FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 12645

FusionGeneSummary for FAM171A1_ANKRD26

check button Fusion gene summary
Fusion gene informationFusion gene name: FAM171A1_ANKRD26
Fusion gene ID: 12645
HgeneTgene
Gene symbol

FAM171A1

ANKRD26

Gene ID

221061

22852

Gene namefamily with sequence similarity 171 member A1ankyrin repeat domain 26
SynonymsC10orf38THC2|bA145E8.1
Cytomap

10p13

10p12.1

Type of geneprotein-codingprotein-coding
Descriptionprotein FAM171A1astroprincinankyrin repeat domain-containing protein 26GNS/ANKRD26/NCKAP1L fusion
Modification date2018051920180519
UniProtAcc

Q5VUB5

Q9UPS8

Ensembl transtripts involved in fusion geneENST00000378116, ENST00000477161, 
ENST00000376070, ENST00000376087, 
ENST00000436985, ENST00000466890, 
Fusion gene scores* DoF score2 X 1 X 2=46 X 5 X 4=120
# samples 26
** MAII scorelog2(2/4*10)=2.32192809488736log2(6/120*10)=-1
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: FAM171A1 [Title/Abstract] AND ANKRD26 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLGGTCGA-FG-8185-01AFAM171A1chr10

15412955

-ANKRD26chr10

27318285

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000378116ENST00000376070FAM171A1chr10

15412955

-ANKRD26chr10

27318285

-
In-frameENST00000378116ENST00000376087FAM171A1chr10

15412955

-ANKRD26chr10

27318285

-
In-frameENST00000378116ENST00000436985FAM171A1chr10

15412955

-ANKRD26chr10

27318285

-
5CDS-intronENST00000378116ENST00000466890FAM171A1chr10

15412955

-ANKRD26chr10

27318285

-
intron-3CDSENST00000477161ENST00000376070FAM171A1chr10

15412955

-ANKRD26chr10

27318285

-
intron-3CDSENST00000477161ENST00000376087FAM171A1chr10

15412955

-ANKRD26chr10

27318285

-
intron-3CDSENST00000477161ENST00000436985FAM171A1chr10

15412955

-ANKRD26chr10

27318285

-
intron-intronENST00000477161ENST00000466890FAM171A1chr10

15412955

-ANKRD26chr10

27318285

-

Top

FusionProtFeatures for FAM171A1_ANKRD26


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
FAM171A1

Q5VUB5

ANKRD26

Q9UPS8

Acts as a regulator of adipogenesis. Involved in theregulation of the feeding behavior.{ECO:0000250|UniProtKB:Q811D2}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneANKRD26chr10:15412955chr10:27318285ENST00000376070-9191516_15868261268Coiled coilOntology_term=ECO:0000255
TgeneANKRD26chr10:15412955chr10:27318285ENST00000376070-9191648_16738261268Coiled coilOntology_term=ECO:0000255
TgeneANKRD26chr10:15412955chr10:27318285ENST00000376070-919904_14718261268Coiled coilOntology_term=ECO:0000255
TgeneANKRD26chr10:15412955chr10:27318285ENST00000376087-24341516_158612691711Coiled coilOntology_term=ECO:0000255
TgeneANKRD26chr10:15412955chr10:27318285ENST00000376087-24341648_167312691711Coiled coilOntology_term=ECO:0000255

- In-frame and not-retained protein feature among the 13 regional features.
>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneFAM171A1chr10:15412955chr10:27318285ENST00000378116-1822_30332891Topological domainExtracellular
HgeneFAM171A1chr10:15412955chr10:27318285ENST00000378116-18325_89032891Topological domainCytoplasmic
HgeneFAM171A1chr10:15412955chr10:27318285ENST00000378116-18304_32432891TransmembraneHelical
TgeneANKRD26chr10:15412955chr10:27318285ENST00000376070-919529_5668261268Coiled coilOntology_term=ECO:0000255
TgeneANKRD26chr10:15412955chr10:27318285ENST00000376070-919742_8728261268Coiled coilOntology_term=ECO:0000255
TgeneANKRD26chr10:15412955chr10:27318285ENST00000376087-2434529_56612691711Coiled coilOntology_term=ECO:0000255
TgeneANKRD26chr10:15412955chr10:27318285ENST00000376087-2434742_87212691711Coiled coilOntology_term=ECO:0000255
TgeneANKRD26chr10:15412955chr10:27318285ENST00000376087-2434904_147112691711Coiled coilOntology_term=ECO:0000255
TgeneANKRD26chr10:15412955chr10:27318285ENST00000376070-91925_288261268Compositional biasNote=Poly-Gly
TgeneANKRD26chr10:15412955chr10:27318285ENST00000376070-919574_5798261268Compositional biasNote=Poly-Asp
TgeneANKRD26chr10:15412955chr10:27318285ENST00000376087-243425_2812691711Compositional biasNote=Poly-Gly
TgeneANKRD26chr10:15412955chr10:27318285ENST00000376087-2434574_57912691711Compositional biasNote=Poly-Asp
TgeneANKRD26chr10:15412955chr10:27318285ENST00000376070-919112_1418261268RepeatNote=ANK 3
TgeneANKRD26chr10:15412955chr10:27318285ENST00000376070-919145_1748261268RepeatNote=ANK 4
TgeneANKRD26chr10:15412955chr10:27318285ENST00000376070-919178_2078261268RepeatNote=ANK 5
TgeneANKRD26chr10:15412955chr10:27318285ENST00000376070-91945_758261268RepeatNote=ANK 1
TgeneANKRD26chr10:15412955chr10:27318285ENST00000376070-91979_1088261268RepeatNote=ANK 2
TgeneANKRD26chr10:15412955chr10:27318285ENST00000376087-2434112_14112691711RepeatNote=ANK 3
TgeneANKRD26chr10:15412955chr10:27318285ENST00000376087-2434145_17412691711RepeatNote=ANK 4
TgeneANKRD26chr10:15412955chr10:27318285ENST00000376087-2434178_20712691711RepeatNote=ANK 5
TgeneANKRD26chr10:15412955chr10:27318285ENST00000376087-243445_7512691711RepeatNote=ANK 1
TgeneANKRD26chr10:15412955chr10:27318285ENST00000376087-243479_10812691711RepeatNote=ANK 2


Top

FusionGeneSequence for FAM171A1_ANKRD26


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_FAM171A1_ENST00000378116_chr10_15412955_-_ANKRD26_ENST00000376070_chr10_27318285_-_474aa
MSRSATLLLCLLGCHVWKAVTKTLREPGAGAQVARSTGSTYRSCQMC_EDARSQAKA_KR_CQVKSYSQKANGQN_GASEKPVKCKFV_R
_KGTIKETTGIKTVTGM_FGSRNEEKC_IRKRDNWI_EPLKNDKKEVK_I_KWRI_FPWRFKN_SI_NGTSD__AKT_D__SYSRTGDCR
FKMSTSGYKEPNSSRGVVITENSTKEM_KTTEE_KEVGTRSDQPEKSTRKETGRTWSSQTV_TGD_RKSKTGNSRKIKRSQSIFTGTSSI
SRKLRAV_RE_FCFNEKSDGTQN_RSGI_TLQNKNFSRRL__NRTGKI_ATLSRRIKS_KIFVK_TNQN__EASRGQHQTSCGKTAEQIF
VHHSHYQASHGATLCGKS___FRSQQKTTSKRKLSDLYLKSTGFK__HGELLEQDAAGVGKKTN_RTQRSCC_IGIWINSFPSRVY__VK

>In-frame_FAM171A1_ENST00000378116_chr10_15412955_-_ANKRD26_ENST00000376087_chr10_27318285_-_474aa
MSRSATLLLCLLGCHVWKAVTKTLREPGAGAQVARSTGSTYRSCQMC_EDARSQAKA_KR_CQVKSYSQKANGQN_GASEKPVKCKFV_R
_KGTIKETTGIKTVTGM_FGSRNEEKC_IRKRDNWI_EPLKNDKKEVK_I_KWRI_FPWRFKN_SI_NGTSD__AKT_D__SYSRTGDCR
FKMSTSGYKEPNSSRGVVITENSTKEM_KTTEE_KEVGTRSDQPEKSTRKETGRTWSSQTV_TGD_RKSKTGNSRKIKRSQSIFTGTSSI
SRKLRAV_RE_FCFNEKSDGTQN_RSGI_TLQNKNFSRRL__NRTGKI_ATLSRRIKS_KIFVK_TNQN__EASRGQHQTSCGKTAEQIF
VHHSHYQASHGATLCGKS___FRSQQKTTSKRKLSDLYLKSTGFK__HGELLEQDAAGVGKKTN_RTQRSCC_IGIWINSFPSRVY__VK

>In-frame_FAM171A1_ENST00000378116_chr10_15412955_-_ANKRD26_ENST00000436985_chr10_27318285_-_474aa
MSRSATLLLCLLGCHVWKAVTKTLREPGAGAQVARSTGSTYRSCQMC_EDARSQAKA_KR_CQVKSYSQKANGQN_GASEKPVKCKFV_R
_KGTIKETTGIKTVTGM_FGSRNEEKC_IRKRDNWI_EPLKNDKKEVK_I_KWRI_FPWRFKN_SI_NGTSD__AKT_D__SYSRTGDCR
FKMSTSGYKEPNSSRGVVITENSTKEM_KTTEE_KEVGTRSDQPEKSTRKETGRTWSSQTV_TGD_RKSKTGNSRKIKRSQSIFTGTSSI
SRKLRAV_RE_FCFNEKSDGTQN_RSGI_TLQNKNFSRRL__NRTGKI_ATLSRRIKS_KIFVK_TNQN__EASRGQHQTSCGKTAEQIF
VHHSHYQASHGATLCGKS___FRSQQKTTSKRKLSDLYLKSTGFK__HGELLEQDAAGVGKKTN_RTQRSCC_IGIWINSFPSRVY__VK


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_FAM171A1_ENST00000378116_chr10_15412955_-_ANKRD26_ENST00000376070_chr10_27318285_-_1423nt
ATGAGCAGGTCCGCGACGCTGCTGCTGTGCCTGCTGGGCTGCCACGTCTGGAAGGCGGTGACCAAGACGCTGCGGGAGCCCGGCGCCGGA
GCCCAAGTTGCAAGAAGCACAGGATCGACATACAGAAGCTGTCAGATGTGCTGAGAAGATGCAAGATCACAAGCAAAAGCTTGAAAAAGA
TAATGCCAAGTTAAAAGTTACAGTCAAAAAGCAAATGGACAAAATTGAGGAGCTTCAGAAAAACCTGTTAAATGCAAATTTGTCTGAAGA
TGAAAAGGAACAATTAAAGAAACTTATGGAATTAAAACAGTCACTGGAATGTAATTTGGATCAAGAAATGAAGAAAAATGTTGAATTAGA
AAGAGAGATAACTGGATTTAAGAACCTCTTAAAAATGACAAGAAAGAAGTTAAATGAATATGAAAATGGAGAATTTAGTTTCCATGGAGA
TTTAAAAACTAGTCAATTTGAAATGGATATTCAGATTAATAAGCTAAAACATAAGATTGATGATCTTACAGCAGAACTGGAGACTGCAGG
TTCAAAATGTCTACATCTGGATACAAAGAACCAAATTCTTCAAGAGGAGTTGTTATCTATGAAAACAGTACAAAAGAAATGTGAAAAACT
ACAGAAGAATAAAAAGAAGTTGGAACAAGAAGTGATCAACCTGAGAAGTCATATAGAAAGGAATATGGTAGAACTTGGTCAAGTCAAACA
GTATAAACAGGAGATTGAAGAAAGAGCAAGACAGGAAATAGCAGAAAAATTAAAAGAAGTCAATCTATTTTTACAGGCACAAGCAGCATC
TCAAGAAAACTTAGAGCAGTTTAGAGAGAATAATTTTGCTTCAATGAAAAGTCAGATGGAACTCAGAATTAAAGATCTGGAATCTGAACT
CTCCAAAATAAAAACTTCTCAAGAAGACTTTAATAAAACCGAACTGGAAAAATATAAGCAACTCTATCTAGAAGAATTAAAAGTTAGAAA
ATCTTTGTCAAGTAAACTAACCAAAACTAATGAGAGGCTAGCAGAGGTCAACACCAAACTTCTTGTGGAAAAACAGCAGAGCAGATCTTT
GTTCACCACTCTCACTACCAGGCCAGTCATGGAGCCACCTTGTGTGGGAAATCTTAATAATAGTTTAGATCTCAACAGAAAACTTATTCC
AAGAGAAAACTTAGTGATCTCTACCTCAAATCCACGGGCTTCAAATAATAGCATGGAGAACTACTTGAGCAAGATGCAGCAGGAGTTGGA
AAAAAATATAACTAGAGAACTCAAAGAAGCTGCTGCTGAATTGGAATCTGGATCAATAGCTTCCCCTCTAGGGTCTACTGATGAGTCAAA

>In-frame_FAM171A1_ENST00000378116_chr10_15412955_-_ANKRD26_ENST00000376087_chr10_27318285_-_1423nt
ATGAGCAGGTCCGCGACGCTGCTGCTGTGCCTGCTGGGCTGCCACGTCTGGAAGGCGGTGACCAAGACGCTGCGGGAGCCCGGCGCCGGA
GCCCAAGTTGCAAGAAGCACAGGATCGACATACAGAAGCTGTCAGATGTGCTGAGAAGATGCAAGATCACAAGCAAAAGCTTGAAAAAGA
TAATGCCAAGTTAAAAGTTACAGTCAAAAAGCAAATGGACAAAATTGAGGAGCTTCAGAAAAACCTGTTAAATGCAAATTTGTCTGAAGA
TGAAAAGGAACAATTAAAGAAACTTATGGAATTAAAACAGTCACTGGAATGTAATTTGGATCAAGAAATGAAGAAAAATGTTGAATTAGA
AAGAGAGATAACTGGATTTAAGAACCTCTTAAAAATGACAAGAAAGAAGTTAAATGAATATGAAAATGGAGAATTTAGTTTCCATGGAGA
TTTAAAAACTAGTCAATTTGAAATGGATATTCAGATTAATAAGCTAAAACATAAGATTGATGATCTTACAGCAGAACTGGAGACTGCAGG
TTCAAAATGTCTACATCTGGATACAAAGAACCAAATTCTTCAAGAGGAGTTGTTATCTATGAAAACAGTACAAAAGAAATGTGAAAAACT
ACAGAAGAATAAAAAGAAGTTGGAACAAGAAGTGATCAACCTGAGAAGTCATATAGAAAGGAATATGGTAGAACTTGGTCAAGTCAAACA
GTATAAACAGGAGATTGAAGAAAGAGCAAGACAGGAAATAGCAGAAAAATTAAAAGAAGTCAATCTATTTTTACAGGCACAAGCAGCATC
TCAAGAAAACTTAGAGCAGTTTAGAGAGAATAATTTTGCTTCAATGAAAAGTCAGATGGAACTCAGAATTAAAGATCTGGAATCTGAACT
CTCCAAAATAAAAACTTCTCAAGAAGACTTTAATAAAACCGAACTGGAAAAATATAAGCAACTCTATCTAGAAGAATTAAAAGTTAGAAA
ATCTTTGTCAAGTAAACTAACCAAAACTAATGAGAGGCTAGCAGAGGTCAACACCAAACTTCTTGTGGAAAAACAGCAGAGCAGATCTTT
GTTCACCACTCTCACTACCAGGCCAGTCATGGAGCCACCTTGTGTGGGAAATCTTAATAATAGTTTAGATCTCAACAGAAAACTTATTCC
AAGAGAAAACTTAGTGATCTCTACCTCAAATCCACGGGCTTCAAATAATAGCATGGAGAACTACTTGAGCAAGATGCAGCAGGAGTTGGA
AAAAAATATAACTAGAGAACTCAAAGAAGCTGCTGCTGAATTGGAATCTGGATCAATAGCTTCCCCTCTAGGGTCTACTGATGAGTCAAA

>In-frame_FAM171A1_ENST00000378116_chr10_15412955_-_ANKRD26_ENST00000436985_chr10_27318285_-_1423nt
ATGAGCAGGTCCGCGACGCTGCTGCTGTGCCTGCTGGGCTGCCACGTCTGGAAGGCGGTGACCAAGACGCTGCGGGAGCCCGGCGCCGGA
GCCCAAGTTGCAAGAAGCACAGGATCGACATACAGAAGCTGTCAGATGTGCTGAGAAGATGCAAGATCACAAGCAAAAGCTTGAAAAAGA
TAATGCCAAGTTAAAAGTTACAGTCAAAAAGCAAATGGACAAAATTGAGGAGCTTCAGAAAAACCTGTTAAATGCAAATTTGTCTGAAGA
TGAAAAGGAACAATTAAAGAAACTTATGGAATTAAAACAGTCACTGGAATGTAATTTGGATCAAGAAATGAAGAAAAATGTTGAATTAGA
AAGAGAGATAACTGGATTTAAGAACCTCTTAAAAATGACAAGAAAGAAGTTAAATGAATATGAAAATGGAGAATTTAGTTTCCATGGAGA
TTTAAAAACTAGTCAATTTGAAATGGATATTCAGATTAATAAGCTAAAACATAAGATTGATGATCTTACAGCAGAACTGGAGACTGCAGG
TTCAAAATGTCTACATCTGGATACAAAGAACCAAATTCTTCAAGAGGAGTTGTTATCTATGAAAACAGTACAAAAGAAATGTGAAAAACT
ACAGAAGAATAAAAAGAAGTTGGAACAAGAAGTGATCAACCTGAGAAGTCATATAGAAAGGAATATGGTAGAACTTGGTCAAGTCAAACA
GTATAAACAGGAGATTGAAGAAAGAGCAAGACAGGAAATAGCAGAAAAATTAAAAGAAGTCAATCTATTTTTACAGGCACAAGCAGCATC
TCAAGAAAACTTAGAGCAGTTTAGAGAGAATAATTTTGCTTCAATGAAAAGTCAGATGGAACTCAGAATTAAAGATCTGGAATCTGAACT
CTCCAAAATAAAAACTTCTCAAGAAGACTTTAATAAAACCGAACTGGAAAAATATAAGCAACTCTATCTAGAAGAATTAAAAGTTAGAAA
ATCTTTGTCAAGTAAACTAACCAAAACTAATGAGAGGCTAGCAGAGGTCAACACCAAACTTCTTGTGGAAAAACAGCAGAGCAGATCTTT
GTTCACCACTCTCACTACCAGGCCAGTCATGGAGCCACCTTGTGTGGGAAATCTTAATAATAGTTTAGATCTCAACAGAAAACTTATTCC
AAGAGAAAACTTAGTGATCTCTACCTCAAATCCACGGGCTTCAAATAATAGCATGGAGAACTACTTGAGCAAGATGCAGCAGGAGTTGGA
AAAAAATATAACTAGAGAACTCAAAGAAGCTGCTGCTGAATTGGAATCTGGATCAATAGCTTCCCCTCTAGGGTCTACTGATGAGTCAAA


* Fusion transcript sequences (Full-length transcript).
>In-frame_FAM171A1_ENST00000378116_chr10_15412955_-_ANKRD26_ENST00000376070_chr10_27318285_-_2904nt
GGCGGAGATGAGCAGGTCCGCGACGCTGCTGCTGTGCCTGCTGGGCTGCCACGTCTGGAAGGCGGTGACCAAGACGCTGCGGGAGCCCGG
CGCCGGAGCCCAAGTTGCAAGAAGCACAGGATCGACATACAGAAGCTGTCAGATGTGCTGAGAAGATGCAAGATCACAAGCAAAAGCTTG
AAAAAGATAATGCCAAGTTAAAAGTTACAGTCAAAAAGCAAATGGACAAAATTGAGGAGCTTCAGAAAAACCTGTTAAATGCAAATTTGT
CTGAAGATGAAAAGGAACAATTAAAGAAACTTATGGAATTAAAACAGTCACTGGAATGTAATTTGGATCAAGAAATGAAGAAAAATGTTG
AATTAGAAAGAGAGATAACTGGATTTAAGAACCTCTTAAAAATGACAAGAAAGAAGTTAAATGAATATGAAAATGGAGAATTTAGTTTCC
ATGGAGATTTAAAAACTAGTCAATTTGAAATGGATATTCAGATTAATAAGCTAAAACATAAGATTGATGATCTTACAGCAGAACTGGAGA
CTGCAGGTTCAAAATGTCTACATCTGGATACAAAGAACCAAATTCTTCAAGAGGAGTTGTTATCTATGAAAACAGTACAAAAGAAATGTG
AAAAACTACAGAAGAATAAAAAGAAGTTGGAACAAGAAGTGATCAACCTGAGAAGTCATATAGAAAGGAATATGGTAGAACTTGGTCAAG
TCAAACAGTATAAACAGGAGATTGAAGAAAGAGCAAGACAGGAAATAGCAGAAAAATTAAAAGAAGTCAATCTATTTTTACAGGCACAAG
CAGCATCTCAAGAAAACTTAGAGCAGTTTAGAGAGAATAATTTTGCTTCAATGAAAAGTCAGATGGAACTCAGAATTAAAGATCTGGAAT
CTGAACTCTCCAAAATAAAAACTTCTCAAGAAGACTTTAATAAAACCGAACTGGAAAAATATAAGCAACTCTATCTAGAAGAATTAAAAG
TTAGAAAATCTTTGTCAAGTAAACTAACCAAAACTAATGAGAGGCTAGCAGAGGTCAACACCAAACTTCTTGTGGAAAAACAGCAGAGCA
GATCTTTGTTCACCACTCTCACTACCAGGCCAGTCATGGAGCCACCTTGTGTGGGAAATCTTAATAATAGTTTAGATCTCAACAGAAAAC
TTATTCCAAGAGAAAACTTAGTGATCTCTACCTCAAATCCACGGGCTTCAAATAATAGCATGGAGAACTACTTGAGCAAGATGCAGCAGG
AGTTGGAAAAAAATATAACTAGAGAACTCAAAGAAGCTGCTGCTGAATTGGAATCTGGATCAATAGCTTCCCCTCTAGGGTCTACTGATG
AGTCAAATCTAAATCAAGATCTAGTTTGGAAAGCATCAAGAGAATATGTACAGGTTTTAAAGAAAAATTATATGATCTGAAAGATAAGAT
TTTATTACTGGGCTGTTTATGTGACATTTTGTTTCTCATTAAATATTAATATATGACATGTAAAAATATTAAAGGAACGTATTTTTGTAT
CATATATGTCAGATCAAAATTTATATAGTATTTTAAACAATGTTACTTGGCTTCTTTAACTTTTAAGTGGATTTTGCCAATGAAAACCAG
GAATATTGAGTTTTACATACTCAAACTGCCCAAATGTGAGCTGTTTAAACAGCCAAACCACTAAGTTGTCATTAATACTTTAGTGCAGTT
AATTGATGGCTTATTTGTATTTTGTAATTTTTATCACTATATGTAGTGGTAGATGTCTAATTGGACTTAGACATCATTTTGTTGTGCAGG
AACTGTGGTCATTGTTCATGTTTGGATGTATTACAATTGTTACAGTGCCATCAAATTTACATAATTTTAATTTTAAGCACTGATTTATAT
AGCTGTTCTCAGGGAGAAACAAGATTTGCCTGATTCACCTTTTCTGTTTGTTTATTTATTTTTAATTAACCTTTTGGAAATAGCCTTCAG
TTTAGAGAAAATTTCGAAGTTTTAGTACAAAGACTTTCTCCTCCGAACAATTTGAGAGTAAATTGCTGACATTATGTCATCACCCCTGAT
TACTTTAGTGGGCATTCCTACAAGTCAGGACATTCTACATAACTACAGTGCAAACCTTGCAATCAGAAAGTCAACATTAATACATTCTAG
TTTGTTACTTCTCTGTAATGTCCTTTATAGCAAAAGGATCCCATTCTAATCCATGGCTTGTATTTAGTTGTTGTATCTGTTAGATCTTTC
AGTCTGGAACAGTTCCTCAGTCTTTCCTTGACCTTCATGACCTTGAATATTTTGAAGAGTAAAGTCTGGTAATATAAGAATGTCCCTCAA
TTGGGTTTCATGGTGATTAGATTTAGATTATATGATTTTTTGGCAGGAGTATCACAGAAGTGACCCAGTGATCTTCTCATTGCATCTTAC
CTGTGACCCTACAGTTTTGATTTGCCCTGTTACTGGTAATGTTAGCATTGATCACTAACAGTGGTATCTGCTGAATTTCTCCTCTGTAAT
GTTATTTTTTCACCTTGTGGTTAATTAGTATTTTACAGGGAGGTAATTTGAGACTATGTACATATCTCTACTCCCCATCGAACCCTCAAT
TTATTCATTTGCTTGTATCAAATAAACCATGGATTCATGGTTTATTTTATTCAGTGAGTTATAATTCATTAATATTGTTATTAAAAATTT
GTTTTTCTTTTAAGAAATGTTATATTTTGACAACTTCAGACTTACAGAAAGATTATAAGAGGTAGTACAAATAATTTTTGGATATTATTC
CCCAAATGTTAACATTTTACTGCATTTACTTTATCCTTTCTCCCCCTTCTCCTCCTGTCTTTCTAGATGAATATGAATATAGGTACTTAA

>In-frame_FAM171A1_ENST00000378116_chr10_15412955_-_ANKRD26_ENST00000376087_chr10_27318285_-_2722nt
GGCGGAGATGAGCAGGTCCGCGACGCTGCTGCTGTGCCTGCTGGGCTGCCACGTCTGGAAGGCGGTGACCAAGACGCTGCGGGAGCCCGG
CGCCGGAGCCCAAGTTGCAAGAAGCACAGGATCGACATACAGAAGCTGTCAGATGTGCTGAGAAGATGCAAGATCACAAGCAAAAGCTTG
AAAAAGATAATGCCAAGTTAAAAGTTACAGTCAAAAAGCAAATGGACAAAATTGAGGAGCTTCAGAAAAACCTGTTAAATGCAAATTTGT
CTGAAGATGAAAAGGAACAATTAAAGAAACTTATGGAATTAAAACAGTCACTGGAATGTAATTTGGATCAAGAAATGAAGAAAAATGTTG
AATTAGAAAGAGAGATAACTGGATTTAAGAACCTCTTAAAAATGACAAGAAAGAAGTTAAATGAATATGAAAATGGAGAATTTAGTTTCC
ATGGAGATTTAAAAACTAGTCAATTTGAAATGGATATTCAGATTAATAAGCTAAAACATAAGATTGATGATCTTACAGCAGAACTGGAGA
CTGCAGGTTCAAAATGTCTACATCTGGATACAAAGAACCAAATTCTTCAAGAGGAGTTGTTATCTATGAAAACAGTACAAAAGAAATGTG
AAAAACTACAGAAGAATAAAAAGAAGTTGGAACAAGAAGTGATCAACCTGAGAAGTCATATAGAAAGGAATATGGTAGAACTTGGTCAAG
TCAAACAGTATAAACAGGAGATTGAAGAAAGAGCAAGACAGGAAATAGCAGAAAAATTAAAAGAAGTCAATCTATTTTTACAGGCACAAG
CAGCATCTCAAGAAAACTTAGAGCAGTTTAGAGAGAATAATTTTGCTTCAATGAAAAGTCAGATGGAACTCAGAATTAAAGATCTGGAAT
CTGAACTCTCCAAAATAAAAACTTCTCAAGAAGACTTTAATAAAACCGAACTGGAAAAATATAAGCAACTCTATCTAGAAGAATTAAAAG
TTAGAAAATCTTTGTCAAGTAAACTAACCAAAACTAATGAGAGGCTAGCAGAGGTCAACACCAAACTTCTTGTGGAAAAACAGCAGAGCA
GATCTTTGTTCACCACTCTCACTACCAGGCCAGTCATGGAGCCACCTTGTGTGGGAAATCTTAATAATAGTTTAGATCTCAACAGAAAAC
TTATTCCAAGAGAAAACTTAGTGATCTCTACCTCAAATCCACGGGCTTCAAATAATAGCATGGAGAACTACTTGAGCAAGATGCAGCAGG
AGTTGGAAAAAAATATAACTAGAGAACTCAAAGAAGCTGCTGCTGAATTGGAATCTGGATCAATAGCTTCCCCTCTAGGGTCTACTGATG
AGTCAAATCTAAATCAAGATCTAGTTTGGAAAGCATCAAGAGAATATGTACAGGTTTTAAAGAAAAATTATATGATCTGAAAGATAAGAT
TTTATTACTGGGCTGTTTATGTGACATTTTGTTTCTCATTAAATATTAATATATGACATGTAAAAATATTAAAGGAACGTATTTTTGTAT
CATATATGTCAGATCAAAATTTATATAGTATTTTAAACAATGTTACTTGGCTTCTTTAACTTTTAAGTGGATTTTGCCAATGAAAACCAG
GAATATTGAGTTTTACATACTCAAACTGCCCAAATGTGAGCTGTTTAAACAGCCAAACCACTAAGTTGTCATTAATACTTTAGTGCAGTT
AATTGATGGCTTATTTGTATTTTGTAATTTTTATCACTATATGTAGTGGTAGATGTCTAATTGGACTTAGACATCATTTTGTTGTGCAGG
AACTGTGGTCATTGTTCATGTTTGGATGTATTACAATTGTTACAGTGCCATCAAATTTACATAATTTTAATTTTAAGCACTGATTTATAT
AGCTGTTCTCAGGGAGAAACAAGATTTGCCTGATTCACCTTTTCTGTTTGTTTATTTATTTTTAATTAACCTTTTGGAAATAGCCTTCAG
TTTAGAGAAAATTTCGAAGTTTTAGTACAAAGACTTTCTCCTCCGAACAATTTGAGAGTAAATTGCTGACATTATGTCATCACCCCTGAT
TACTTTAGTGGGCATTCCTACAAGTCAGGACATTCTACATAACTACAGTGCAAACCTTGCAATCAGAAAGTCAACATTAATACATTCTAG
TTTGTTACTTCTCTGTAATGTCCTTTATAGCAAAAGGATCCCATTCTAATCCATGGCTTGTATTTAGTTGTTGTATCTGTTAGATCTTTC
AGTCTGGAACAGTTCCTCAGTCTTTCCTTGACCTTCATGACCTTGAATATTTTGAAGAGTAAAGTCTGGTAATATAAGAATGTCCCTCAA
TTGGGTTTCATGGTGATTAGATTTAGATTATATGATTTTTTGGCAGGAGTATCACAGAAGTGACCCAGTGATCTTCTCATTGCATCTTAC
CTGTGACCCTACAGTTTTGATTTGCCCTGTTACTGGTAATGTTAGCATTGATCACTAACAGTGGTATCTGCTGAATTTCTCCTCTGTAAT
GTTATTTTTTCACCTTGTGGTTAATTAGTATTTTACAGGGAGGTAATTTGAGACTATGTACATATCTCTACTCCCCATCGAACCCTCAAT
TTATTCATTTGCTTGTATCAAATAAACCATGGATTCATGGTTTATTTTATTCAGTGAGTTATAATTCATTAATATTGTTATTAAAAATTT

>In-frame_FAM171A1_ENST00000378116_chr10_15412955_-_ANKRD26_ENST00000436985_chr10_27318285_-_1471nt
GGCGGAGATGAGCAGGTCCGCGACGCTGCTGCTGTGCCTGCTGGGCTGCCACGTCTGGAAGGCGGTGACCAAGACGCTGCGGGAGCCCGG
CGCCGGAGCCCAAGTTGCAAGAAGCACAGGATCGACATACAGAAGCTGTCAGATGTGCTGAGAAGATGCAAGATCACAAGCAAAAGCTTG
AAAAAGATAATGCCAAGTTAAAAGTTACAGTCAAAAAGCAAATGGACAAAATTGAGGAGCTTCAGAAAAACCTGTTAAATGCAAATTTGT
CTGAAGATGAAAAGGAACAATTAAAGAAACTTATGGAATTAAAACAGTCACTGGAATGTAATTTGGATCAAGAAATGAAGAAAAATGTTG
AATTAGAAAGAGAGATAACTGGATTTAAGAACCTCTTAAAAATGACAAGAAAGAAGTTAAATGAATATGAAAATGGAGAATTTAGTTTCC
ATGGAGATTTAAAAACTAGTCAATTTGAAATGGATATTCAGATTAATAAGCTAAAACATAAGATTGATGATCTTACAGCAGAACTGGAGA
CTGCAGGTTCAAAATGTCTACATCTGGATACAAAGAACCAAATTCTTCAAGAGGAGTTGTTATCTATGAAAACAGTACAAAAGAAATGTG
AAAAACTACAGAAGAATAAAAAGAAGTTGGAACAAGAAGTGATCAACCTGAGAAGTCATATAGAAAGGAATATGGTAGAACTTGGTCAAG
TCAAACAGTATAAACAGGAGATTGAAGAAAGAGCAAGACAGGAAATAGCAGAAAAATTAAAAGAAGTCAATCTATTTTTACAGGCACAAG
CAGCATCTCAAGAAAACTTAGAGCAGTTTAGAGAGAATAATTTTGCTTCAATGAAAAGTCAGATGGAACTCAGAATTAAAGATCTGGAAT
CTGAACTCTCCAAAATAAAAACTTCTCAAGAAGACTTTAATAAAACCGAACTGGAAAAATATAAGCAACTCTATCTAGAAGAATTAAAAG
TTAGAAAATCTTTGTCAAGTAAACTAACCAAAACTAATGAGAGGCTAGCAGAGGTCAACACCAAACTTCTTGTGGAAAAACAGCAGAGCA
GATCTTTGTTCACCACTCTCACTACCAGGCCAGTCATGGAGCCACCTTGTGTGGGAAATCTTAATAATAGTTTAGATCTCAACAGAAAAC
TTATTCCAAGAGAAAACTTAGTGATCTCTACCTCAAATCCACGGGCTTCAAATAATAGCATGGAGAACTACTTGAGCAAGATGCAGCAGG
AGTTGGAAAAAAATATAACTAGAGAACTCAAAGAAGCTGCTGCTGAATTGGAATCTGGATCAATAGCTTCCCCTCTAGGGTCTACTGATG
AGTCAAATCTAAATCAAGATCTAGTTTGGAAAGCATCAAGAGAATATGTACAGGTTTTAAAGAAAAATTATATGATCTGAAAGATAAGAT


Top

FusionGenePPI for FAM171A1_ANKRD26


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
FAM171A1NTRK1, TMEM17, CTDSPL, FAM171B, PCDHGB1, TNFRSF17ANKRD26BRCA1, CBX2, CBX4, AMOT, PRKAR1A, MED4, PCM1, CEP128, CEP89, CNTRL, CCDC40, NDEL1, RALBP1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for FAM171A1_ANKRD26


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for FAM171A1_ANKRD26


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource