGTGCTTCTGAGGTTTCATCCAGACTCTTTCCCAGCTGTCCCTGAGGTTCAGAGGGTA
TCAGAGTCAATTCAAGGCCATGCCATAATCCCTGACCAGGCCTGGACATGGGTCCAGCCCTGACTCCAGGGGTCCAGGTGCCAAGGTCAT
GTGCTGTCCCCCACTTCCCTTTCTTTGCCTTCGCACTTTGGAACAGGCTCCAGGCCTGGCTGTGACAGTATGCAGGAGTGCCCAAGCCAG
GGCCACCAGGGTGTCCACAGCCCCTGGAAACACAGATCACAATCTCAAGTCCCCTGAATGAACTGCTTCCTGGGTGAACGGGGTGGTGTA
GCCTTGCCACTCGGGCAGCGCACCAGACAGTACGGTGCAGCAGTGCCCGAGATGCCCAGAAGTGTGCCTGCCCCCCTGAGTGGCATTCAA
GTATGAAAACTTGTAAAATTTTCTGTCGGCCTAAAGAAAAATGTCCATGGGCCAAACTTGACCCACTGGGCACCAGCCTGTGAGCCCCAA
TGCCTGTCAATTGCCCCCTTTCTCATTCACCTCCTGTCCTTTGTTGCAGATTTGGAGGAGATGGGAGCCCAGAGAGGTGAGAGATGTGCT
TCAGGGTGTCCAGCAAGGCAGGGGTAGAAACGGGCACGCCCAGAGCCTGCCACTCTCCCAGGCCTCATCTTGGGCTCTTGCAAGTCTTGC
GCTTTGAAGATGGAGTTGGGTGGAAGGTCAGAGGCGCTGGGGACGGGATTGGGGAGCTGCTGGGTTTTCAGGGGAGGTCAGTGCTGCTTG
GGCACCTTTCACATGTGCAGGGAAGAGACTCAGATGTGGCCACAGGGCACTGAGGGGTGAAATCCATTTACCAGAAGTCACGCTCCAGAA
CGACTGCCCAGCCTTGGCAGCCAGTGGCTCCAGCCACCCCCTCCTCATGACATTCAGCCAGAATTGAGCTCCAAGCCAGGGAAGCAAATC
TTAAAAACCAACCAAGCACCCTGACACAGCCCTAGAAACACGATGAGTCTGAAATACAGCTTCCCAGGAGGGGAGTCTAAGATACAGCTT
CCCGGGAGGGTGGAAACCAACTCCTGCCCCACGGCCAGGCCAGGCCCAGGCAGGCATGGGTGGATCCCACAGGGCTCTGAGCTAGACCGG
CTCCACGGTGGCCCCACTACGAGGCCAGTTCTGCAGTCTTGGCCTTGTCACCCATCGAGAGGCTGCTCTGATGGTTCCCAGCCACACACC
AGCTCTCCTGGGGAAACTATTTCTTTCGTTCTTTTGGCCTCGGAGAGGTCCGAGGCAAGTACATTTCTTAAAAGGTAATAAAATGCATTA
TTGGAAAGTTGGACAGTCAGGCCACGACTCCTAGCCCACGGCGTGCCCCACCTCCCAGCAGCCCCTTCAGCCCCTTGCCCCTGTTGCCCC
AAACCTCAGGGTTCCCTCTTGCATATTCATGGGGGAACCACAGTGCTGATGTGTACTTCCCCACTGTCAGCTCGGCTGCACCTCGTGTGG
CGCCAGGTCCCAAGGGCCTCTGCAGAGGCCAGGCTGTGAGCCCCTTGCCTGCCTGCTCCCCTGATGAGGCAACAGCTTCTCTGAAATGAG
CTGCCGGCCAGGAGCAGGCAGGCACCAGCCTGTCTTTCCTTTTCTGGTAATTCCTCAGCACTGAGGCTCCGTTCCTGGGCACCCCAGGAT
TGAAGGGAACCTCAGAATCATGTCACTGCCATTCTAGAGTTTCAATCCAAGGGGTCCCCTTTAGCTCATCTCCAAGATGGGTAAACGTAG
CCACCATTCAGAAAGCCCAGAAATTCTTGTTCCCACATCTTAGACCCCTGAGCAACACAAGGAGAAAATGCAGCTGCTTACCTATTAATA
TCTACTGAGGGACAATCAGCAAAGCCTCAAAGGAGTCGTCTCAGGTAGGGTACTTGGCCTGTGGCAGGAGAGACAGAGGCACAAACCCAC
CCACCCATCAGCTTCCGGTGGCTGATCGGGGCCCAGGGAGGGAAGCAGGTGAAACAGCAGGGTGGGGGTGACTTGGCAGTCGTGCATCTC
CTCCCCGACTCTGAGGCCTGGCAGGAGGAGGCCACACCAGCCTCACCTGCCCTGACCCCCGCCCCCCACCCTGTGACCCTGTGGCTATGG
CCGCTGGTCGCCCTTGTCCCCAAAATCACCATGCCTGTGGCCACGTCCCTCATCTTCTCCAAAAGCATCATTAAGAACAAGTGATTTTGG
ATGATGGATTTTTGATTTACAAACGGCGCATTTCCCTTGGAGTGGAACAGAAAGGAAACCATTTAATGGCGCCCTTCTTTTCAAGCATGA
ATACATTTTAATGAAACTATTTTATTGTATTTGAGGAAATGGAGAGTTGAACATTCCAACCAATCAATAGCCAATTAATTGCTATAAAGC
TAAAAAGAAAATAAATAAATCCTGAGTCTATTTTAAACACTGCAAAAAGTTCAGAGCCTCAGAATCTGGCCTTCCCCTCCATAAGGTGCA
CGAGCATGTAAACACACACACACACACACACACACACACACACACACTCACTCACTCCCCTACACCTCAGACATACTTGAAACTCAGAAA
CAGCACTGAGTCTCCCCATGCCAATTCTTGCCTGCTGTCTTCGACTTGGGTCAGAGAAGGTGAGCAGACCCGGCAGCAGCCTGTCCCGGG
GCTCAGGAAGAGGCAGGCCCATCCCCTGGCCCCAAGCACCCAGCACAACAGAGGGTGGCGGGCAGTGAGGGCCTGGCGTTGCCTGGGCCC
CACTTCTCAGCCCCAGCTGCTGGGCCTCCAAGGTTGGGCTGAGGATGGAGTTTTGGCTCTGGGTTTGCCCTGACTCCTGCTGGAAGACGC
TGCCCTGGTTTTTCACCCTCTAGTGGCCTTGGACATTGAGTATTTGTAGAAATGCAGATTACATTGCAAATGGAAACCTTTGCCAGGAAG
ACACATGCATTTTGCTTTTAATTCTTTGAGACATTTGATTTTGTCTTAGGGACTGACCTTTCAGCATCAAAGAAATACATATCTACTGTA
TCCGCCAAAGTTTGTGATGCCTGCATAGACGCTTACTTGTAAAAAAAAAAAAATACAAAAAAATACAAAAAAACCAACAACAAAAACCAC
AATTGAATTGCCTTTGAAAGTGGGAGATGATCTGTCTCCAACGGATTGAAAAAAAAAAATGCTTCTTAAAAAATGTGTATGTTTTGTATT
CTTTTTTTCTAGTAGAAAATAACTGACTTGAAATATTGGTGGTTTTTTTCTTAGTGACGTGTGTTGCTTTTGTGTGTAATAATATTTGAA
TGTAATTACAGCAGTGCCAATTTGCCAAAGATGTTGGACATATTTTTCTTTTTTGGGGAGGAGGGCAGGGCTAGGGGTGGGACTTGGGAG
AAAACAGGGGTGGGGTTTTGGTTTAATTTTTTTTTTACTTTTTTTTCCTTGTCAAACCTGAAATTTGTGGCTTCCTTTTAAGTTAAATGG
TTGACTGCAACACCTTTATTTTAGATTAGTTGGAGAAACATGCAATAAGATTGGCGTAGTTTCAATATCTGTGTGTCTTTTCATGAGTGG
CTGTTACTTGTGAAGAATTGATTTTATGTAACCTTTATGTGAGATAATTATTTGTAAATATTTGCCATAATTTTATTGGTTCCTAAAATA

>In-frame_FAM219A_ENST00000445726_chr9_34458202_-_PAX5_ENST00000358127_chr9_36923481_-_8048nt
GAGTCACCGCAGTGGCTGAGCTGCTGACAGGAGGCGGCAGCGGAGTAGGAGGCGAGGCAAGACCTGCGGCTCGGCCCGGCCACAGCCGCG
GTAGTGCTAGGCAAGCCCACGGAGTCACGCCGGCCTCAGCCAGTCTGCGAACCTCTCGCCCCCGCCCACCCCTGCATCCGCCCGGCCCCT
GCCCGCCCGAGTGGTCCGGGGAGGCCTAGTCTGCACCACCCGCCGGGCTCCTGGGGCCGCCGCCCCGCGCGGTCCTGTCGGCGTCCGCGG
CCGCGCCCGGCCCCTGGCCCGCTCGCCCGCCGGCACCATGATGGAGGAGATCGACCGGTTCCAGGTGCCCACCGCGCACTCGGAGATGCA
GCCGCTGACCACAGAGTATTCAGCCATGGCCTCGCTGGCTGGTGGGCTGGACGACATGAAGGCCAATCTGGCCAGCCCCACCCCTGCTGA
CATCGGGAGCAGTGTGCCAGGCCCGCAGTCCTACCCCATTGTGACAGGCCGTGACTTGGCGAGCACGACCCTCCCCGGGTACCCTCCACA
CGTCCCCCCCGCTGGACAGGGCAGCTACTCAGCACCGACGCTGACAGGGATGGTGCCTGGGAGTGAGTTTTCCGGGAGTCCCTACAGCCA
CCCTCAGTATTCCTCGTACAACGACTCCTGGAGGTTCCCCAACCCGGGGCTGCTTGGCTCCCCCTACTATTATAGCGCTGCCGCCCGAGG
AGCCGCCCCACCTGCAGCCGCCACTGCCTATGACCGTCACTGACCCTTGGAGCCAGGCGGGCACCAAACACTGATGGCACCTATTGAGGG
TGACAGCCACCCAGCCCTCCTGAAGATAGCCAGAGAGCCCATGAGACCGTCCCCCAGCATCCCCCACTTGCCTGAAGCTCCCCTCTTCCT
CTCTTCCTCCAGGGACTCTGGGGCCCTTTGGTGGGGCCGTTGGACTTCTGGATGCTTGTCTATTTCTAAAAGCCAATCTATGAGCTTCTC
CCGATGGCCACTGGGTCTCTGCAAACCAATAGACTGTCCTGCAAATAACCGCAGCCCCAGCCCAGCCTGCCTGTCCTCCAGCTGTCTGAC
TATCCATCCATCATAACCACCCCAGCCTGGGAAGGAGAGCTTGCTTTTGTTGCTTCAGCAGCACCCATGTAAATACCTTCTTGCTTTTCT
GTGGGCCTGAAGGTCCGACTGAGAAGACTGCTCCACCCATGATGCATCTCGCACTCTTGGTGCATCACCGGACATCTTAGACCTATGGCA
GAGCATCCTCTCTGCCCTGGGTGACCCTGGCAGGTGCGCTCAGAGCTGTCCTCAAGATGGAGGATGCTGCCCTTGGGCCCCAGCCTCCTG
CTCATCCCTCCTTCTTTAGTATCTTTACGAGGAGTCTCACTGGGCTGGTTGTGCTGCAGGCTCCCCCTGAGGCCCCTCTCCAAGAGGAGC
ACACTTTGGGGAGATGTCCTGGTTTCCTGCCTCCATTTCTCTGGGACCGATGCAGTATCAGCAGCTCTTTTCCAGATCAAAGAACTCAAA
GAAAACTGTCTGGGAGATTCCTCAGCTACTTTTCCGAAGCAGAATGTCATCCGAGGTATTGATTACATTGTGGACTTTGAATGTGAGGGC
TGGATGGGACGCAGGAGATCATCTGATCCCAGCCAAGGAGGGGCCTGAGGCTCTCCCTACTCCCTCAGCCCCTGGAACGGTGTTTTCTGA
GGCATGCCCAGGTTCAGGTCACTTCGGACACCTGCCATGGACACTTCACCCACCCTCCAGGACCCCAGCAAGTGGATTCTGGGCAAGCCT
GTTCCGGTGATGTAGACAATAATTAACACAGAGGACTTTCCCCCACACCCAGATCACAAACAGCCTACAGCCAGAACTTCTGAGCATCCT
CTCGGGGCAGACCCTCCCCGTCCTCGTGGAGCTTAGCAGGCAGCTGGGCATGGAGGTGCTGGGGCTGGGGCAGATGCCTAATTTCGCACA
ATGCATGCCCACCTGTTGATCTAAGGGGCCGCGATGGTCAGGGCCACGGCCAAGGGCCACGGGAACTTGGAGAGGGAGCTTGGAGAACTC
ACTGTGGGCTAGGGTGGTCAGAGGAAGCCAGCAGGGAAGATCTGGGGGACAGAGGAAGGCCTCCTGAGGGAGGGGCAGGAGAGCAGTGAG
GAGCTGCTGTGTGACCTGGGAGTGATTTTGACATGGGGGTGCCAGGTGCCATCATCTCTTTACCTGGGGCCTTAATTCCTTGCATAGTCT
CTCTTGTCAAGTCAGAACAGCCAGGTAGAGCCCTTGTCCAAACCTGGGCTGAATGACAGTGATGAGAGGGGGCTTGGCCTTCTTAGGTGA
CAATGTCCCCCATATCTGTATGTCACCAGGATGGCAGAGAGCCAGGGCAGAGAGAGACTGGACTTGGGATCAGCAGGCCAGGCAGGTCTT
GTCCTGGTCCTGGCCACATGTCTTTGCTGTGGGACCTCAGACAAAACCCTGCACCTCTTTGAGCCTTGGCTGCCTTGGTGCAGCAGGGTC
ATCTGTAGGGCCACCCCACAGCTCTTTCCTTCCCCTCCTCTCTCCAGGGAGCCGGGGCTGTGAGAGGATCATCTGGGGCAGGCCCTCCAC
TTCCAAGCAAGCAGATGGGGGTGGGCACCTGAGGCCCAATAATATTTGGACCAAGTGGGAAACAAGAACACTCGGAGGGGCGGGAATCAG
AAGAGCCTGGAAAAAGACCTAGCCCAACTTCCCTTGTGGGAAACTGAGGCCCAGCTTGGGGAAGGCCAGGACCATGCAGGGAGAAAAAGC
AGACTTCCTCTGGCCACCGCTAAGTATTTTGTTCCCTAAGTCCCCCACAGGGTGGTGGAACAGAAGAGAAAACTAAGGCTCAGCAAGGTG
GAGTCCTCAAGCAGTGACTGGTGGGGGTGGGGCTGGGACTCGGGCTCCTGACCCCCAACCCATGGTGTTCCCTGTCACCCTGGTCTATCC
ACATCTCCTATTCCTGAGGAGAGTTGACAGTAAGAGCAGTGAGAGATGGTTCTGGGCCCCATGCCCTAGACAATCAGTCTGTAAGAACTG
CCAAGGAAGCCTGGTCACCCAGGCCAGGGATGGAGCCCAGCGAGCTCACAGCAGGCACATGCACCCCCGCCCCCACCCAGAACCTGCGGG
GCAAAGAAGGGAGGTAGTTGGGGCCAGAGTCCACCTCCAGGAGCCAGGGTGAGCTGGCTGCAGCTTCCACCTGTCAGGTAAGGTAGGAGA
AGGTATGTTACCTGGCATCTCTCTCCCTGCCTCCCTCCATTTAGCAGGAAGTGGTGGGGTCAGGGGTCTTCAGCACAGACTTCTTGAGCC
TCTGCCCCCTGTCACCCTTCTTTTGGAATGATGTGTACCCACATCTTTGGATCCTGCCCTCCTTGTGGTTCCAGGCTGTTGGGAGGAGGT
CAGCCTCCCCTGAACCAGCTGCCTGAGGCATGCAGCATCCTTCCTCGGCAAAGCCCACCTGGCTCACAGCGGCCCCCTCTCCCCATCCTG
TTCCTCTTCTTGCCCTGTAATGAGCTCCCCCCATACCTTTCCTCCCTCACCTGAGGCTTTGCTGGTCCTCAGATTGGTTTTGTATTTGTG
AGACAACCACTTGACTCCTGGGCTGCCAGGCGGAAGCACAAGCGCACATGGATGCACACGGATGTTCTCACACACACACGCCCGCTCTCA
CCAATTCACAGCACCTCGTGGTCCAGCGGAGCTGCCTGGGAGCTTGGTGAGGATGGCTCCAAAGGACACAAGCCGTTGAGTAGATGCCAG
AGAATTCTGAATGGAAAACACAAGTCCGGGGCCTCACCAGCATCGTGGCAGAAGGCCTGGGGCATTTCTCCATGGGCCTTCTTCCCTGTG
TTCGAGCTCTGACTTTTGGAAAAGGACATTGTGGATTTTATGAAAATTTCTCATACCATCAGTCTAGCTCCAACCTAGAAAAATTGGATG
ATATATCAAACCCAACATCCCTTTCCCAAGGCACCTTAGTTAAGGCTAGCCCTTCCATAACTGACATTGTACGGTGCTTTGCAATCCTCA
ACCACTCTGTGGAGCAAAGAGCATGATGCCTACTTTATAGACGGGGAAATTGACATTTGGGGCTCTCACGGCAACATAGAGGCGAAGTGA
ATTCTCAGATCTCCAGGCCCCATTCTCTCTCCACCGAGTTGTGCTCCTGTCATGGGAGTGTATGGCTTAAAGACACTCCCCCACCCCCAT
TCCCTAGAAATCCCCCAGACCCACAATCAGGCAAGAAAGAACAGGGACCCAGAGGCTGGCCTGACCTAGGGGCCTGCAGGTTGGCGGCTT
TGTTTCCTAAGAACATTGAAACCTGCGGAGTCTTTGACCAAATCCACAACAGTGCTTCTGAGGTTTCATCCAGACTCTTTCCCAGCTGTC
CCTGAGGTTCAGAGGGTATCAGAGTCAATTCAAGGCCATGCCATAATCCCTGACCAGGCCTGGACATGGGTCCAGCCCTGACTCCAGGGG
TCCAGGTGCCAAGGTCATGTGCTGTCCCCCACTTCCCTTTCTTTGCCTTCGCACTTTGGAACAGGCTCCAGGCCTGGCTGTGACAGTATG
CAGGAGTGCCCAAGCCAGGGCCACCAGGGTGTCCACAGCCCCTGGAAACACAGATCACAATCTCAAGTCCCCTGAATGAACTGCTTCCTG
GGTGAACGGGGTGGTGTAGCCTTGCCACTCGGGCAGCGCACCAGACAGTACGGTGCAGCAGTGCCCGAGATGCCCAGAAGTGTGCCTGCC
CCCCTGAGTGGCATTCAAGTATGAAAACTTGTAAAATTTTCTGTCGGCCTAAAGAAAAATGTCCATGGGCCAAACTTGACCCACTGGGCA
CCAGCCTGTGAGCCCCAATGCCTGTCAATTGCCCCCTTTCTCATTCACCTCCTGTCCTTTGTTGCAGATTTGGAGGAGATGGGAGCCCAG
AGAGGTGAGAGATGTGCTTCAGGGTGTCCAGCAAGGCAGGGGTAGAAACGGGCACGCCCAGAGCCTGCCACTCTCCCAGGCCTCATCTTG
GGCTCTTGCAAGTCTTGCGCTTTGAAGATGGAGTTGGGTGGAAGGTCAGAGGCGCTGGGGACGGGATTGGGGAGCTGCTGGGTTTTCAGG
GGAGGTCAGTGCTGCTTGGGCACCTTTCACATGTGCAGGGAAGAGACTCAGATGTGGCCACAGGGCACTGAGGGGTGAAATCCATTTACC
AGAAGTCACGCTCCAGAACGACTGCCCAGCCTTGGCAGCCAGTGGCTCCAGCCACCCCCTCCTCATGACATTCAGCCAGAATTGAGCTCC
AAGCCAGGGAAGCAAATCTTAAAAACCAACCAAGCACCCTGACACAGCCCTAGAAACACGATGAGTCTGAAATACAGCTTCCCAGGAGGG
GAGTCTAAGATACAGCTTCCCGGGAGGGTGGAAACCAACTCCTGCCCCACGGCCAGGCCAGGCCCAGGCAGGCATGGGTGGATCCCACAG
GGCTCTGAGCTAGACCGGCTCCACGGTGGCCCCACTACGAGGCCAGTTCTGCAGTCTTGGCCTTGTCACCCATCGAGAGGCTGCTCTGAT
GGTTCCCAGCCACACACCAGCTCTCCTGGGGAAACTATTTCTTTCGTTCTTTTGGCCTCGGAGAGGTCCGAGGCAAGTACATTTCTTAAA
AGGTAATAAAATGCATTATTGGAAAGTTGGACAGTCAGGCCACGACTCCTAGCCCACGGCGTGCCCCACCTCCCAGCAGCCCCTTCAGCC
CCTTGCCCCTGTTGCCCCAAACCTCAGGGTTCCCTCTTGCATATTCATGGGGGAACCACAGTGCTGATGTGTACTTCCCCACTGTCAGCT
CGGCTGCACCTCGTGTGGCGCCAGGTCCCAAGGGCCTCTGCAGAGGCCAGGCTGTGAGCCCCTTGCCTGCCTGCTCCCCTGATGAGGCAA
CAGCTTCTCTGAAATGAGCTGCCGGCCAGGAGCAGGCAGGCACCAGCCTGTCTTTCCTTTTCTGGTAATTCCTCAGCACTGAGGCTCCGT
TCCTGGGCACCCCAGGATTGAAGGGAACCTCAGAATCATGTCACTGCCATTCTAGAGTTTCAATCCAAGGGGTCCCCTTTAGCTCATCTC
CAAGATGGGTAAACGTAGCCACCATTCAGAAAGCCCAGAAATTCTTGTTCCCACATCTTAGACCCCTGAGCAACACAAGGAGAAAATGCA
GCTGCTTACCTATTAATATCTACTGAGGGACAATCAGCAAAGCCTCAAAGGAGTCGTCTCAGGTAGGGTACTTGGCCTGTGGCAGGAGAG
ACAGAGGCACAAACCCACCCACCCATCAGCTTCCGGTGGCTGATCGGGGCCCAGGGAGGGAAGCAGGTGAAACAGCAGGGTGGGGGTGAC
TTGGCAGTCGTGCATCTCCTCCCCGACTCTGAGGCCTGGCAGGAGGAGGCCACACCAGCCTCACCTGCCCTGACCCCCGCCCCCCACCCT
GTGACCCTGTGGCTATGGCCGCTGGTCGCCCTTGTCCCCAAAATCACCATGCCTGTGGCCACGTCCCTCATCTTCTCCAAAAGCATCATT
AAGAACAAGTGATTTTGGATGATGGATTTTTGATTTACAAACGGCGCATTTCCCTTGGAGTGGAACAGAAAGGAAACCATTTAATGGCGC
CCTTCTTTTCAAGCATGAATACATTTTAATGAAACTATTTTATTGTATTTGAGGAAATGGAGAGTTGAACATTCCAACCAATCAATAGCC
AATTAATTGCTATAAAGCTAAAAAGAAAATAAATAAATCCTGAGTCTATTTTAAACACTGCAAAAAGTTCAGAGCCTCAGAATCTGGCCT
TCCCCTCCATAAGGTGCACGAGCATGTAAACACACACACACACACACACACACACACACACACACTCACTCACTCCCCTACACCTCAGAC
ATACTTGAAACTCAGAAACAGCACTGAGTCTCCCCATGCCAATTCTTGCCTGCTGTCTTCGACTTGGGTCAGAGAAGGTGAGCAGACCCG
GCAGCAGCCTGTCCCGGGGCTCAGGAAGAGGCAGGCCCATCCCCTGGCCCCAAGCACCCAGCACAACAGAGGGTGGCGGGCAGTGAGGGC
CTGGCGTTGCCTGGGCCCCACTTCTCAGCCCCAGCTGCTGGGCCTCCAAGGTTGGGCTGAGGATGGAGTTTTGGCTCTGGGTTTGCCCTG
ACTCCTGCTGGAAGACGCTGCCCTGGTTTTTCACCCTCTAGTGGCCTTGGACATTGAGTATTTGTAGAAATGCAGATTACATTGCAAATG
GAAACCTTTGCCAGGAAGACACATGCATTTTGCTTTTAATTCTTTGAGACATTTGATTTTGTCTTAGGGACTGACCTTTCAGCATCAAAG
AAATACATATCTACTGTATCCGCCAAAGTTTGTGATGCCTGCATAGACGCTTACTTGTAAAAAAAAAAAAATACAAAAAAATACAAAAAA
ACCAACAACAAAAACCACAATTGAATTGCCTTTGAAAGTGGGAGATGATCTGTCTCCAACGGATTGAAAAAAAAAAATGCTTCTTAAAAA
ATGTGTATGTTTTGTATTCTTTTTTTCTAGTAGAAAATAACTGACTTGAAATATTGGTGGTTTTTTTCTTAGTGACGTGTGTTGCTTTTG
TGTGTAATAATATTTGAATGTAATTACAGCAGTGCCAATTTGCCAAAGATGTTGGACATATTTTTCTTTTTTGGGGAGGAGGGCAGGGCT
AGGGGTGGGACTTGGGAGAAAACAGGGGTGGGGTTTTGGTTTAATTTTTTTTTTACTTTTTTTTCCTTGTCAAACCTGAAATTTGTGGCT
TCCTTTTAAGTTAAATGGTTGACTGCAACACCTTTATTTTAGATTAGTTGGAGAAACATGCAATAAGATTGGCGTAGTTTCAATATCTGT
GTGTCTTTTCATGAGTGGCTGTTACTTGTGAAGAATTGATTTTATGTAACCTTTATGTGAGATAATTATTTGTAAATATTTGCCATAATT

>In-frame_FAM219A_ENST00000297620_chr9_34458202_-_PAX5_ENST00000358127_chr9_36923481_-_8048nt
GAGTCACCGCAGTGGCTGAGCTGCTGACAGGAGGCGGCAGCGGAGTAGGAGGCGAGGCAAGACCTGCGGCTCGGCCCGGCCACAGCCGCG
GTAGTGCTAGGCAAGCCCACGGAGTCACGCCGGCCTCAGCCAGTCTGCGAACCTCTCGCCCCCGCCCACCCCTGCATCCGCCCGGCCCCT
GCCCGCCCGAGTGGTCCGGGGAGGCCTAGTCTGCACCACCCGCCGGGCTCCTGGGGCCGCCGCCCCGCGCGGTCCTGTCGGCGTCCGCGG
CCGCGCCCGGCCCCTGGCCCGCTCGCCCGCCGGCACCATGATGGAGGAGATCGACCGGTTCCAGGTGCCCACCGCGCACTCGGAGATGCA
GCCGCTGACCACAGAGTATTCAGCCATGGCCTCGCTGGCTGGTGGGCTGGACGACATGAAGGCCAATCTGGCCAGCCCCACCCCTGCTGA
CATCGGGAGCAGTGTGCCAGGCCCGCAGTCCTACCCCATTGTGACAGGCCGTGACTTGGCGAGCACGACCCTCCCCGGGTACCCTCCACA
CGTCCCCCCCGCTGGACAGGGCAGCTACTCAGCACCGACGCTGACAGGGATGGTGCCTGGGAGTGAGTTTTCCGGGAGTCCCTACAGCCA
CCCTCAGTATTCCTCGTACAACGACTCCTGGAGGTTCCCCAACCCGGGGCTGCTTGGCTCCCCCTACTATTATAGCGCTGCCGCCCGAGG
AGCCGCCCCACCTGCAGCCGCCACTGCCTATGACCGTCACTGACCCTTGGAGCCAGGCGGGCACCAAACACTGATGGCACCTATTGAGGG
TGACAGCCACCCAGCCCTCCTGAAGATAGCCAGAGAGCCCATGAGACCGTCCCCCAGCATCCCCCACTTGCCTGAAGCTCCCCTCTTCCT
CTCTTCCTCCAGGGACTCTGGGGCCCTTTGGTGGGGCCGTTGGACTTCTGGATGCTTGTCTATTTCTAAAAGCCAATCTATGAGCTTCTC
CCGATGGCCACTGGGTCTCTGCAAACCAATAGACTGTCCTGCAAATAACCGCAGCCCCAGCCCAGCCTGCCTGTCCTCCAGCTGTCTGAC
TATCCATCCATCATAACCACCCCAGCCTGGGAAGGAGAGCTTGCTTTTGTTGCTTCAGCAGCACCCATGTAAATACCTTCTTGCTTTTCT
GTGGGCCTGAAGGTCCGACTGAGAAGACTGCTCCACCCATGATGCATCTCGCACTCTTGGTGCATCACCGGACATCTTAGACCTATGGCA
GAGCATCCTCTCTGCCCTGGGTGACCCTGGCAGGTGCGCTCAGAGCTGTCCTCAAGATGGAGGATGCTGCCCTTGGGCCCCAGCCTCCTG
CTCATCCCTCCTTCTTTAGTATCTTTACGAGGAGTCTCACTGGGCTGGTTGTGCTGCAGGCTCCCCCTGAGGCCCCTCTCCAAGAGGAGC
ACACTTTGGGGAGATGTCCTGGTTTCCTGCCTCCATTTCTCTGGGACCGATGCAGTATCAGCAGCTCTTTTCCAGATCAAAGAACTCAAA
GAAAACTGTCTGGGAGATTCCTCAGCTACTTTTCCGAAGCAGAATGTCATCCGAGGTATTGATTACATTGTGGACTTTGAATGTGAGGGC
TGGATGGGACGCAGGAGATCATCTGATCCCAGCCAAGGAGGGGCCTGAGGCTCTCCCTACTCCCTCAGCCCCTGGAACGGTGTTTTCTGA
GGCATGCCCAGGTTCAGGTCACTTCGGACACCTGCCATGGACACTTCACCCACCCTCCAGGACCCCAGCAAGTGGATTCTGGGCAAGCCT
GTTCCGGTGATGTAGACAATAATTAACACAGAGGACTTTCCCCCACACCCAGATCACAAACAGCCTACAGCCAGAACTTCTGAGCATCCT
CTCGGGGCAGACCCTCCCCGTCCTCGTGGAGCTTAGCAGGCAGCTGGGCATGGAGGTGCTGGGGCTGGGGCAGATGCCTAATTTCGCACA
ATGCATGCCCACCTGTTGATCTAAGGGGCCGCGATGGTCAGGGCCACGGCCAAGGGCCACGGGAACTTGGAGAGGGAGCTTGGAGAACTC
ACTGTGGGCTAGGGTGGTCAGAGGAAGCCAGCAGGGAAGATCTGGGGGACAGAGGAAGGCCTCCTGAGGGAGGGGCAGGAGAGCAGTGAG
GAGCTGCTGTGTGACCTGGGAGTGATTTTGACATGGGGGTGCCAGGTGCCATCATCTCTTTACCTGGGGCCTTAATTCCTTGCATAGTCT
CTCTTGTCAAGTCAGAACAGCCAGGTAGAGCCCTTGTCCAAACCTGGGCTGAATGACAGTGATGAGAGGGGGCTTGGCCTTCTTAGGTGA
CAATGTCCCCCATATCTGTATGTCACCAGGATGGCAGAGAGCCAGGGCAGAGAGAGACTGGACTTGGGATCAGCAGGCCAGGCAGGTCTT
GTCCTGGTCCTGGCCACATGTCTTTGCTGTGGGACCTCAGACAAAACCCTGCACCTCTTTGAGCCTTGGCTGCCTTGGTGCAGCAGGGTC
ATCTGTAGGGCCACCCCACAGCTCTTTCCTTCCCCTCCTCTCTCCAGGGAGCCGGGGCTGTGAGAGGATCATCTGGGGCAGGCCCTCCAC
TTCCAAGCAAGCAGATGGGGGTGGGCACCTGAGGCCCAATAATATTTGGACCAAGTGGGAAACAAGAACACTCGGAGGGGCGGGAATCAG
AAGAGCCTGGAAAAAGACCTAGCCCAACTTCCCTTGTGGGAAACTGAGGCCCAGCTTGGGGAAGGCCAGGACCATGCAGGGAGAAAAAGC
AGACTTCCTCTGGCCACCGCTAAGTATTTTGTTCCCTAAGTCCCCCACAGGGTGGTGGAACAGAAGAGAAAACTAAGGCTCAGCAAGGTG
GAGTCCTCAAGCAGTGACTGGTGGGGGTGGGGCTGGGACTCGGGCTCCTGACCCCCAACCCATGGTGTTCCCTGTCACCCTGGTCTATCC
ACATCTCCTATTCCTGAGGAGAGTTGACAGTAAGAGCAGTGAGAGATGGTTCTGGGCCCCATGCCCTAGACAATCAGTCTGTAAGAACTG
CCAAGGAAGCCTGGTCACCCAGGCCAGGGATGGAGCCCAGCGAGCTCACAGCAGGCACATGCACCCCCGCCCCCACCCAGAACCTGCGGG
GCAAAGAAGGGAGGTAGTTGGGGCCAGAGTCCACCTCCAGGAGCCAGGGTGAGCTGGCTGCAGCTTCCACCTGTCAGGTAAGGTAGGAGA
AGGTATGTTACCTGGCATCTCTCTCCCTGCCTCCCTCCATTTAGCAGGAAGTGGTGGGGTCAGGGGTCTTCAGCACAGACTTCTTGAGCC
TCTGCCCCCTGTCACCCTTCTTTTGGAATGATGTGTACCCACATCTTTGGATCCTGCCCTCCTTGTGGTTCCAGGCTGTTGGGAGGAGGT
CAGCCTCCCCTGAACCAGCTGCCTGAGGCATGCAGCATCCTTCCTCGGCAAAGCCCACCTGGCTCACAGCGGCCCCCTCTCCCCATCCTG
TTCCTCTTCTTGCCCTGTAATGAGCTCCCCCCATACCTTTCCTCCCTCACCTGAGGCTTTGCTGGTCCTCAGATTGGTTTTGTATTTGTG
AGACAACCACTTGACTCCTGGGCTGCCAGGCGGAAGCACAAGCGCACATGGATGCACACGGATGTTCTCACACACACACGCCCGCTCTCA
CCAATTCACAGCACCTCGTGGTCCAGCGGAGCTGCCTGGGAGCTTGGTGAGGATGGCTCCAAAGGACACAAGCCGTTGAGTAGATGCCAG
AGAATTCTGAATGGAAAACACAAGTCCGGGGCCTCACCAGCATCGTGGCAGAAGGCCTGGGGCATTTCTCCATGGGCCTTCTTCCCTGTG
TTCGAGCTCTGACTTTTGGAAAAGGACATTGTGGATTTTATGAAAATTTCTCATACCATCAGTCTAGCTCCAACCTAGAAAAATTGGATG
ATATATCAAACCCAACATCCCTTTCCCAAGGCACCTTAGTTAAGGCTAGCCCTTCCATAACTGACATTGTACGGTGCTTTGCAATCCTCA
ACCACTCTGTGGAGCAAAGAGCATGATGCCTACTTTATAGACGGGGAAATTGACATTTGGGGCTCTCACGGCAACATAGAGGCGAAGTGA
ATTCTCAGATCTCCAGGCCCCATTCTCTCTCCACCGAGTTGTGCTCCTGTCATGGGAGTGTATGGCTTAAAGACACTCCCCCACCCCCAT
TCCCTAGAAATCCCCCAGACCCACAATCAGGCAAGAAAGAACAGGGACCCAGAGGCTGGCCTGACCTAGGGGCCTGCAGGTTGGCGGCTT
TGTTTCCTAAGAACATTGAAACCTGCGGAGTCTTTGACCAAATCCACAACAGTGCTTCTGAGGTTTCATCCAGACTCTTTCCCAGCTGTC
CCTGAGGTTCAGAGGGTATCAGAGTCAATTCAAGGCCATGCCATAATCCCTGACCAGGCCTGGACATGGGTCCAGCCCTGACTCCAGGGG
TCCAGGTGCCAAGGTCATGTGCTGTCCCCCACTTCCCTTTCTTTGCCTTCGCACTTTGGAACAGGCTCCAGGCCTGGCTGTGACAGTATG
CAGGAGTGCCCAAGCCAGGGCCACCAGGGTGTCCACAGCCCCTGGAAACACAGATCACAATCTCAAGTCCCCTGAATGAACTGCTTCCTG
GGTGAACGGGGTGGTGTAGCCTTGCCACTCGGGCAGCGCACCAGACAGTACGGTGCAGCAGTGCCCGAGATGCCCAGAAGTGTGCCTGCC
CCCCTGAGTGGCATTCAAGTATGAAAACTTGTAAAATTTTCTGTCGGCCTAAAGAAAAATGTCCATGGGCCAAACTTGACCCACTGGGCA
CCAGCCTGTGAGCCCCAATGCCTGTCAATTGCCCCCTTTCTCATTCACCTCCTGTCCTTTGTTGCAGATTTGGAGGAGATGGGAGCCCAG
AGAGGTGAGAGATGTGCTTCAGGGTGTCCAGCAAGGCAGGGGTAGAAACGGGCACGCCCAGAGCCTGCCACTCTCCCAGGCCTCATCTTG
GGCTCTTGCAAGTCTTGCGCTTTGAAGATGGAGTTGGGTGGAAGGTCAGAGGCGCTGGGGACGGGATTGGGGAGCTGCTGGGTTTTCAGG
GGAGGTCAGTGCTGCTTGGGCACCTTTCACATGTGCAGGGAAGAGACTCAGATGTGGCCACAGGGCACTGAGGGGTGAAATCCATTTACC
AGAAGTCACGCTCCAGAACGACTGCCCAGCCTTGGCAGCCAGTGGCTCCAGCCACCCCCTCCTCATGACATTCAGCCAGAATTGAGCTCC
AAGCCAGGGAAGCAAATCTTAAAAACCAACCAAGCACCCTGACACAGCCCTAGAAACACGATGAGTCTGAAATACAGCTTCCCAGGAGGG
GAGTCTAAGATACAGCTTCCCGGGAGGGTGGAAACCAACTCCTGCCCCACGGCCAGGCCAGGCCCAGGCAGGCATGGGTGGATCCCACAG
GGCTCTGAGCTAGACCGGCTCCACGGTGGCCCCACTACGAGGCCAGTTCTGCAGTCTTGGCCTTGTCACCCATCGAGAGGCTGCTCTGAT
GGTTCCCAGCCACACACCAGCTCTCCTGGGGAAACTATTTCTTTCGTTCTTTTGGCCTCGGAGAGGTCCGAGGCAAGTACATTTCTTAAA
AGGTAATAAAATGCATTATTGGAAAGTTGGACAGTCAGGCCACGACTCCTAGCCCACGGCGTGCCCCACCTCCCAGCAGCCCCTTCAGCC
CCTTGCCCCTGTTGCCCCAAACCTCAGGGTTCCCTCTTGCATATTCATGGGGGAACCACAGTGCTGATGTGTACTTCCCCACTGTCAGCT
CGGCTGCACCTCGTGTGGCGCCAGGTCCCAAGGGCCTCTGCAGAGGCCAGGCTGTGAGCCCCTTGCCTGCCTGCTCCCCTGATGAGGCAA
CAGCTTCTCTGAAATGAGCTGCCGGCCAGGAGCAGGCAGGCACCAGCCTGTCTTTCCTTTTCTGGTAATTCCTCAGCACTGAGGCTCCGT
TCCTGGGCACCCCAGGATTGAAGGGAACCTCAGAATCATGTCACTGCCATTCTAGAGTTTCAATCCAAGGGGTCCCCTTTAGCTCATCTC
CAAGATGGGTAAACGTAGCCACCATTCAGAAAGCCCAGAAATTCTTGTTCCCACATCTTAGACCCCTGAGCAACACAAGGAGAAAATGCA
GCTGCTTACCTATTAATATCTACTGAGGGACAATCAGCAAAGCCTCAAAGGAGTCGTCTCAGGTAGGGTACTTGGCCTGTGGCAGGAGAG
ACAGAGGCACAAACCCACCCACCCATCAGCTTCCGGTGGCTGATCGGGGCCCAGGGAGGGAAGCAGGTGAAACAGCAGGGTGGGGGTGAC
TTGGCAGTCGTGCATCTCCTCCCCGACTCTGAGGCCTGGCAGGAGGAGGCCACACCAGCCTCACCTGCCCTGACCCCCGCCCCCCACCCT
GTGACCCTGTGGCTATGGCCGCTGGTCGCCCTTGTCCCCAAAATCACCATGCCTGTGGCCACGTCCCTCATCTTCTCCAAAAGCATCATT
AAGAACAAGTGATTTTGGATGATGGATTTTTGATTTACAAACGGCGCATTTCCCTTGGAGTGGAACAGAAAGGAAACCATTTAATGGCGC
CCTTCTTTTCAAGCATGAATACATTTTAATGAAACTATTTTATTGTATTTGAGGAAATGGAGAGTTGAACATTCCAACCAATCAATAGCC
AATTAATTGCTATAAAGCTAAAAAGAAAATAAATAAATCCTGAGTCTATTTTAAACACTGCAAAAAGTTCAGAGCCTCAGAATCTGGCCT
TCCCCTCCATAAGGTGCACGAGCATGTAAACACACACACACACACACACACACACACACACACACTCACTCACTCCCCTACACCTCAGAC
ATACTTGAAACTCAGAAACAGCACTGAGTCTCCCCATGCCAATTCTTGCCTGCTGTCTTCGACTTGGGTCAGAGAAGGTGAGCAGACCCG
GCAGCAGCCTGTCCCGGGGCTCAGGAAGAGGCAGGCCCATCCCCTGGCCCCAAGCACCCAGCACAACAGAGGGTGGCGGGCAGTGAGGGC
CTGGCGTTGCCTGGGCCCCACTTCTCAGCCCCAGCTGCTGGGCCTCCAAGGTTGGGCTGAGGATGGAGTTTTGGCTCTGGGTTTGCCCTG
ACTCCTGCTGGAAGACGCTGCCCTGGTTTTTCACCCTCTAGTGGCCTTGGACATTGAGTATTTGTAGAAATGCAGATTACATTGCAAATG
GAAACCTTTGCCAGGAAGACACATGCATTTTGCTTTTAATTCTTTGAGACATTTGATTTTGTCTTAGGGACTGACCTTTCAGCATCAAAG
AAATACATATCTACTGTATCCGCCAAAGTTTGTGATGCCTGCATAGACGCTTACTTGTAAAAAAAAAAAAATACAAAAAAATACAAAAAA
ACCAACAACAAAAACCACAATTGAATTGCCTTTGAAAGTGGGAGATGATCTGTCTCCAACGGATTGAAAAAAAAAAATGCTTCTTAAAAA
ATGTGTATGTTTTGTATTCTTTTTTTCTAGTAGAAAATAACTGACTTGAAATATTGGTGGTTTTTTTCTTAGTGACGTGTGTTGCTTTTG
TGTGTAATAATATTTGAATGTAATTACAGCAGTGCCAATTTGCCAAAGATGTTGGACATATTTTTCTTTTTTGGGGAGGAGGGCAGGGCT
AGGGGTGGGACTTGGGAGAAAACAGGGGTGGGGTTTTGGTTTAATTTTTTTTTTACTTTTTTTTCCTTGTCAAACCTGAAATTTGTGGCT
TCCTTTTAAGTTAAATGGTTGACTGCAACACCTTTATTTTAGATTAGTTGGAGAAACATGCAATAAGATTGGCGTAGTTTCAATATCTGT
GTGTCTTTTCATGAGTGGCTGTTACTTGTGAAGAATTGATTTTATGTAACCTTTATGTGAGATAATTATTTGTAAATATTTGCCATAATT

>In-frame_FAM219A_ENST00000379078_chr9_34458202_-_PAX5_ENST00000358127_chr9_36923481_-_8030nt
AGCTGCTGACAGGAGGCGGCAGCGGAGTAGGAGGCGAGGCAAGACCTGCGGCTCGGCCCGGCCACAGCCGCGGTAGTGCTAGGCAAGCCC
ACGGAGTCACGCCGGCCTCAGCCAGTCTGCGAACCTCTCGCCCCCGCCCACCCCTGCATCCGCCCGGCCCCTGCCCGCCCGAGTGGTCCG
GGGAGGCCTAGTCTGCACCACCCGCCGGGCTCCTGGGGCCGCCGCCCCGCGCGGTCCTGTCGGCGTCCGCGGCCGCGCCCGGCCCCTGGC
CCGCTCGCCCGCCGGCACCATGATGGAGGAGATCGACCGGTTCCAGGTGCCCACCGCGCACTCGGAGATGCAGCCGCTGACCACAGAGTA
TTCAGCCATGGCCTCGCTGGCTGGTGGGCTGGACGACATGAAGGCCAATCTGGCCAGCCCCACCCCTGCTGACATCGGGAGCAGTGTGCC
AGGCCCGCAGTCCTACCCCATTGTGACAGGCCGTGACTTGGCGAGCACGACCCTCCCCGGGTACCCTCCACACGTCCCCCCCGCTGGACA
GGGCAGCTACTCAGCACCGACGCTGACAGGGATGGTGCCTGGGAGTGAGTTTTCCGGGAGTCCCTACAGCCACCCTCAGTATTCCTCGTA
CAACGACTCCTGGAGGTTCCCCAACCCGGGGCTGCTTGGCTCCCCCTACTATTATAGCGCTGCCGCCCGAGGAGCCGCCCCACCTGCAGC
CGCCACTGCCTATGACCGTCACTGACCCTTGGAGCCAGGCGGGCACCAAACACTGATGGCACCTATTGAGGGTGACAGCCACCCAGCCCT
CCTGAAGATAGCCAGAGAGCCCATGAGACCGTCCCCCAGCATCCCCCACTTGCCTGAAGCTCCCCTCTTCCTCTCTTCCTCCAGGGACTC
TGGGGCCCTTTGGTGGGGCCGTTGGACTTCTGGATGCTTGTCTATTTCTAAAAGCCAATCTATGAGCTTCTCCCGATGGCCACTGGGTCT
CTGCAAACCAATAGACTGTCCTGCAAATAACCGCAGCCCCAGCCCAGCCTGCCTGTCCTCCAGCTGTCTGACTATCCATCCATCATAACC
ACCCCAGCCTGGGAAGGAGAGCTTGCTTTTGTTGCTTCAGCAGCACCCATGTAAATACCTTCTTGCTTTTCTGTGGGCCTGAAGGTCCGA
CTGAGAAGACTGCTCCACCCATGATGCATCTCGCACTCTTGGTGCATCACCGGACATCTTAGACCTATGGCAGAGCATCCTCTCTGCCCT
GGGTGACCCTGGCAGGTGCGCTCAGAGCTGTCCTCAAGATGGAGGATGCTGCCCTTGGGCCCCAGCCTCCTGCTCATCCCTCCTTCTTTA
GTATCTTTACGAGGAGTCTCACTGGGCTGGTTGTGCTGCAGGCTCCCCCTGAGGCCCCTCTCCAAGAGGAGCACACTTTGGGGAGATGTC
CTGGTTTCCTGCCTCCATTTCTCTGGGACCGATGCAGTATCAGCAGCTCTTTTCCAGATCAAAGAACTCAAAGAAAACTGTCTGGGAGAT
TCCTCAGCTACTTTTCCGAAGCAGAATGTCATCCGAGGTATTGATTACATTGTGGACTTTGAATGTGAGGGCTGGATGGGACGCAGGAGA
TCATCTGATCCCAGCCAAGGAGGGGCCTGAGGCTCTCCCTACTCCCTCAGCCCCTGGAACGGTGTTTTCTGAGGCATGCCCAGGTTCAGG
TCACTTCGGACACCTGCCATGGACACTTCACCCACCCTCCAGGACCCCAGCAAGTGGATTCTGGGCAAGCCTGTTCCGGTGATGTAGACA
ATAATTAACACAGAGGACTTTCCCCCACACCCAGATCACAAACAGCCTACAGCCAGAACTTCTGAGCATCCTCTCGGGGCAGACCCTCCC
CGTCCTCGTGGAGCTTAGCAGGCAGCTGGGCATGGAGGTGCTGGGGCTGGGGCAGATGCCTAATTTCGCACAATGCATGCCCACCTGTTG
ATCTAAGGGGCCGCGATGGTCAGGGCCACGGCCAAGGGCCACGGGAACTTGGAGAGGGAGCTTGGAGAACTCACTGTGGGCTAGGGTGGT
CAGAGGAAGCCAGCAGGGAAGATCTGGGGGACAGAGGAAGGCCTCCTGAGGGAGGGGCAGGAGAGCAGTGAGGAGCTGCTGTGTGACCTG
GGAGTGATTTTGACATGGGGGTGCCAGGTGCCATCATCTCTTTACCTGGGGCCTTAATTCCTTGCATAGTCTCTCTTGTCAAGTCAGAAC
AGCCAGGTAGAGCCCTTGTCCAAACCTGGGCTGAATGACAGTGATGAGAGGGGGCTTGGCCTTCTTAGGTGACAATGTCCCCCATATCTG
TATGTCACCAGGATGGCAGAGAGCCAGGGCAGAGAGAGACTGGACTTGGGATCAGCAGGCCAGGCAGGTCTTGTCCTGGTCCTGGCCACA
TGTCTTTGCTGTGGGACCTCAGACAAAACCCTGCACCTCTTTGAGCCTTGGCTGCCTTGGTGCAGCAGGGTCATCTGTAGGGCCACCCCA
CAGCTCTTTCCTTCCCCTCCTCTCTCCAGGGAGCCGGGGCTGTGAGAGGATCATCTGGGGCAGGCCCTCCACTTCCAAGCAAGCAGATGG
GGGTGGGCACCTGAGGCCCAATAATATTTGGACCAAGTGGGAAACAAGAACACTCGGAGGGGCGGGAATCAGAAGAGCCTGGAAAAAGAC
CTAGCCCAACTTCCCTTGTGGGAAACTGAGGCCCAGCTTGGGGAAGGCCAGGACCATGCAGGGAGAAAAAGCAGACTTCCTCTGGCCACC
GCTAAGTATTTTGTTCCCTAAGTCCCCCACAGGGTGGTGGAACAGAAGAGAAAACTAAGGCTCAGCAAGGTGGAGTCCTCAAGCAGTGAC
TGGTGGGGGTGGGGCTGGGACTCGGGCTCCTGACCCCCAACCCATGGTGTTCCCTGTCACCCTGGTCTATCCACATCTCCTATTCCTGAG
GAGAGTTGACAGTAAGAGCAGTGAGAGATGGTTCTGGGCCCCATGCCCTAGACAATCAGTCTGTAAGAACTGCCAAGGAAGCCTGGTCAC
CCAGGCCAGGGATGGAGCCCAGCGAGCTCACAGCAGGCACATGCACCCCCGCCCCCACCCAGAACCTGCGGGGCAAAGAAGGGAGGTAGT
TGGGGCCAGAGTCCACCTCCAGGAGCCAGGGTGAGCTGGCTGCAGCTTCCACCTGTCAGGTAAGGTAGGAGAAGGTATGTTACCTGGCAT
CTCTCTCCCTGCCTCCCTCCATTTAGCAGGAAGTGGTGGGGTCAGGGGTCTTCAGCACAGACTTCTTGAGCCTCTGCCCCCTGTCACCCT
TCTTTTGGAATGATGTGTACCCACATCTTTGGATCCTGCCCTCCTTGTGGTTCCAGGCTGTTGGGAGGAGGTCAGCCTCCCCTGAACCAG
CTGCCTGAGGCATGCAGCATCCTTCCTCGGCAAAGCCCACCTGGCTCACAGCGGCCCCCTCTCCCCATCCTGTTCCTCTTCTTGCCCTGT
AATGAGCTCCCCCCATACCTTTCCTCCCTCACCTGAGGCTTTGCTGGTCCTCAGATTGGTTTTGTATTTGTGAGACAACCACTTGACTCC
TGGGCTGCCAGGCGGAAGCACAAGCGCACATGGATGCACACGGATGTTCTCACACACACACGCCCGCTCTCACCAATTCACAGCACCTCG
TGGTCCAGCGGAGCTGCCTGGGAGCTTGGTGAGGATGGCTCCAAAGGACACAAGCCGTTGAGTAGATGCCAGAGAATTCTGAATGGAAAA
CACAAGTCCGGGGCCTCACCAGCATCGTGGCAGAAGGCCTGGGGCATTTCTCCATGGGCCTTCTTCCCTGTGTTCGAGCTCTGACTTTTG
GAAAAGGACATTGTGGATTTTATGAAAATTTCTCATACCATCAGTCTAGCTCCAACCTAGAAAAATTGGATGATATATCAAACCCAACAT
CCCTTTCCCAAGGCACCTTAGTTAAGGCTAGCCCTTCCATAACTGACATTGTACGGTGCTTTGCAATCCTCAACCACTCTGTGGAGCAAA
GAGCATGATGCCTACTTTATAGACGGGGAAATTGACATTTGGGGCTCTCACGGCAACATAGAGGCGAAGTGAATTCTCAGATCTCCAGGC
CCCATTCTCTCTCCACCGAGTTGTGCTCCTGTCATGGGAGTGTATGGCTTAAAGACACTCCCCCACCCCCATTCCCTAGAAATCCCCCAG
ACCCACAATCAGGCAAGAAAGAACAGGGACCCAGAGGCTGGCCTGACCTAGGGGCCTGCAGGTTGGCGGCTTTGTTTCCTAAGAACATTG
AAACCTGCGGAGTCTTTGACCAAATCCACAACAGTGCTTCTGAGGTTTCATCCAGACTCTTTCCCAGCTGTCCCTGAGGTTCAGAGGGTA
TCAGAGTCAATTCAAGGCCATGCCATAATCCCTGACCAGGCCTGGACATGGGTCCAGCCCTGACTCCAGGGGTCCAGGTGCCAAGGTCAT
GTGCTGTCCCCCACTTCCCTTTCTTTGCCTTCGCACTTTGGAACAGGCTCCAGGCCTGGCTGTGACAGTATGCAGGAGTGCCCAAGCCAG
GGCCACCAGGGTGTCCACAGCCCCTGGAAACACAGATCACAATCTCAAGTCCCCTGAATGAACTGCTTCCTGGGTGAACGGGGTGGTGTA
GCCTTGCCACTCGGGCAGCGCACCAGACAGTACGGTGCAGCAGTGCCCGAGATGCCCAGAAGTGTGCCTGCCCCCCTGAGTGGCATTCAA
GTATGAAAACTTGTAAAATTTTCTGTCGGCCTAAAGAAAAATGTCCATGGGCCAAACTTGACCCACTGGGCACCAGCCTGTGAGCCCCAA
TGCCTGTCAATTGCCCCCTTTCTCATTCACCTCCTGTCCTTTGTTGCAGATTTGGAGGAGATGGGAGCCCAGAGAGGTGAGAGATGTGCT
TCAGGGTGTCCAGCAAGGCAGGGGTAGAAACGGGCACGCCCAGAGCCTGCCACTCTCCCAGGCCTCATCTTGGGCTCTTGCAAGTCTTGC
GCTTTGAAGATGGAGTTGGGTGGAAGGTCAGAGGCGCTGGGGACGGGATTGGGGAGCTGCTGGGTTTTCAGGGGAGGTCAGTGCTGCTTG
GGCACCTTTCACATGTGCAGGGAAGAGACTCAGATGTGGCCACAGGGCACTGAGGGGTGAAATCCATTTACCAGAAGTCACGCTCCAGAA
CGACTGCCCAGCCTTGGCAGCCAGTGGCTCCAGCCACCCCCTCCTCATGACATTCAGCCAGAATTGAGCTCCAAGCCAGGGAAGCAAATC
TTAAAAACCAACCAAGCACCCTGACACAGCCCTAGAAACACGATGAGTCTGAAATACAGCTTCCCAGGAGGGGAGTCTAAGATACAGCTT
CCCGGGAGGGTGGAAACCAACTCCTGCCCCACGGCCAGGCCAGGCCCAGGCAGGCATGGGTGGATCCCACAGGGCTCTGAGCTAGACCGG
CTCCACGGTGGCCCCACTACGAGGCCAGTTCTGCAGTCTTGGCCTTGTCACCCATCGAGAGGCTGCTCTGATGGTTCCCAGCCACACACC
AGCTCTCCTGGGGAAACTATTTCTTTCGTTCTTTTGGCCTCGGAGAGGTCCGAGGCAAGTACATTTCTTAAAAGGTAATAAAATGCATTA
TTGGAAAGTTGGACAGTCAGGCCACGACTCCTAGCCCACGGCGTGCCCCACCTCCCAGCAGCCCCTTCAGCCCCTTGCCCCTGTTGCCCC
AAACCTCAGGGTTCCCTCTTGCATATTCATGGGGGAACCACAGTGCTGATGTGTACTTCCCCACTGTCAGCTCGGCTGCACCTCGTGTGG
CGCCAGGTCCCAAGGGCCTCTGCAGAGGCCAGGCTGTGAGCCCCTTGCCTGCCTGCTCCCCTGATGAGGCAACAGCTTCTCTGAAATGAG
CTGCCGGCCAGGAGCAGGCAGGCACCAGCCTGTCTTTCCTTTTCTGGTAATTCCTCAGCACTGAGGCTCCGTTCCTGGGCACCCCAGGAT
TGAAGGGAACCTCAGAATCATGTCACTGCCATTCTAGAGTTTCAATCCAAGGGGTCCCCTTTAGCTCATCTCCAAGATGGGTAAACGTAG
CCACCATTCAGAAAGCCCAGAAATTCTTGTTCCCACATCTTAGACCCCTGAGCAACACAAGGAGAAAATGCAGCTGCTTACCTATTAATA
TCTACTGAGGGACAATCAGCAAAGCCTCAAAGGAGTCGTCTCAGGTAGGGTACTTGGCCTGTGGCAGGAGAGACAGAGGCACAAACCCAC
CCACCCATCAGCTTCCGGTGGCTGATCGGGGCCCAGGGAGGGAAGCAGGTGAAACAGCAGGGTGGGGGTGACTTGGCAGTCGTGCATCTC
CTCCCCGACTCTGAGGCCTGGCAGGAGGAGGCCACACCAGCCTCACCTGCCCTGACCCCCGCCCCCCACCCTGTGACCCTGTGGCTATGG
CCGCTGGTCGCCCTTGTCCCCAAAATCACCATGCCTGTGGCCACGTCCCTCATCTTCTCCAAAAGCATCATTAAGAACAAGTGATTTTGG
ATGATGGATTTTTGATTTACAAACGGCGCATTTCCCTTGGAGTGGAACAGAAAGGAAACCATTTAATGGCGCCCTTCTTTTCAAGCATGA
ATACATTTTAATGAAACTATTTTATTGTATTTGAGGAAATGGAGAGTTGAACATTCCAACCAATCAATAGCCAATTAATTGCTATAAAGC
TAAAAAGAAAATAAATAAATCCTGAGTCTATTTTAAACACTGCAAAAAGTTCAGAGCCTCAGAATCTGGCCTTCCCCTCCATAAGGTGCA
CGAGCATGTAAACACACACACACACACACACACACACACACACACACTCACTCACTCCCCTACACCTCAGACATACTTGAAACTCAGAAA
CAGCACTGAGTCTCCCCATGCCAATTCTTGCCTGCTGTCTTCGACTTGGGTCAGAGAAGGTGAGCAGACCCGGCAGCAGCCTGTCCCGGG
GCTCAGGAAGAGGCAGGCCCATCCCCTGGCCCCAAGCACCCAGCACAACAGAGGGTGGCGGGCAGTGAGGGCCTGGCGTTGCCTGGGCCC
CACTTCTCAGCCCCAGCTGCTGGGCCTCCAAGGTTGGGCTGAGGATGGAGTTTTGGCTCTGGGTTTGCCCTGACTCCTGCTGGAAGACGC
TGCCCTGGTTTTTCACCCTCTAGTGGCCTTGGACATTGAGTATTTGTAGAAATGCAGATTACATTGCAAATGGAAACCTTTGCCAGGAAG
ACACATGCATTTTGCTTTTAATTCTTTGAGACATTTGATTTTGTCTTAGGGACTGACCTTTCAGCATCAAAGAAATACATATCTACTGTA
TCCGCCAAAGTTTGTGATGCCTGCATAGACGCTTACTTGTAAAAAAAAAAAAATACAAAAAAATACAAAAAAACCAACAACAAAAACCAC
AATTGAATTGCCTTTGAAAGTGGGAGATGATCTGTCTCCAACGGATTGAAAAAAAAAAATGCTTCTTAAAAAATGTGTATGTTTTGTATT
CTTTTTTTCTAGTAGAAAATAACTGACTTGAAATATTGGTGGTTTTTTTCTTAGTGACGTGTGTTGCTTTTGTGTGTAATAATATTTGAA
TGTAATTACAGCAGTGCCAATTTGCCAAAGATGTTGGACATATTTTTCTTTTTTGGGGAGGAGGGCAGGGCTAGGGGTGGGACTTGGGAG
AAAACAGGGGTGGGGTTTTGGTTTAATTTTTTTTTTACTTTTTTTTCCTTGTCAAACCTGAAATTTGTGGCTTCCTTTTAAGTTAAATGG
TTGACTGCAACACCTTTATTTTAGATTAGTTGGAGAAACATGCAATAAGATTGGCGTAGTTTCAATATCTGTGTGTCTTTTCATGAGTGG
CTGTTACTTGTGAAGAATTGATTTTATGTAACCTTTATGTGAGATAATTATTTGTAAATATTTGCCATAATTTTATTGGTTCCTAAAATA


Top

FusionGenePPI for FAM219A_PAX5


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
FAM219APDE6D, POLA2, CSNK1G1, SPRY2, NIPSNAP3A, RABGGTB, GATAD2A, MBD3, FBXO10, MTA2, MTA3, MTA1, UBR3, ATE1, MRE11A, OBSL1, RAD50, NBN, WDFY1, MARS2, BTRC, FBXW11, KLHL24, SHPK, FBXO21, CTU2, TMEM17, GPR37, GORASP1, GATAD2B, TRIM25PAX5TLE4, DAXX, RUNX1, MYB, ID3, EP300, TBP, RB1, MAPK1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for FAM219A_PAX5


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for FAM219A_PAX5


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgenePAX5C1961102Precursor Cell Lymphoblastic Leukemia Lymphoma2CTD_human;UNIPROT
TgenePAX5C0023485Precursor B-Cell Lymphoblastic Leukemia-Lymphoma1CTD_human