FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 12381

FusionGeneSummary for EZR_ROS1

check button Fusion gene summary
Fusion gene informationFusion gene name: EZR_ROS1
Fusion gene ID: 12381
HgeneTgene
Gene symbol

EZR

ROS1

Gene ID

7430

6098

Gene nameezrinROS proto-oncogene 1, receptor tyrosine kinase
SynonymsCVIL|CVL|HEL-S-105|VIL2MCF3|ROS|c-ros-1
Cytomap

6q25.3

6q22.1

Type of geneprotein-codingprotein-coding
Descriptionezrincytovillin 2epididymis secretory protein Li 105p81villin 2 (ezrin)proto-oncogene tyrosine-protein kinase ROSROS proto-oncogene 1 , receptor tyrosine kinasec-ros oncogene 1 , receptor tyrosine kinaseproto-oncogene c-Ros-1transmembrane tyrosine-specific protein kinasev-ros avian UR2 sarcoma virus oncogene homolog 1
Modification date2018052320180523
UniProtAcc

P15311

P08922

Ensembl transtripts involved in fusion geneENST00000337147, ENST00000367075, 
ENST00000392177, ENST00000476189, 
ENST00000368508, ENST00000368507, 
Fusion gene scores* DoF score14 X 13 X 5=9105 X 6 X 3=90
# samples 1712
** MAII scorelog2(17/910*10)=-2.42033179894836
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(12/90*10)=0.415037499278844
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: EZR [Title/Abstract] AND ROS1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Kinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneEZR

GO:0048015

phosphatidylinositol-mediated signaling

25591774

HgeneEZR

GO:0051017

actin filament bundle assembly

10793131

TgeneROS1

GO:0001558

regulation of cell growth

16885344

TgeneROS1

GO:0006468

protein phosphorylation

16885344

TgeneROS1

GO:0032006

regulation of TOR signaling

16885344


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUADTCGA-NJ-A7XG-01AEZRchr6

159191796

-ROS1chr6

117645578

-
TCGARVLUADTCGA-55-6986-01AEZRchr6

159191796

-ROS1chr6

117645578

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000337147ENST00000368508EZRchr6

159191796

-ROS1chr6

117645578

-
In-frameENST00000337147ENST00000368507EZRchr6

159191796

-ROS1chr6

117645578

-
Frame-shitENST00000367075ENST00000368508EZRchr6

159191796

-ROS1chr6

117645578

-
Frame-shitENST00000367075ENST00000368507EZRchr6

159191796

-ROS1chr6

117645578

-
In-frameENST00000392177ENST00000368508EZRchr6

159191796

-ROS1chr6

117645578

-
In-frameENST00000392177ENST00000368507EZRchr6

159191796

-ROS1chr6

117645578

-
intron-3CDSENST00000476189ENST00000368508EZRchr6

159191796

-ROS1chr6

117645578

-
intron-3CDSENST00000476189ENST00000368507EZRchr6

159191796

-ROS1chr6

117645578

-

Top

FusionProtFeatures for EZR_ROS1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
EZR

P15311

ROS1

P08922

Probably involved in connections of major cytoskeletalstructures to the plasma membrane. In epithelial cells, requiredfor the formation of microvilli and membrane ruffles on the apicalpole. Along with PLEKHG6, required for normal macropinocytosis.{ECO:0000269|PubMed:17881735, ECO:0000269|PubMed:18270268,ECO:0000269|PubMed:19111582}. Orphan receptor tyrosine kinase (RTK) that plays a rolein epithelial cell differentiation and regionalization of theproximal epididymal epithelium. May activate several downstreamsignaling pathways related to cell differentiation, proliferation,growth and survival including the PI3 kinase-mTOR signalingpathway. Mediates the phosphorylation of PTPN11, an activator ofthis pathway. May also phosphorylate and activate thetranscription factor STAT3 to control anchorage-independent cellgrowth. Mediates the phosphorylation and the activation of VAV3, aguanine nucleotide exchange factor regulating cell morphology. Mayactivate other downstream signaling proteins including AKT1,MAPK1, MAPK3, IRS1 and PLCG2. {ECO:0000269|PubMed:11094073,ECO:0000269|PubMed:16885344}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneEZRchr6:159191796chr6:117645578ENST00000337147-9132_295363587DomainFERM
HgeneEZRchr6:159191796chr6:117645578ENST00000367075-10142_295363587DomainFERM
HgeneEZRchr6:159191796chr6:117645578ENST00000337147-913115_120363587Motif[IL]-x-C-x-x-[DE] motif
HgeneEZRchr6:159191796chr6:117645578ENST00000367075-1014115_120363587Motif[IL]-x-C-x-x-[DE] motif
TgeneROS1chr6:159191796chr6:117645578ENST00000368508-32431945_222218522348DomainProtein kinase
TgeneROS1chr6:159191796chr6:117645578ENST00000368508-32431951_195918522348Nucleotide bindingATP
TgeneROS1chr6:159191796chr6:117645578ENST00000368508-32431883_234718522348Topological domainCytoplasmic
TgeneROS1chr6:159191796chr6:117645578ENST00000368508-32431860_188218522348TransmembraneHelical

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneROS1chr6:159191796chr6:117645578ENST00000368508-3243101_19618522348DomainFibronectin type-III 1
TgeneROS1chr6:159191796chr6:117645578ENST00000368508-32431043_115018522348DomainFibronectin type-III 5
TgeneROS1chr6:159191796chr6:117645578ENST00000368508-32431450_155618522348DomainFibronectin type-III 6
TgeneROS1chr6:159191796chr6:117645578ENST00000368508-32431557_165618522348DomainFibronectin type-III 7
TgeneROS1chr6:159191796chr6:117645578ENST00000368508-32431658_175118522348DomainFibronectin type-III 8
TgeneROS1chr6:159191796chr6:117645578ENST00000368508-32431752_185418522348DomainFibronectin type-III 9
TgeneROS1chr6:159191796chr6:117645578ENST00000368508-3243197_28518522348DomainFibronectin type-III 2
TgeneROS1chr6:159191796chr6:117645578ENST00000368508-3243557_67118522348DomainFibronectin type-III 3
TgeneROS1chr6:159191796chr6:117645578ENST00000368508-3243947_104218522348DomainFibronectin type-III 4
TgeneROS1chr6:159191796chr6:117645578ENST00000368508-324328_185918522348Topological domainExtracellular


Top

FusionGeneSequence for EZR_ROS1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_EZR_ENST00000337147_chr6_159191796_-_ROS1_ENST00000368508_chr6_117645578_-_859aa
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHTVDNKGFPTWLKLDKKVSAQEVRKENPLQFKFRAKFYPEDVA
EELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHR
GMLKDNAMLEYLKIAQDLEMTGINTFEIKNKKGTDLWLGVDALGLNITEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFT
APRLRINKRILQLCMGNHELTMRRRKPDTIEVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEELMLRLQDTEEKTKK
AERDDFWIPETSFILTIIVGIFLVVTIPLTFVWHRRLKNQKSAKEGVTVLINEDKELAELRGLAAGVGLANACTAIHTLPTQEEIENLPA
FPREKLTLRLLLGSGAFGEVTEGTAVDILGVGSGEIKVAVKTLKKGSTDQEKIEFLKEAHLMSKFNHPNILKQLGVCLLNEPQYIILELM
EGGDLLTTLRKARMATFTGPLLTLVDLVDLCVDISKGCVYLERMHFIHRDLAARNCLVSVKDTTSPRIVKIGDFGLARDITKNDYTRKRG
EGLLPVRWMAPESLMDGIFTTQSDVWSFGILIWEILTLGHQPTPAHSNLDVLNTVQTGGRLEPPRNCPDDLWNLMTQCWAQEPDQRPTFH
RIQDQLQLFRNFFLNSITKSRDEANNSGVINESFEGEDGDVICLNSDDIMPVALMETKNREGLNTMVLATECGQGEEKSEGPLGSQESES

>In-frame_EZR_ENST00000337147_chr6_159191796_-_ROS1_ENST00000368507_chr6_117645578_-_859aa
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHTVDNKGFPTWLKLDKKVSAQEVRKENPLQFKFRAKFYPEDVA
EELIQDITQKLFFLQVKEGILSDEIYCPPETAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHR
GMLKDNAMLEYLKIAQDLEMTGINTFEIKNKKGTDLWLGVDALGLNITEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFT
APRLRINKRILQLCMGNHELTMRRRKPDTIEVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEELMLRLQDTEEKTKK
AERDDFWIPETSFILTIIVGIFLVVTIPLTFVWHRRLKNQKSAKEGVTVLINEDKELAELRGLAAGVGLANACTAIHTLPTQEEIENLPA
FPREKLTLRLLLGSGAFGEVTEGTAVDILGVGSGEIKVAVKTLKKGSTDQEKIEFLKEAHLMSKFNHPNILKQLGVCLLNEPQYIILELM
EGGDLLTTLRKARMATFTGPLLTLVDLVDLCVDISKGCVYLERMHFIHRDLAARNCLVSVKDTTSPRIVKIGDFGLARDITKNDYTRKRG
EGLLPVRWMAPESLMDGIFTTQSDVWSFGILIWEILTLGHQPTPAHSNLDVLNTVQTGGRLEPPRNCPDDLWNLMTQCWAQEPDQRPTFH
RIQDQLQLFRNFFLNSITKSRDEANNSGVINESFEGEDGDVICLNSDDIMPVALMETKNREGLNTMVLATECGQGEEKSEGPLGSQESES

>In-frame_EZR_ENST00000392177_chr6_159191796_-_ROS1_ENST00000368508_chr6_117645578_-_827aa
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETA
VLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMTGINTFEIKNKK
GTDLWLGVDALGLNITEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFTAPRLRINKRILQLCMGNHELTMRRRKPDTIEV
QQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEELMLRLQDTEEKTKKAERDDFWIPETSFILTIIVGIFLVVTIPLTFV
WHRRLKNQKSAKEGVTVLINEDKELAELRGLAAGVGLANACTAIHTLPTQEEIENLPAFPREKLTLRLLLGSGAFGEVTEGTAVDILGVG
SGEIKVAVKTLKKGSTDQEKIEFLKEAHLMSKFNHPNILKQLGVCLLNEPQYIILELMEGGDLLTTLRKARMATFTGPLLTLVDLVDLCV
DISKGCVYLERMHFIHRDLAARNCLVSVKDTTSPRIVKIGDFGLARDITKNDYTRKRGEGLLPVRWMAPESLMDGIFTTQSDVWSFGILI
WEILTLGHQPTPAHSNLDVLNTVQTGGRLEPPRNCPDDLWNLMTQCWAQEPDQRPTFHRIQDQLQLFRNFFLNSITKSRDEANNSGVINE
SFEGEDGDVICLNSDDIMPVALMETKNREGLNTMVLATECGQGEEKSEGPLGSQESESCGLRKEEKEPHADKDFCQEKQVAYCPSGKPEG

>In-frame_EZR_ENST00000392177_chr6_159191796_-_ROS1_ENST00000368507_chr6_117645578_-_827aa
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPETA
VLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHRGMLKDNAMLEYLKIAQDLEMTGINTFEIKNKK
GTDLWLGVDALGLNITEKDDKLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFTAPRLRINKRILQLCMGNHELTMRRRKPDTIEV
QQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEELMLRLQDTEEKTKKAERDDFWIPETSFILTIIVGIFLVVTIPLTFV
WHRRLKNQKSAKEGVTVLINEDKELAELRGLAAGVGLANACTAIHTLPTQEEIENLPAFPREKLTLRLLLGSGAFGEVTEGTAVDILGVG
SGEIKVAVKTLKKGSTDQEKIEFLKEAHLMSKFNHPNILKQLGVCLLNEPQYIILELMEGGDLLTTLRKARMATFTGPLLTLVDLVDLCV
DISKGCVYLERMHFIHRDLAARNCLVSVKDTTSPRIVKIGDFGLARDITKNDYTRKRGEGLLPVRWMAPESLMDGIFTTQSDVWSFGILI
WEILTLGHQPTPAHSNLDVLNTVQTGGRLEPPRNCPDDLWNLMTQCWAQEPDQRPTFHRIQDQLQLFRNFFLNSITKSRDEANNSGVINE
SFEGEDGDVICLNSDDIMPVALMETKNREGLNTMVLATECGQGEEKSEGPLGSQESESCGLRKEEKEPHADKDFCQEKQVAYCPSGKPEG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_EZR_ENST00000337147_chr6_159191796_-_ROS1_ENST00000368508_chr6_117645578_-_2577nt
ATGCCGAAACCAATCAATGTCCGAGTTACCACCATGGATGCAGAGCTGGAGTTTGCAATCCAGCCAAATACAACTGGAAAACAGCTTTTT
GATCAGGTGGTAAAGACTATCGGCCTCCGGGAAGTGTGGTACTTTGGCCTCCACTATGTGGATAATAAAGGATTTCCTACCTGGCTGAAG
CTGGATAAGAAGGTGTCTGCCCAGGAGGTCAGGAAGGAGAATCCCCTCCAGTTCAAGTTCCGGGCCAAGTTCTACCCTGAAGATGTGGCT
GAGGAGCTCATCCAGGACATCACCCAGAAACTTTTCTTCCTCCAAGTGAAGGAAGGAATCCTTAGCGATGAGATCTACTGCCCCCCTGAG
ACTGCCGTGCTCTTGGGGTCCTACGCTGTGCAGGCCAAGTTTGGGGACTACAACAAAGAAGTGCACAAGTCTGGGTACCTCAGCTCTGAG
CGGCTGATCCCTCAAAGAGTGATGGACCAGCACAAACTTACCAGGGACCAGTGGGAGGACCGGATCCAGGTGTGGCATGCGGAACACCGT
GGGATGCTCAAAGATAATGCTATGTTGGAATACCTGAAGATTGCTCAGGACCTGGAAATGTATGGAATCAACTATTTCGAGATAAAAAAC
AAGAAAGGAACAGACCTTTGGCTTGGAGTTGATGCCCTTGGACTGAATATTTATGAGAAAGATGATAAGTTAACCCCAAAGATTGGCTTT
CCTTGGAGTGAAATCAGGAACATCTCTTTCAATGACAAAAAGTTTGTCATTAAACCCATCGACAAGAAGGCACCTGACTTTGTGTTTTAT
GCCCCACGTCTGAGAATCAACAAGCGGATCCTGCAGCTCTGCATGGGCAACCATGAGTTGTATATGCGCCGCAGGAAGCCTGACACCATC
GAGGTGCAGCAGATGAAGGCCCAGGCCCGGGAGGAGAAGCATCAGAAGCAGCTGGAGCGGCAACAGCTGGAAACAGAGAAGAAAAGGAGA
GAAACCGTGGAGAGAGAGAAAGAGCAGATGATGCGCGAGAAGGAGGAGTTGATGCTGCGGCTGCAGGACTATGAGGAGAAGACAAAGAAG
GCAGAGAGAGATGATTTTTGGATACCAGAAACAAGTTTCATACTTACTATTATAGTTGGAATATTTCTGGTTGTTACAATCCCACTGACC
TTTGTCTGGCATAGAAGATTAAAGAATCAAAAAAGTGCCAAGGAAGGGGTGACAGTGCTTATAAACGAAGACAAAGAGTTGGCTGAGCTG
CGAGGTCTGGCAGCCGGAGTAGGCCTGGCTAATGCCTGCTATGCAATACATACTCTTCCAACCCAAGAGGAGATTGAAAATCTTCCTGCC
TTCCCTCGGGAAAAACTGACTCTGCGTCTCTTGCTGGGAAGTGGAGCCTTTGGAGAAGTGTATGAAGGAACAGCAGTGGACATCTTAGGA
GTTGGAAGTGGAGAAATCAAAGTAGCAGTGAAGACTTTGAAGAAGGGTTCCACAGACCAGGAGAAGATTGAATTCCTGAAGGAGGCACAT
CTGATGAGCAAATTTAATCATCCCAACATTCTGAAGCAGCTTGGAGTTTGTCTGCTGAATGAACCCCAATACATTATCCTGGAACTGATG
GAGGGAGGAGACCTTCTTACTTATTTGCGTAAAGCCCGGATGGCAACGTTTTATGGTCCTTTACTCACCTTGGTTGACCTTGTAGACCTG
TGTGTAGATATTTCAAAAGGCTGTGTCTACTTGGAACGGATGCATTTCATTCACAGGGATCTGGCAGCTAGAAATTGCCTTGTTTCCGTG
AAAGACTATACCAGTCCACGGATAGTGAAGATTGGAGACTTTGGACTCGCCAGAGACATCTATAAAAATGATTACTATAGAAAGAGAGGG
GAAGGCCTGCTCCCAGTTCGGTGGATGGCTCCAGAAAGTTTGATGGATGGAATCTTCACTACTCAATCTGATGTATGGTCTTTTGGAATT
CTGATTTGGGAGATTTTAACTCTTGGTCATCAGCCTTATCCAGCTCATTCCAACCTTGATGTGTTAAACTATGTGCAAACAGGAGGGAGA
CTGGAGCCACCAAGAAATTGTCCTGATGATCTGTGGAATTTAATGACCCAGTGCTGGGCTCAAGAACCCGACCAAAGACCTACTTTTCAT
AGAATTCAGGACCAACTTCAGTTATTCAGAAATTTTTTCTTAAATAGCATTTATAAGTCCAGAGATGAAGCAAACAACAGTGGAGTCATA
AATGAAAGCTTTGAAGGTGAAGATGGCGATGTGATTTGTTTGAATTCAGATGACATTATGCCAGTTGCTTTAATGGAAACGAAGAACCGA
GAAGGGTTAAACTATATGGTACTTGCTACAGAATGTGGCCAAGGTGAAGAAAAGTCTGAGGGTCCTCTAGGCTCCCAGGAATCTGAATCT
TGTGGTCTGAGGAAAGAAGAGAAGGAACCACATGCAGACAAAGATTTCTGCCAAGAAAAACAAGTGGCTTACTGCCCTTCTGGCAAGCCT

>In-frame_EZR_ENST00000337147_chr6_159191796_-_ROS1_ENST00000368507_chr6_117645578_-_2577nt
ATGCCGAAACCAATCAATGTCCGAGTTACCACCATGGATGCAGAGCTGGAGTTTGCAATCCAGCCAAATACAACTGGAAAACAGCTTTTT
GATCAGGTGGTAAAGACTATCGGCCTCCGGGAAGTGTGGTACTTTGGCCTCCACTATGTGGATAATAAAGGATTTCCTACCTGGCTGAAG
CTGGATAAGAAGGTGTCTGCCCAGGAGGTCAGGAAGGAGAATCCCCTCCAGTTCAAGTTCCGGGCCAAGTTCTACCCTGAAGATGTGGCT
GAGGAGCTCATCCAGGACATCACCCAGAAACTTTTCTTCCTCCAAGTGAAGGAAGGAATCCTTAGCGATGAGATCTACTGCCCCCCTGAG
ACTGCCGTGCTCTTGGGGTCCTACGCTGTGCAGGCCAAGTTTGGGGACTACAACAAAGAAGTGCACAAGTCTGGGTACCTCAGCTCTGAG
CGGCTGATCCCTCAAAGAGTGATGGACCAGCACAAACTTACCAGGGACCAGTGGGAGGACCGGATCCAGGTGTGGCATGCGGAACACCGT
GGGATGCTCAAAGATAATGCTATGTTGGAATACCTGAAGATTGCTCAGGACCTGGAAATGTATGGAATCAACTATTTCGAGATAAAAAAC
AAGAAAGGAACAGACCTTTGGCTTGGAGTTGATGCCCTTGGACTGAATATTTATGAGAAAGATGATAAGTTAACCCCAAAGATTGGCTTT
CCTTGGAGTGAAATCAGGAACATCTCTTTCAATGACAAAAAGTTTGTCATTAAACCCATCGACAAGAAGGCACCTGACTTTGTGTTTTAT
GCCCCACGTCTGAGAATCAACAAGCGGATCCTGCAGCTCTGCATGGGCAACCATGAGTTGTATATGCGCCGCAGGAAGCCTGACACCATC
GAGGTGCAGCAGATGAAGGCCCAGGCCCGGGAGGAGAAGCATCAGAAGCAGCTGGAGCGGCAACAGCTGGAAACAGAGAAGAAAAGGAGA
GAAACCGTGGAGAGAGAGAAAGAGCAGATGATGCGCGAGAAGGAGGAGTTGATGCTGCGGCTGCAGGACTATGAGGAGAAGACAAAGAAG
GCAGAGAGAGATGATTTTTGGATACCAGAAACAAGTTTCATACTTACTATTATAGTTGGAATATTTCTGGTTGTTACAATCCCACTGACC
TTTGTCTGGCATAGAAGATTAAAGAATCAAAAAAGTGCCAAGGAAGGGGTGACAGTGCTTATAAACGAAGACAAAGAGTTGGCTGAGCTG
CGAGGTCTGGCAGCCGGAGTAGGCCTGGCTAATGCCTGCTATGCAATACATACTCTTCCAACCCAAGAGGAGATTGAAAATCTTCCTGCC
TTCCCTCGGGAAAAACTGACTCTGCGTCTCTTGCTGGGAAGTGGAGCCTTTGGAGAAGTGTATGAAGGAACAGCAGTGGACATCTTAGGA
GTTGGAAGTGGAGAAATCAAAGTAGCAGTGAAGACTTTGAAGAAGGGTTCCACAGACCAGGAGAAGATTGAATTCCTGAAGGAGGCACAT
CTGATGAGCAAATTTAATCATCCCAACATTCTGAAGCAGCTTGGAGTTTGTCTGCTGAATGAACCCCAATACATTATCCTGGAACTGATG
GAGGGAGGAGACCTTCTTACTTATTTGCGTAAAGCCCGGATGGCAACGTTTTATGGTCCTTTACTCACCTTGGTTGACCTTGTAGACCTG
TGTGTAGATATTTCAAAAGGCTGTGTCTACTTGGAACGGATGCATTTCATTCACAGGGATCTGGCAGCTAGAAATTGCCTTGTTTCCGTG
AAAGACTATACCAGTCCACGGATAGTGAAGATTGGAGACTTTGGACTCGCCAGAGACATCTATAAAAATGATTACTATAGAAAGAGAGGG
GAAGGCCTGCTCCCAGTTCGGTGGATGGCTCCAGAAAGTTTGATGGATGGAATCTTCACTACTCAATCTGATGTATGGTCTTTTGGAATT
CTGATTTGGGAGATTTTAACTCTTGGTCATCAGCCTTATCCAGCTCATTCCAACCTTGATGTGTTAAACTATGTGCAAACAGGAGGGAGA
CTGGAGCCACCAAGAAATTGTCCTGATGATCTGTGGAATTTAATGACCCAGTGCTGGGCTCAAGAACCCGACCAAAGACCTACTTTTCAT
AGAATTCAGGACCAACTTCAGTTATTCAGAAATTTTTTCTTAAATAGCATTTATAAGTCCAGAGATGAAGCAAACAACAGTGGAGTCATA
AATGAAAGCTTTGAAGGTGAAGATGGCGATGTGATTTGTTTGAATTCAGATGACATTATGCCAGTTGCTTTAATGGAAACGAAGAACCGA
GAAGGGTTAAACTATATGGTACTTGCTACAGAATGTGGCCAAGGTGAAGAAAAGTCTGAGGGTCCTCTAGGCTCCCAGGAATCTGAATCT
TGTGGTCTGAGGAAAGAAGAGAAGGAACCACATGCAGACAAAGATTTCTGCCAAGAAAAACAAGTGGCTTACTGCCCTTCTGGCAAGCCT

>In-frame_EZR_ENST00000392177_chr6_159191796_-_ROS1_ENST00000368508_chr6_117645578_-_2481nt
ATGCCGAAACCAATCAATGTCCGAGTTACCACCATGGATGCAGAGCTGGAGTTTGCAATCCAGCCAAATACAACTGGAAAACAGCTTTTT
GATCAGGTGTCTGCCCAGGAGGTCAGGAAGGAGAATCCCCTCCAGTTCAAGTTCCGGGCCAAGTTCTACCCTGAAGATGTGGCTGAGGAG
CTCATCCAGGACATCACCCAGAAACTTTTCTTCCTCCAAGTGAAGGAAGGAATCCTTAGCGATGAGATCTACTGCCCCCCTGAGACTGCC
GTGCTCTTGGGGTCCTACGCTGTGCAGGCCAAGTTTGGGGACTACAACAAAGAAGTGCACAAGTCTGGGTACCTCAGCTCTGAGCGGCTG
ATCCCTCAAAGAGTGATGGACCAGCACAAACTTACCAGGGACCAGTGGGAGGACCGGATCCAGGTGTGGCATGCGGAACACCGTGGGATG
CTCAAAGATAATGCTATGTTGGAATACCTGAAGATTGCTCAGGACCTGGAAATGTATGGAATCAACTATTTCGAGATAAAAAACAAGAAA
GGAACAGACCTTTGGCTTGGAGTTGATGCCCTTGGACTGAATATTTATGAGAAAGATGATAAGTTAACCCCAAAGATTGGCTTTCCTTGG
AGTGAAATCAGGAACATCTCTTTCAATGACAAAAAGTTTGTCATTAAACCCATCGACAAGAAGGCACCTGACTTTGTGTTTTATGCCCCA
CGTCTGAGAATCAACAAGCGGATCCTGCAGCTCTGCATGGGCAACCATGAGTTGTATATGCGCCGCAGGAAGCCTGACACCATCGAGGTG
CAGCAGATGAAGGCCCAGGCCCGGGAGGAGAAGCATCAGAAGCAGCTGGAGCGGCAACAGCTGGAAACAGAGAAGAAAAGGAGAGAAACC
GTGGAGAGAGAGAAAGAGCAGATGATGCGCGAGAAGGAGGAGTTGATGCTGCGGCTGCAGGACTATGAGGAGAAGACAAAGAAGGCAGAG
AGAGATGATTTTTGGATACCAGAAACAAGTTTCATACTTACTATTATAGTTGGAATATTTCTGGTTGTTACAATCCCACTGACCTTTGTC
TGGCATAGAAGATTAAAGAATCAAAAAAGTGCCAAGGAAGGGGTGACAGTGCTTATAAACGAAGACAAAGAGTTGGCTGAGCTGCGAGGT
CTGGCAGCCGGAGTAGGCCTGGCTAATGCCTGCTATGCAATACATACTCTTCCAACCCAAGAGGAGATTGAAAATCTTCCTGCCTTCCCT
CGGGAAAAACTGACTCTGCGTCTCTTGCTGGGAAGTGGAGCCTTTGGAGAAGTGTATGAAGGAACAGCAGTGGACATCTTAGGAGTTGGA
AGTGGAGAAATCAAAGTAGCAGTGAAGACTTTGAAGAAGGGTTCCACAGACCAGGAGAAGATTGAATTCCTGAAGGAGGCACATCTGATG
AGCAAATTTAATCATCCCAACATTCTGAAGCAGCTTGGAGTTTGTCTGCTGAATGAACCCCAATACATTATCCTGGAACTGATGGAGGGA
GGAGACCTTCTTACTTATTTGCGTAAAGCCCGGATGGCAACGTTTTATGGTCCTTTACTCACCTTGGTTGACCTTGTAGACCTGTGTGTA
GATATTTCAAAAGGCTGTGTCTACTTGGAACGGATGCATTTCATTCACAGGGATCTGGCAGCTAGAAATTGCCTTGTTTCCGTGAAAGAC
TATACCAGTCCACGGATAGTGAAGATTGGAGACTTTGGACTCGCCAGAGACATCTATAAAAATGATTACTATAGAAAGAGAGGGGAAGGC
CTGCTCCCAGTTCGGTGGATGGCTCCAGAAAGTTTGATGGATGGAATCTTCACTACTCAATCTGATGTATGGTCTTTTGGAATTCTGATT
TGGGAGATTTTAACTCTTGGTCATCAGCCTTATCCAGCTCATTCCAACCTTGATGTGTTAAACTATGTGCAAACAGGAGGGAGACTGGAG
CCACCAAGAAATTGTCCTGATGATCTGTGGAATTTAATGACCCAGTGCTGGGCTCAAGAACCCGACCAAAGACCTACTTTTCATAGAATT
CAGGACCAACTTCAGTTATTCAGAAATTTTTTCTTAAATAGCATTTATAAGTCCAGAGATGAAGCAAACAACAGTGGAGTCATAAATGAA
AGCTTTGAAGGTGAAGATGGCGATGTGATTTGTTTGAATTCAGATGACATTATGCCAGTTGCTTTAATGGAAACGAAGAACCGAGAAGGG
TTAAACTATATGGTACTTGCTACAGAATGTGGCCAAGGTGAAGAAAAGTCTGAGGGTCCTCTAGGCTCCCAGGAATCTGAATCTTGTGGT
CTGAGGAAAGAAGAGAAGGAACCACATGCAGACAAAGATTTCTGCCAAGAAAAACAAGTGGCTTACTGCCCTTCTGGCAAGCCTGAAGGC

>In-frame_EZR_ENST00000392177_chr6_159191796_-_ROS1_ENST00000368507_chr6_117645578_-_2481nt
ATGCCGAAACCAATCAATGTCCGAGTTACCACCATGGATGCAGAGCTGGAGTTTGCAATCCAGCCAAATACAACTGGAAAACAGCTTTTT
GATCAGGTGTCTGCCCAGGAGGTCAGGAAGGAGAATCCCCTCCAGTTCAAGTTCCGGGCCAAGTTCTACCCTGAAGATGTGGCTGAGGAG
CTCATCCAGGACATCACCCAGAAACTTTTCTTCCTCCAAGTGAAGGAAGGAATCCTTAGCGATGAGATCTACTGCCCCCCTGAGACTGCC
GTGCTCTTGGGGTCCTACGCTGTGCAGGCCAAGTTTGGGGACTACAACAAAGAAGTGCACAAGTCTGGGTACCTCAGCTCTGAGCGGCTG
ATCCCTCAAAGAGTGATGGACCAGCACAAACTTACCAGGGACCAGTGGGAGGACCGGATCCAGGTGTGGCATGCGGAACACCGTGGGATG
CTCAAAGATAATGCTATGTTGGAATACCTGAAGATTGCTCAGGACCTGGAAATGTATGGAATCAACTATTTCGAGATAAAAAACAAGAAA
GGAACAGACCTTTGGCTTGGAGTTGATGCCCTTGGACTGAATATTTATGAGAAAGATGATAAGTTAACCCCAAAGATTGGCTTTCCTTGG
AGTGAAATCAGGAACATCTCTTTCAATGACAAAAAGTTTGTCATTAAACCCATCGACAAGAAGGCACCTGACTTTGTGTTTTATGCCCCA
CGTCTGAGAATCAACAAGCGGATCCTGCAGCTCTGCATGGGCAACCATGAGTTGTATATGCGCCGCAGGAAGCCTGACACCATCGAGGTG
CAGCAGATGAAGGCCCAGGCCCGGGAGGAGAAGCATCAGAAGCAGCTGGAGCGGCAACAGCTGGAAACAGAGAAGAAAAGGAGAGAAACC
GTGGAGAGAGAGAAAGAGCAGATGATGCGCGAGAAGGAGGAGTTGATGCTGCGGCTGCAGGACTATGAGGAGAAGACAAAGAAGGCAGAG
AGAGATGATTTTTGGATACCAGAAACAAGTTTCATACTTACTATTATAGTTGGAATATTTCTGGTTGTTACAATCCCACTGACCTTTGTC
TGGCATAGAAGATTAAAGAATCAAAAAAGTGCCAAGGAAGGGGTGACAGTGCTTATAAACGAAGACAAAGAGTTGGCTGAGCTGCGAGGT
CTGGCAGCCGGAGTAGGCCTGGCTAATGCCTGCTATGCAATACATACTCTTCCAACCCAAGAGGAGATTGAAAATCTTCCTGCCTTCCCT
CGGGAAAAACTGACTCTGCGTCTCTTGCTGGGAAGTGGAGCCTTTGGAGAAGTGTATGAAGGAACAGCAGTGGACATCTTAGGAGTTGGA
AGTGGAGAAATCAAAGTAGCAGTGAAGACTTTGAAGAAGGGTTCCACAGACCAGGAGAAGATTGAATTCCTGAAGGAGGCACATCTGATG
AGCAAATTTAATCATCCCAACATTCTGAAGCAGCTTGGAGTTTGTCTGCTGAATGAACCCCAATACATTATCCTGGAACTGATGGAGGGA
GGAGACCTTCTTACTTATTTGCGTAAAGCCCGGATGGCAACGTTTTATGGTCCTTTACTCACCTTGGTTGACCTTGTAGACCTGTGTGTA
GATATTTCAAAAGGCTGTGTCTACTTGGAACGGATGCATTTCATTCACAGGGATCTGGCAGCTAGAAATTGCCTTGTTTCCGTGAAAGAC
TATACCAGTCCACGGATAGTGAAGATTGGAGACTTTGGACTCGCCAGAGACATCTATAAAAATGATTACTATAGAAAGAGAGGGGAAGGC
CTGCTCCCAGTTCGGTGGATGGCTCCAGAAAGTTTGATGGATGGAATCTTCACTACTCAATCTGATGTATGGTCTTTTGGAATTCTGATT
TGGGAGATTTTAACTCTTGGTCATCAGCCTTATCCAGCTCATTCCAACCTTGATGTGTTAAACTATGTGCAAACAGGAGGGAGACTGGAG
CCACCAAGAAATTGTCCTGATGATCTGTGGAATTTAATGACCCAGTGCTGGGCTCAAGAACCCGACCAAAGACCTACTTTTCATAGAATT
CAGGACCAACTTCAGTTATTCAGAAATTTTTTCTTAAATAGCATTTATAAGTCCAGAGATGAAGCAAACAACAGTGGAGTCATAAATGAA
AGCTTTGAAGGTGAAGATGGCGATGTGATTTGTTTGAATTCAGATGACATTATGCCAGTTGCTTTAATGGAAACGAAGAACCGAGAAGGG
TTAAACTATATGGTACTTGCTACAGAATGTGGCCAAGGTGAAGAAAAGTCTGAGGGTCCTCTAGGCTCCCAGGAATCTGAATCTTGTGGT
CTGAGGAAAGAAGAGAAGGAACCACATGCAGACAAAGATTTCTGCCAAGAAAAACAAGTGGCTTACTGCCCTTCTGGCAAGCCTGAAGGC


* Fusion transcript sequences (Full-length transcript).
>In-frame_EZR_ENST00000337147_chr6_159191796_-_ROS1_ENST00000368508_chr6_117645578_-_2903nt
GGCGCGGCAGGAGGACGAGGCAGGGCGGGCGGGCGCTCTAAGGGTTCTGCTCTGACTCCAGGTTGGGACAGCGTCTTCGCTGCTGCTGGA
TAGTCGTGTTTTCGGGGATCGAGGATACTCACCAGAAACCGAAAATGCCGAAACCAATCAATGTCCGAGTTACCACCATGGATGCAGAGC
TGGAGTTTGCAATCCAGCCAAATACAACTGGAAAACAGCTTTTTGATCAGGTGGTAAAGACTATCGGCCTCCGGGAAGTGTGGTACTTTG
GCCTCCACTATGTGGATAATAAAGGATTTCCTACCTGGCTGAAGCTGGATAAGAAGGTGTCTGCCCAGGAGGTCAGGAAGGAGAATCCCC
TCCAGTTCAAGTTCCGGGCCAAGTTCTACCCTGAAGATGTGGCTGAGGAGCTCATCCAGGACATCACCCAGAAACTTTTCTTCCTCCAAG
TGAAGGAAGGAATCCTTAGCGATGAGATCTACTGCCCCCCTGAGACTGCCGTGCTCTTGGGGTCCTACGCTGTGCAGGCCAAGTTTGGGG
ACTACAACAAAGAAGTGCACAAGTCTGGGTACCTCAGCTCTGAGCGGCTGATCCCTCAAAGAGTGATGGACCAGCACAAACTTACCAGGG
ACCAGTGGGAGGACCGGATCCAGGTGTGGCATGCGGAACACCGTGGGATGCTCAAAGATAATGCTATGTTGGAATACCTGAAGATTGCTC
AGGACCTGGAAATGTATGGAATCAACTATTTCGAGATAAAAAACAAGAAAGGAACAGACCTTTGGCTTGGAGTTGATGCCCTTGGACTGA
ATATTTATGAGAAAGATGATAAGTTAACCCCAAAGATTGGCTTTCCTTGGAGTGAAATCAGGAACATCTCTTTCAATGACAAAAAGTTTG
TCATTAAACCCATCGACAAGAAGGCACCTGACTTTGTGTTTTATGCCCCACGTCTGAGAATCAACAAGCGGATCCTGCAGCTCTGCATGG
GCAACCATGAGTTGTATATGCGCCGCAGGAAGCCTGACACCATCGAGGTGCAGCAGATGAAGGCCCAGGCCCGGGAGGAGAAGCATCAGA
AGCAGCTGGAGCGGCAACAGCTGGAAACAGAGAAGAAAAGGAGAGAAACCGTGGAGAGAGAGAAAGAGCAGATGATGCGCGAGAAGGAGG
AGTTGATGCTGCGGCTGCAGGACTATGAGGAGAAGACAAAGAAGGCAGAGAGAGATGATTTTTGGATACCAGAAACAAGTTTCATACTTA
CTATTATAGTTGGAATATTTCTGGTTGTTACAATCCCACTGACCTTTGTCTGGCATAGAAGATTAAAGAATCAAAAAAGTGCCAAGGAAG
GGGTGACAGTGCTTATAAACGAAGACAAAGAGTTGGCTGAGCTGCGAGGTCTGGCAGCCGGAGTAGGCCTGGCTAATGCCTGCTATGCAA
TACATACTCTTCCAACCCAAGAGGAGATTGAAAATCTTCCTGCCTTCCCTCGGGAAAAACTGACTCTGCGTCTCTTGCTGGGAAGTGGAG
CCTTTGGAGAAGTGTATGAAGGAACAGCAGTGGACATCTTAGGAGTTGGAAGTGGAGAAATCAAAGTAGCAGTGAAGACTTTGAAGAAGG
GTTCCACAGACCAGGAGAAGATTGAATTCCTGAAGGAGGCACATCTGATGAGCAAATTTAATCATCCCAACATTCTGAAGCAGCTTGGAG
TTTGTCTGCTGAATGAACCCCAATACATTATCCTGGAACTGATGGAGGGAGGAGACCTTCTTACTTATTTGCGTAAAGCCCGGATGGCAA
CGTTTTATGGTCCTTTACTCACCTTGGTTGACCTTGTAGACCTGTGTGTAGATATTTCAAAAGGCTGTGTCTACTTGGAACGGATGCATT
TCATTCACAGGGATCTGGCAGCTAGAAATTGCCTTGTTTCCGTGAAAGACTATACCAGTCCACGGATAGTGAAGATTGGAGACTTTGGAC
TCGCCAGAGACATCTATAAAAATGATTACTATAGAAAGAGAGGGGAAGGCCTGCTCCCAGTTCGGTGGATGGCTCCAGAAAGTTTGATGG
ATGGAATCTTCACTACTCAATCTGATGTATGGTCTTTTGGAATTCTGATTTGGGAGATTTTAACTCTTGGTCATCAGCCTTATCCAGCTC
ATTCCAACCTTGATGTGTTAAACTATGTGCAAACAGGAGGGAGACTGGAGCCACCAAGAAATTGTCCTGATGATCTGTGGAATTTAATGA
CCCAGTGCTGGGCTCAAGAACCCGACCAAAGACCTACTTTTCATAGAATTCAGGACCAACTTCAGTTATTCAGAAATTTTTTCTTAAATA
GCATTTATAAGTCCAGAGATGAAGCAAACAACAGTGGAGTCATAAATGAAAGCTTTGAAGGTGAAGATGGCGATGTGATTTGTTTGAATT
CAGATGACATTATGCCAGTTGCTTTAATGGAAACGAAGAACCGAGAAGGGTTAAACTATATGGTACTTGCTACAGAATGTGGCCAAGGTG
AAGAAAAGTCTGAGGGTCCTCTAGGCTCCCAGGAATCTGAATCTTGTGGTCTGAGGAAAGAAGAGAAGGAACCACATGCAGACAAAGATT
TCTGCCAAGAAAAACAAGTGGCTTACTGCCCTTCTGGCAAGCCTGAAGGCCTGAACTATGCCTGTCTCACTCACAGTGGATATGGAGATG
GGTCTGATTAATAGCGTTGTTTGGGAAATAGAGAGTTGAGATAAACACTCTCATTCAGTAGTTACTGAAAGAAAACTCTGCTAGAATGAT
AAATGTCATGGTGGTCTATAACTCCAAATAAACAATGCAACGTTCCTGATTTCTAATCTTGGTTCTGAGAGCCATTTGGTTTCAGTTGTA

>In-frame_EZR_ENST00000337147_chr6_159191796_-_ROS1_ENST00000368507_chr6_117645578_-_2903nt
GGCGCGGCAGGAGGACGAGGCAGGGCGGGCGGGCGCTCTAAGGGTTCTGCTCTGACTCCAGGTTGGGACAGCGTCTTCGCTGCTGCTGGA
TAGTCGTGTTTTCGGGGATCGAGGATACTCACCAGAAACCGAAAATGCCGAAACCAATCAATGTCCGAGTTACCACCATGGATGCAGAGC
TGGAGTTTGCAATCCAGCCAAATACAACTGGAAAACAGCTTTTTGATCAGGTGGTAAAGACTATCGGCCTCCGGGAAGTGTGGTACTTTG
GCCTCCACTATGTGGATAATAAAGGATTTCCTACCTGGCTGAAGCTGGATAAGAAGGTGTCTGCCCAGGAGGTCAGGAAGGAGAATCCCC
TCCAGTTCAAGTTCCGGGCCAAGTTCTACCCTGAAGATGTGGCTGAGGAGCTCATCCAGGACATCACCCAGAAACTTTTCTTCCTCCAAG
TGAAGGAAGGAATCCTTAGCGATGAGATCTACTGCCCCCCTGAGACTGCCGTGCTCTTGGGGTCCTACGCTGTGCAGGCCAAGTTTGGGG
ACTACAACAAAGAAGTGCACAAGTCTGGGTACCTCAGCTCTGAGCGGCTGATCCCTCAAAGAGTGATGGACCAGCACAAACTTACCAGGG
ACCAGTGGGAGGACCGGATCCAGGTGTGGCATGCGGAACACCGTGGGATGCTCAAAGATAATGCTATGTTGGAATACCTGAAGATTGCTC
AGGACCTGGAAATGTATGGAATCAACTATTTCGAGATAAAAAACAAGAAAGGAACAGACCTTTGGCTTGGAGTTGATGCCCTTGGACTGA
ATATTTATGAGAAAGATGATAAGTTAACCCCAAAGATTGGCTTTCCTTGGAGTGAAATCAGGAACATCTCTTTCAATGACAAAAAGTTTG
TCATTAAACCCATCGACAAGAAGGCACCTGACTTTGTGTTTTATGCCCCACGTCTGAGAATCAACAAGCGGATCCTGCAGCTCTGCATGG
GCAACCATGAGTTGTATATGCGCCGCAGGAAGCCTGACACCATCGAGGTGCAGCAGATGAAGGCCCAGGCCCGGGAGGAGAAGCATCAGA
AGCAGCTGGAGCGGCAACAGCTGGAAACAGAGAAGAAAAGGAGAGAAACCGTGGAGAGAGAGAAAGAGCAGATGATGCGCGAGAAGGAGG
AGTTGATGCTGCGGCTGCAGGACTATGAGGAGAAGACAAAGAAGGCAGAGAGAGATGATTTTTGGATACCAGAAACAAGTTTCATACTTA
CTATTATAGTTGGAATATTTCTGGTTGTTACAATCCCACTGACCTTTGTCTGGCATAGAAGATTAAAGAATCAAAAAAGTGCCAAGGAAG
GGGTGACAGTGCTTATAAACGAAGACAAAGAGTTGGCTGAGCTGCGAGGTCTGGCAGCCGGAGTAGGCCTGGCTAATGCCTGCTATGCAA
TACATACTCTTCCAACCCAAGAGGAGATTGAAAATCTTCCTGCCTTCCCTCGGGAAAAACTGACTCTGCGTCTCTTGCTGGGAAGTGGAG
CCTTTGGAGAAGTGTATGAAGGAACAGCAGTGGACATCTTAGGAGTTGGAAGTGGAGAAATCAAAGTAGCAGTGAAGACTTTGAAGAAGG
GTTCCACAGACCAGGAGAAGATTGAATTCCTGAAGGAGGCACATCTGATGAGCAAATTTAATCATCCCAACATTCTGAAGCAGCTTGGAG
TTTGTCTGCTGAATGAACCCCAATACATTATCCTGGAACTGATGGAGGGAGGAGACCTTCTTACTTATTTGCGTAAAGCCCGGATGGCAA
CGTTTTATGGTCCTTTACTCACCTTGGTTGACCTTGTAGACCTGTGTGTAGATATTTCAAAAGGCTGTGTCTACTTGGAACGGATGCATT
TCATTCACAGGGATCTGGCAGCTAGAAATTGCCTTGTTTCCGTGAAAGACTATACCAGTCCACGGATAGTGAAGATTGGAGACTTTGGAC
TCGCCAGAGACATCTATAAAAATGATTACTATAGAAAGAGAGGGGAAGGCCTGCTCCCAGTTCGGTGGATGGCTCCAGAAAGTTTGATGG
ATGGAATCTTCACTACTCAATCTGATGTATGGTCTTTTGGAATTCTGATTTGGGAGATTTTAACTCTTGGTCATCAGCCTTATCCAGCTC
ATTCCAACCTTGATGTGTTAAACTATGTGCAAACAGGAGGGAGACTGGAGCCACCAAGAAATTGTCCTGATGATCTGTGGAATTTAATGA
CCCAGTGCTGGGCTCAAGAACCCGACCAAAGACCTACTTTTCATAGAATTCAGGACCAACTTCAGTTATTCAGAAATTTTTTCTTAAATA
GCATTTATAAGTCCAGAGATGAAGCAAACAACAGTGGAGTCATAAATGAAAGCTTTGAAGGTGAAGATGGCGATGTGATTTGTTTGAATT
CAGATGACATTATGCCAGTTGCTTTAATGGAAACGAAGAACCGAGAAGGGTTAAACTATATGGTACTTGCTACAGAATGTGGCCAAGGTG
AAGAAAAGTCTGAGGGTCCTCTAGGCTCCCAGGAATCTGAATCTTGTGGTCTGAGGAAAGAAGAGAAGGAACCACATGCAGACAAAGATT
TCTGCCAAGAAAAACAAGTGGCTTACTGCCCTTCTGGCAAGCCTGAAGGCCTGAACTATGCCTGTCTCACTCACAGTGGATATGGAGATG
GGTCTGATTAATAGCGTTGTTTGGGAAATAGAGAGTTGAGATAAACACTCTCATTCAGTAGTTACTGAAAGAAAACTCTGCTAGAATGAT
AAATGTCATGGTGGTCTATAACTCCAAATAAACAATGCAACGTTCCTGATTTCTAATCTTGGTTCTGAGAGCCATTTGGTTTCAGTTGTA

>In-frame_EZR_ENST00000392177_chr6_159191796_-_ROS1_ENST00000368508_chr6_117645578_-_2813nt
GTGTCGGGCGCGGCAGGAGGACGAGGCAGGGCGGGCGGGCGCTCTAAGGGTTCTGCTCTGACTCCAGGTTGGGACAGCGTCTTCGCTGCT
GCTGGATAGTCGTGTTTTCGGGGATCGAGGATACTCACCAGAAACCGAAAATGCCGAAACCAATCAATGTCCGAGTTACCACCATGGATG
CAGAGCTGGAGTTTGCAATCCAGCCAAATACAACTGGAAAACAGCTTTTTGATCAGGTGTCTGCCCAGGAGGTCAGGAAGGAGAATCCCC
TCCAGTTCAAGTTCCGGGCCAAGTTCTACCCTGAAGATGTGGCTGAGGAGCTCATCCAGGACATCACCCAGAAACTTTTCTTCCTCCAAG
TGAAGGAAGGAATCCTTAGCGATGAGATCTACTGCCCCCCTGAGACTGCCGTGCTCTTGGGGTCCTACGCTGTGCAGGCCAAGTTTGGGG
ACTACAACAAAGAAGTGCACAAGTCTGGGTACCTCAGCTCTGAGCGGCTGATCCCTCAAAGAGTGATGGACCAGCACAAACTTACCAGGG
ACCAGTGGGAGGACCGGATCCAGGTGTGGCATGCGGAACACCGTGGGATGCTCAAAGATAATGCTATGTTGGAATACCTGAAGATTGCTC
AGGACCTGGAAATGTATGGAATCAACTATTTCGAGATAAAAAACAAGAAAGGAACAGACCTTTGGCTTGGAGTTGATGCCCTTGGACTGA
ATATTTATGAGAAAGATGATAAGTTAACCCCAAAGATTGGCTTTCCTTGGAGTGAAATCAGGAACATCTCTTTCAATGACAAAAAGTTTG
TCATTAAACCCATCGACAAGAAGGCACCTGACTTTGTGTTTTATGCCCCACGTCTGAGAATCAACAAGCGGATCCTGCAGCTCTGCATGG
GCAACCATGAGTTGTATATGCGCCGCAGGAAGCCTGACACCATCGAGGTGCAGCAGATGAAGGCCCAGGCCCGGGAGGAGAAGCATCAGA
AGCAGCTGGAGCGGCAACAGCTGGAAACAGAGAAGAAAAGGAGAGAAACCGTGGAGAGAGAGAAAGAGCAGATGATGCGCGAGAAGGAGG
AGTTGATGCTGCGGCTGCAGGACTATGAGGAGAAGACAAAGAAGGCAGAGAGAGATGATTTTTGGATACCAGAAACAAGTTTCATACTTA
CTATTATAGTTGGAATATTTCTGGTTGTTACAATCCCACTGACCTTTGTCTGGCATAGAAGATTAAAGAATCAAAAAAGTGCCAAGGAAG
GGGTGACAGTGCTTATAAACGAAGACAAAGAGTTGGCTGAGCTGCGAGGTCTGGCAGCCGGAGTAGGCCTGGCTAATGCCTGCTATGCAA
TACATACTCTTCCAACCCAAGAGGAGATTGAAAATCTTCCTGCCTTCCCTCGGGAAAAACTGACTCTGCGTCTCTTGCTGGGAAGTGGAG
CCTTTGGAGAAGTGTATGAAGGAACAGCAGTGGACATCTTAGGAGTTGGAAGTGGAGAAATCAAAGTAGCAGTGAAGACTTTGAAGAAGG
GTTCCACAGACCAGGAGAAGATTGAATTCCTGAAGGAGGCACATCTGATGAGCAAATTTAATCATCCCAACATTCTGAAGCAGCTTGGAG
TTTGTCTGCTGAATGAACCCCAATACATTATCCTGGAACTGATGGAGGGAGGAGACCTTCTTACTTATTTGCGTAAAGCCCGGATGGCAA
CGTTTTATGGTCCTTTACTCACCTTGGTTGACCTTGTAGACCTGTGTGTAGATATTTCAAAAGGCTGTGTCTACTTGGAACGGATGCATT
TCATTCACAGGGATCTGGCAGCTAGAAATTGCCTTGTTTCCGTGAAAGACTATACCAGTCCACGGATAGTGAAGATTGGAGACTTTGGAC
TCGCCAGAGACATCTATAAAAATGATTACTATAGAAAGAGAGGGGAAGGCCTGCTCCCAGTTCGGTGGATGGCTCCAGAAAGTTTGATGG
ATGGAATCTTCACTACTCAATCTGATGTATGGTCTTTTGGAATTCTGATTTGGGAGATTTTAACTCTTGGTCATCAGCCTTATCCAGCTC
ATTCCAACCTTGATGTGTTAAACTATGTGCAAACAGGAGGGAGACTGGAGCCACCAAGAAATTGTCCTGATGATCTGTGGAATTTAATGA
CCCAGTGCTGGGCTCAAGAACCCGACCAAAGACCTACTTTTCATAGAATTCAGGACCAACTTCAGTTATTCAGAAATTTTTTCTTAAATA
GCATTTATAAGTCCAGAGATGAAGCAAACAACAGTGGAGTCATAAATGAAAGCTTTGAAGGTGAAGATGGCGATGTGATTTGTTTGAATT
CAGATGACATTATGCCAGTTGCTTTAATGGAAACGAAGAACCGAGAAGGGTTAAACTATATGGTACTTGCTACAGAATGTGGCCAAGGTG
AAGAAAAGTCTGAGGGTCCTCTAGGCTCCCAGGAATCTGAATCTTGTGGTCTGAGGAAAGAAGAGAAGGAACCACATGCAGACAAAGATT
TCTGCCAAGAAAAACAAGTGGCTTACTGCCCTTCTGGCAAGCCTGAAGGCCTGAACTATGCCTGTCTCACTCACAGTGGATATGGAGATG
GGTCTGATTAATAGCGTTGTTTGGGAAATAGAGAGTTGAGATAAACACTCTCATTCAGTAGTTACTGAAAGAAAACTCTGCTAGAATGAT
AAATGTCATGGTGGTCTATAACTCCAAATAAACAATGCAACGTTCCTGATTTCTAATCTTGGTTCTGAGAGCCATTTGGTTTCAGTTGTA

>In-frame_EZR_ENST00000392177_chr6_159191796_-_ROS1_ENST00000368507_chr6_117645578_-_2813nt
GTGTCGGGCGCGGCAGGAGGACGAGGCAGGGCGGGCGGGCGCTCTAAGGGTTCTGCTCTGACTCCAGGTTGGGACAGCGTCTTCGCTGCT
GCTGGATAGTCGTGTTTTCGGGGATCGAGGATACTCACCAGAAACCGAAAATGCCGAAACCAATCAATGTCCGAGTTACCACCATGGATG
CAGAGCTGGAGTTTGCAATCCAGCCAAATACAACTGGAAAACAGCTTTTTGATCAGGTGTCTGCCCAGGAGGTCAGGAAGGAGAATCCCC
TCCAGTTCAAGTTCCGGGCCAAGTTCTACCCTGAAGATGTGGCTGAGGAGCTCATCCAGGACATCACCCAGAAACTTTTCTTCCTCCAAG
TGAAGGAAGGAATCCTTAGCGATGAGATCTACTGCCCCCCTGAGACTGCCGTGCTCTTGGGGTCCTACGCTGTGCAGGCCAAGTTTGGGG
ACTACAACAAAGAAGTGCACAAGTCTGGGTACCTCAGCTCTGAGCGGCTGATCCCTCAAAGAGTGATGGACCAGCACAAACTTACCAGGG
ACCAGTGGGAGGACCGGATCCAGGTGTGGCATGCGGAACACCGTGGGATGCTCAAAGATAATGCTATGTTGGAATACCTGAAGATTGCTC
AGGACCTGGAAATGTATGGAATCAACTATTTCGAGATAAAAAACAAGAAAGGAACAGACCTTTGGCTTGGAGTTGATGCCCTTGGACTGA
ATATTTATGAGAAAGATGATAAGTTAACCCCAAAGATTGGCTTTCCTTGGAGTGAAATCAGGAACATCTCTTTCAATGACAAAAAGTTTG
TCATTAAACCCATCGACAAGAAGGCACCTGACTTTGTGTTTTATGCCCCACGTCTGAGAATCAACAAGCGGATCCTGCAGCTCTGCATGG
GCAACCATGAGTTGTATATGCGCCGCAGGAAGCCTGACACCATCGAGGTGCAGCAGATGAAGGCCCAGGCCCGGGAGGAGAAGCATCAGA
AGCAGCTGGAGCGGCAACAGCTGGAAACAGAGAAGAAAAGGAGAGAAACCGTGGAGAGAGAGAAAGAGCAGATGATGCGCGAGAAGGAGG
AGTTGATGCTGCGGCTGCAGGACTATGAGGAGAAGACAAAGAAGGCAGAGAGAGATGATTTTTGGATACCAGAAACAAGTTTCATACTTA
CTATTATAGTTGGAATATTTCTGGTTGTTACAATCCCACTGACCTTTGTCTGGCATAGAAGATTAAAGAATCAAAAAAGTGCCAAGGAAG
GGGTGACAGTGCTTATAAACGAAGACAAAGAGTTGGCTGAGCTGCGAGGTCTGGCAGCCGGAGTAGGCCTGGCTAATGCCTGCTATGCAA
TACATACTCTTCCAACCCAAGAGGAGATTGAAAATCTTCCTGCCTTCCCTCGGGAAAAACTGACTCTGCGTCTCTTGCTGGGAAGTGGAG
CCTTTGGAGAAGTGTATGAAGGAACAGCAGTGGACATCTTAGGAGTTGGAAGTGGAGAAATCAAAGTAGCAGTGAAGACTTTGAAGAAGG
GTTCCACAGACCAGGAGAAGATTGAATTCCTGAAGGAGGCACATCTGATGAGCAAATTTAATCATCCCAACATTCTGAAGCAGCTTGGAG
TTTGTCTGCTGAATGAACCCCAATACATTATCCTGGAACTGATGGAGGGAGGAGACCTTCTTACTTATTTGCGTAAAGCCCGGATGGCAA
CGTTTTATGGTCCTTTACTCACCTTGGTTGACCTTGTAGACCTGTGTGTAGATATTTCAAAAGGCTGTGTCTACTTGGAACGGATGCATT
TCATTCACAGGGATCTGGCAGCTAGAAATTGCCTTGTTTCCGTGAAAGACTATACCAGTCCACGGATAGTGAAGATTGGAGACTTTGGAC
TCGCCAGAGACATCTATAAAAATGATTACTATAGAAAGAGAGGGGAAGGCCTGCTCCCAGTTCGGTGGATGGCTCCAGAAAGTTTGATGG
ATGGAATCTTCACTACTCAATCTGATGTATGGTCTTTTGGAATTCTGATTTGGGAGATTTTAACTCTTGGTCATCAGCCTTATCCAGCTC
ATTCCAACCTTGATGTGTTAAACTATGTGCAAACAGGAGGGAGACTGGAGCCACCAAGAAATTGTCCTGATGATCTGTGGAATTTAATGA
CCCAGTGCTGGGCTCAAGAACCCGACCAAAGACCTACTTTTCATAGAATTCAGGACCAACTTCAGTTATTCAGAAATTTTTTCTTAAATA
GCATTTATAAGTCCAGAGATGAAGCAAACAACAGTGGAGTCATAAATGAAAGCTTTGAAGGTGAAGATGGCGATGTGATTTGTTTGAATT
CAGATGACATTATGCCAGTTGCTTTAATGGAAACGAAGAACCGAGAAGGGTTAAACTATATGGTACTTGCTACAGAATGTGGCCAAGGTG
AAGAAAAGTCTGAGGGTCCTCTAGGCTCCCAGGAATCTGAATCTTGTGGTCTGAGGAAAGAAGAGAAGGAACCACATGCAGACAAAGATT
TCTGCCAAGAAAAACAAGTGGCTTACTGCCCTTCTGGCAAGCCTGAAGGCCTGAACTATGCCTGTCTCACTCACAGTGGATATGGAGATG
GGTCTGATTAATAGCGTTGTTTGGGAAATAGAGAGTTGAGATAAACACTCTCATTCAGTAGTTACTGAAAGAAAACTCTGCTAGAATGAT
AAATGTCATGGTGGTCTATAACTCCAAATAAACAATGCAACGTTCCTGATTTCTAATCTTGGTTCTGAGAGCCATTTGGTTTCAGTTGTA


Top

FusionGenePPI for EZR_ROS1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
EZRPRKAB1, HLA-B, GABARAPL2, MCC, BID, TNFRSF10B, FAS, MSN, RHOA, ARHGDIA, FADD, FASLG, MAPK8, CASP10, CASP8, TNFRSF1A, AHNAK, PPL, SPTA1, PRX, S100P, SCYL3, SLC9A3R2, NF2, EZR, PTK2, L1CAM, TSC1, PIK3R1, ICAM1, ICAM2, ICAM3, VCAM1, ADORA2B, IQGAP1, CLIC5, CD44, PALLD, SLC9A3R1, PRKCA, SELP, DLG1, CFTR, SELL, SDC2, SPN, CTNNB1, CDH1, PHLPP2, DCC, ELAVL1, WWP1, ISG15, BRCA1, RDX, ACTN1, DGKQ, ARPC3, FN1, GZMM, BAG3, MPP3, WFDC1, MDM2, MAPK10, FBXO6, ASB6, CROCC, FH, FKBP9, GNPDA1, GTF3C4, H2AFZ, HEXA, HEXB, PDCD10, PDCD6IP, UBA1, IPO5, MC1R, OGFOD1, PYGL, RIC8A, TRNT1, UBE2R2, XPNPEP1, CUL7, OBSL1, VPS11, ACAA2, AKR1B1, CALR, CLIC4, ECE2, EIF5A2, EIF5AL1, ENO1, ENO2, AURKA, GDI2, TPD52, FABP5, GPX4, HSD17B10, HSPA4, HSPA4L, HSPE1, HSPH1, ISYNA1, LCP1, OAT, P4HB, PDXK, PGD, PLS1, PLS3, PPA2, RCN1, SHMT2, STIP1, TAGLN2, TKT, TPD52L2, TXNRD2, UCHL3, WDR1, NTRK1, SCARNA22, PTTG1, PPME1, NOLC1, B4GALT7, TIMM13, EGFR, MCM2, U2AF2, ERBB2, MRPL12, MISP, TSPAN33, PTPRQ, LASP1, DNM1L, FOXA1, TRIM25, HEY1ROS1PTPN6, PTPN11, VAV3, IKBKG, GRB2


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneEZRchr6:159191796chr6:117645578ENST00000337147-913244_586363587SCYL3
HgeneEZRchr6:159191796chr6:117645578ENST00000367075-1014244_586363587SCYL3


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for EZR_ROS1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for EZR_ROS1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneEZRC0033578Prostatic Neoplasms3CTD_human
HgeneEZRC0023893Liver Cirrhosis, Experimental1CTD_human
HgeneEZRC0024667Animal Mammary Neoplasms1CTD_human
HgeneEZRC0024668Mammary Neoplasms, Experimental1CTD_human
HgeneEZRC0027627Neoplasm Metastasis1CTD_human
HgeneEZRC0029408Degenerative polyarthritis1CTD_human
TgeneROS1C0007131Non-Small Cell Lung Carcinoma4CTD_human
TgeneROS1C0017638Glioma1CTD_human
TgeneROS1C0025202melanoma1CTD_human
TgeneROS1C0152013Adenocarcinoma of lung (disorder)1CTD_human