FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 12255

FusionGeneSummary for EXOC1_NUP107

check button Fusion gene summary
Fusion gene informationFusion gene name: EXOC1_NUP107
Fusion gene ID: 12255
HgeneTgene
Gene symbol

EXOC1

NUP107

Gene ID

55763

57122

Gene nameexocyst complex component 1nucleoporin 107
SynonymsBM-102|SEC3|SEC3L1|SEC3PNPHS11|NUP84
Cytomap

4q12

12q15

Type of geneprotein-codingprotein-coding
Descriptionexocyst complex component 1SEC3-like 1exocyst complex component Sec3nuclear pore complex protein Nup107nucleoporin 107kDa
Modification date2018052320180523
UniProtAcc

Q9NV70

P57740

Ensembl transtripts involved in fusion geneENST00000381295, ENST00000346134, 
ENST00000349598, 
ENST00000229179, 
ENST00000378905, ENST00000539906, 
ENST00000401003, 
Fusion gene scores* DoF score4 X 3 X 4=4823 X 12 X 9=2484
# samples 426
** MAII scorelog2(4/48*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(26/2484*10)=-3.25608164519203
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: EXOC1 [Title/Abstract] AND NUP107 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneEXOC1

GO:0048015

phosphatidylinositol-mediated signaling

25591774

TgeneNUP107

GO:0006406

mRNA export from nucleus

11684705


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDGBMTCGA-26-5135-01AEXOC1chr4

56726707

+NUP107chr12

69135593

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000381295ENST00000229179EXOC1chr4

56726707

+NUP107chr12

69135593

+
In-frameENST00000381295ENST00000378905EXOC1chr4

56726707

+NUP107chr12

69135593

+
In-frameENST00000381295ENST00000539906EXOC1chr4

56726707

+NUP107chr12

69135593

+
5CDS-intronENST00000381295ENST00000401003EXOC1chr4

56726707

+NUP107chr12

69135593

+
In-frameENST00000346134ENST00000229179EXOC1chr4

56726707

+NUP107chr12

69135593

+
In-frameENST00000346134ENST00000378905EXOC1chr4

56726707

+NUP107chr12

69135593

+
In-frameENST00000346134ENST00000539906EXOC1chr4

56726707

+NUP107chr12

69135593

+
5CDS-intronENST00000346134ENST00000401003EXOC1chr4

56726707

+NUP107chr12

69135593

+
In-frameENST00000349598ENST00000229179EXOC1chr4

56726707

+NUP107chr12

69135593

+
In-frameENST00000349598ENST00000378905EXOC1chr4

56726707

+NUP107chr12

69135593

+
In-frameENST00000349598ENST00000539906EXOC1chr4

56726707

+NUP107chr12

69135593

+
5CDS-intronENST00000349598ENST00000401003EXOC1chr4

56726707

+NUP107chr12

69135593

+

Top

FusionProtFeatures for EXOC1_NUP107


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
EXOC1

Q9NV70

NUP107

P57740

Component of the exocyst complex involved in the dockingof exocytic vesicles with fusion sites on the plasma membrane. (Microbial infection) Has an antiviral effect againstflaviviruses by affecting viral RNA transcription and translationthrough the sequestration of elongation factor 1-alpha (EEF1A1).This results in decreased viral RNA synthesis and decreased viralprotein translation. {ECO:0000269|PubMed:19889084}. Plays a role in the nuclear pore complex (NPC) assemblyand/or maintenance (PubMed:12552102, PubMed:15229283). Requiredfor the assembly of peripheral proteins into the NPC(PubMed:15229283, PubMed:12552102). May anchor NUP62 to the NPC(PubMed:15229283). {ECO:0000269|PubMed:12552102,ECO:0000269|PubMed:15229283}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneEXOC1chr4:56726707chr12:69135593ENST00000346134+319152_17485895Coiled coilOntology_term=ECO:0000255
HgeneEXOC1chr4:56726707chr12:69135593ENST00000346134+319205_25985895Coiled coilOntology_term=ECO:0000255
HgeneEXOC1chr4:56726707chr12:69135593ENST00000349598+318152_17485880Coiled coilOntology_term=ECO:0000255
HgeneEXOC1chr4:56726707chr12:69135593ENST00000349598+318205_25985880Coiled coilOntology_term=ECO:0000255
HgeneEXOC1chr4:56726707chr12:69135593ENST00000381295+319152_17485895Coiled coilOntology_term=ECO:0000255
HgeneEXOC1chr4:56726707chr12:69135593ENST00000381295+319205_25985895Coiled coilOntology_term=ECO:0000255


Top

FusionGeneSequence for EXOC1_NUP107


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_EXOC1_ENST00000381295_chr4_56726707_+_NUP107_ENST00000229179_chr12_69135593_+_177aa
MTAIKHALQRDIFTPNDERLLSIVNVCKAGKKKKNCFLCATVTTERPVQVKVVKVKKSDKGDFYKRQIAWALRDLAVVDAKDAIKDAKED

>In-frame_EXOC1_ENST00000381295_chr4_56726707_+_NUP107_ENST00000378905_chr12_69135593_+_177aa
MTAIKHALQRDIFTPNDERLLSIVNVCKAGKKKKNCFLCATVTTERPVQVKVVKVKKSDKGDFYKRQIAWALRDLAVVDAKDAIKDAKED

>In-frame_EXOC1_ENST00000381295_chr4_56726707_+_NUP107_ENST00000539906_chr12_69135593_+_177aa
MTAIKHALQRDIFTPNDERLLSIVNVCKAGKKKKNCFLCATVTTERPVQVKVVKVKKSDKGDFYKRQIAWALRDLAVVDAKDAIKDAKED

>In-frame_EXOC1_ENST00000346134_chr4_56726707_+_NUP107_ENST00000229179_chr12_69135593_+_177aa
MTAIKHALQRDIFTPNDERLLSIVNVCKAGKKKKNCFLCATVTTERPVQVKVVKVKKSDKGDFYKRQIAWALRDLAVVDAKDAIKDAKED

>In-frame_EXOC1_ENST00000346134_chr4_56726707_+_NUP107_ENST00000378905_chr12_69135593_+_177aa
MTAIKHALQRDIFTPNDERLLSIVNVCKAGKKKKNCFLCATVTTERPVQVKVVKVKKSDKGDFYKRQIAWALRDLAVVDAKDAIKDAKED

>In-frame_EXOC1_ENST00000346134_chr4_56726707_+_NUP107_ENST00000539906_chr12_69135593_+_177aa
MTAIKHALQRDIFTPNDERLLSIVNVCKAGKKKKNCFLCATVTTERPVQVKVVKVKKSDKGDFYKRQIAWALRDLAVVDAKDAIKDAKED

>In-frame_EXOC1_ENST00000349598_chr4_56726707_+_NUP107_ENST00000229179_chr12_69135593_+_177aa
MTAIKHALQRDIFTPNDERLLSIVNVCKAGKKKKNCFLCATVTTERPVQVKVVKVKKSDKGDFYKRQIAWALRDLAVVDAKDAIKDAKED

>In-frame_EXOC1_ENST00000349598_chr4_56726707_+_NUP107_ENST00000378905_chr12_69135593_+_177aa
MTAIKHALQRDIFTPNDERLLSIVNVCKAGKKKKNCFLCATVTTERPVQVKVVKVKKSDKGDFYKRQIAWALRDLAVVDAKDAIKDAKED

>In-frame_EXOC1_ENST00000349598_chr4_56726707_+_NUP107_ENST00000539906_chr12_69135593_+_177aa
MTAIKHALQRDIFTPNDERLLSIVNVCKAGKKKKNCFLCATVTTERPVQVKVVKVKKSDKGDFYKRQIAWALRDLAVVDAKDAIKDAKED


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_EXOC1_ENST00000381295_chr4_56726707_+_NUP107_ENST00000229179_chr12_69135593_+_531nt
ATGACAGCAATCAAGCATGCATTACAAAGAGACATTTTTACACCAAATGATGAACGCCTGCTGAGCATTGTGAATGTCTGCAAAGCAGGA
AAAAAGAAAAAGAACTGTTTTTTATGTGCCACAGTGACAACTGAACGCCCTGTGCAGGTTAAGGTGGTCAAAGTCAAGAAATCCGATAAG
GGAGATTTCTACAAAAGGCAGATTGCATGGGCCCTTCGAGATCTTGCTGTGGTAGATGCCAAAGATGCTATCAAAGATGCCAAAGAAGAC
CATGAAAGAACACATCAAATGGTCTTACTGAGAAAGCTTTGTCTGCCAATGTTGTGTTTTCTGCTTCATACGATATTGCACAGTACTGGT
CAGTATCAGGAATGCCTACAGTTAGCAGATATGGTATCCTCTGAGCGCCACAAACTGTACCTGGTATTTTCTAAGGAAGAGCTAAGGAAG

>In-frame_EXOC1_ENST00000381295_chr4_56726707_+_NUP107_ENST00000378905_chr12_69135593_+_531nt
ATGACAGCAATCAAGCATGCATTACAAAGAGACATTTTTACACCAAATGATGAACGCCTGCTGAGCATTGTGAATGTCTGCAAAGCAGGA
AAAAAGAAAAAGAACTGTTTTTTATGTGCCACAGTGACAACTGAACGCCCTGTGCAGGTTAAGGTGGTCAAAGTCAAGAAATCCGATAAG
GGAGATTTCTACAAAAGGCAGATTGCATGGGCCCTTCGAGATCTTGCTGTGGTAGATGCCAAAGATGCTATCAAAGATGCCAAAGAAGAC
CATGAAAGAACACATCAAATGGTCTTACTGAGAAAGCTTTGTCTGCCAATGTTGTGTTTTCTGCTTCATACGATATTGCACAGTACTGGT
CAGTATCAGGAATGCCTACAGTTAGCAGATATGGTATCCTCTGAGCGCCACAAACTGTACCTGGTATTTTCTAAGGAAGAGCTAAGGAAG

>In-frame_EXOC1_ENST00000381295_chr4_56726707_+_NUP107_ENST00000539906_chr12_69135593_+_531nt
ATGACAGCAATCAAGCATGCATTACAAAGAGACATTTTTACACCAAATGATGAACGCCTGCTGAGCATTGTGAATGTCTGCAAAGCAGGA
AAAAAGAAAAAGAACTGTTTTTTATGTGCCACAGTGACAACTGAACGCCCTGTGCAGGTTAAGGTGGTCAAAGTCAAGAAATCCGATAAG
GGAGATTTCTACAAAAGGCAGATTGCATGGGCCCTTCGAGATCTTGCTGTGGTAGATGCCAAAGATGCTATCAAAGATGCCAAAGAAGAC
CATGAAAGAACACATCAAATGGTCTTACTGAGAAAGCTTTGTCTGCCAATGTTGTGTTTTCTGCTTCATACGATATTGCACAGTACTGGT
CAGTATCAGGAATGCCTACAGTTAGCAGATATGGTATCCTCTGAGCGCCACAAACTGTACCTGGTATTTTCTAAGGAAGAGCTAAGGAAG

>In-frame_EXOC1_ENST00000346134_chr4_56726707_+_NUP107_ENST00000229179_chr12_69135593_+_531nt
ATGACAGCAATCAAGCATGCATTACAAAGAGACATTTTTACACCAAATGATGAACGCCTGCTGAGCATTGTGAATGTCTGCAAAGCAGGA
AAAAAGAAAAAGAACTGTTTTTTATGTGCCACAGTGACAACTGAACGCCCTGTGCAGGTTAAGGTGGTCAAAGTCAAGAAATCCGATAAG
GGAGATTTCTACAAAAGGCAGATTGCATGGGCCCTTCGAGATCTTGCTGTGGTAGATGCCAAAGATGCTATCAAAGATGCCAAAGAAGAC
CATGAAAGAACACATCAAATGGTCTTACTGAGAAAGCTTTGTCTGCCAATGTTGTGTTTTCTGCTTCATACGATATTGCACAGTACTGGT
CAGTATCAGGAATGCCTACAGTTAGCAGATATGGTATCCTCTGAGCGCCACAAACTGTACCTGGTATTTTCTAAGGAAGAGCTAAGGAAG

>In-frame_EXOC1_ENST00000346134_chr4_56726707_+_NUP107_ENST00000378905_chr12_69135593_+_531nt
ATGACAGCAATCAAGCATGCATTACAAAGAGACATTTTTACACCAAATGATGAACGCCTGCTGAGCATTGTGAATGTCTGCAAAGCAGGA
AAAAAGAAAAAGAACTGTTTTTTATGTGCCACAGTGACAACTGAACGCCCTGTGCAGGTTAAGGTGGTCAAAGTCAAGAAATCCGATAAG
GGAGATTTCTACAAAAGGCAGATTGCATGGGCCCTTCGAGATCTTGCTGTGGTAGATGCCAAAGATGCTATCAAAGATGCCAAAGAAGAC
CATGAAAGAACACATCAAATGGTCTTACTGAGAAAGCTTTGTCTGCCAATGTTGTGTTTTCTGCTTCATACGATATTGCACAGTACTGGT
CAGTATCAGGAATGCCTACAGTTAGCAGATATGGTATCCTCTGAGCGCCACAAACTGTACCTGGTATTTTCTAAGGAAGAGCTAAGGAAG

>In-frame_EXOC1_ENST00000346134_chr4_56726707_+_NUP107_ENST00000539906_chr12_69135593_+_531nt
ATGACAGCAATCAAGCATGCATTACAAAGAGACATTTTTACACCAAATGATGAACGCCTGCTGAGCATTGTGAATGTCTGCAAAGCAGGA
AAAAAGAAAAAGAACTGTTTTTTATGTGCCACAGTGACAACTGAACGCCCTGTGCAGGTTAAGGTGGTCAAAGTCAAGAAATCCGATAAG
GGAGATTTCTACAAAAGGCAGATTGCATGGGCCCTTCGAGATCTTGCTGTGGTAGATGCCAAAGATGCTATCAAAGATGCCAAAGAAGAC
CATGAAAGAACACATCAAATGGTCTTACTGAGAAAGCTTTGTCTGCCAATGTTGTGTTTTCTGCTTCATACGATATTGCACAGTACTGGT
CAGTATCAGGAATGCCTACAGTTAGCAGATATGGTATCCTCTGAGCGCCACAAACTGTACCTGGTATTTTCTAAGGAAGAGCTAAGGAAG

>In-frame_EXOC1_ENST00000349598_chr4_56726707_+_NUP107_ENST00000229179_chr12_69135593_+_531nt
ATGACAGCAATCAAGCATGCATTACAAAGAGACATTTTTACACCAAATGATGAACGCCTGCTGAGCATTGTGAATGTCTGCAAAGCAGGA
AAAAAGAAAAAGAACTGTTTTTTATGTGCCACAGTGACAACTGAACGCCCTGTGCAGGTTAAGGTGGTCAAAGTCAAGAAATCCGATAAG
GGAGATTTCTACAAAAGGCAGATTGCATGGGCCCTTCGAGATCTTGCTGTGGTAGATGCCAAAGATGCTATCAAAGATGCCAAAGAAGAC
CATGAAAGAACACATCAAATGGTCTTACTGAGAAAGCTTTGTCTGCCAATGTTGTGTTTTCTGCTTCATACGATATTGCACAGTACTGGT
CAGTATCAGGAATGCCTACAGTTAGCAGATATGGTATCCTCTGAGCGCCACAAACTGTACCTGGTATTTTCTAAGGAAGAGCTAAGGAAG

>In-frame_EXOC1_ENST00000349598_chr4_56726707_+_NUP107_ENST00000378905_chr12_69135593_+_531nt
ATGACAGCAATCAAGCATGCATTACAAAGAGACATTTTTACACCAAATGATGAACGCCTGCTGAGCATTGTGAATGTCTGCAAAGCAGGA
AAAAAGAAAAAGAACTGTTTTTTATGTGCCACAGTGACAACTGAACGCCCTGTGCAGGTTAAGGTGGTCAAAGTCAAGAAATCCGATAAG
GGAGATTTCTACAAAAGGCAGATTGCATGGGCCCTTCGAGATCTTGCTGTGGTAGATGCCAAAGATGCTATCAAAGATGCCAAAGAAGAC
CATGAAAGAACACATCAAATGGTCTTACTGAGAAAGCTTTGTCTGCCAATGTTGTGTTTTCTGCTTCATACGATATTGCACAGTACTGGT
CAGTATCAGGAATGCCTACAGTTAGCAGATATGGTATCCTCTGAGCGCCACAAACTGTACCTGGTATTTTCTAAGGAAGAGCTAAGGAAG

>In-frame_EXOC1_ENST00000349598_chr4_56726707_+_NUP107_ENST00000539906_chr12_69135593_+_531nt
ATGACAGCAATCAAGCATGCATTACAAAGAGACATTTTTACACCAAATGATGAACGCCTGCTGAGCATTGTGAATGTCTGCAAAGCAGGA
AAAAAGAAAAAGAACTGTTTTTTATGTGCCACAGTGACAACTGAACGCCCTGTGCAGGTTAAGGTGGTCAAAGTCAAGAAATCCGATAAG
GGAGATTTCTACAAAAGGCAGATTGCATGGGCCCTTCGAGATCTTGCTGTGGTAGATGCCAAAGATGCTATCAAAGATGCCAAAGAAGAC
CATGAAAGAACACATCAAATGGTCTTACTGAGAAAGCTTTGTCTGCCAATGTTGTGTTTTCTGCTTCATACGATATTGCACAGTACTGGT
CAGTATCAGGAATGCCTACAGTTAGCAGATATGGTATCCTCTGAGCGCCACAAACTGTACCTGGTATTTTCTAAGGAAGAGCTAAGGAAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_EXOC1_ENST00000381295_chr4_56726707_+_NUP107_ENST00000229179_chr12_69135593_+_1422nt
CTTCCTTCTCTACGCGGTCAACTTCCGGCGCGGAGTTTGTCACGTGCCCGGATATAGGAAGTGTTGGGGGAACGGCCGCTTCCCGTTCAA
CGCTTTATTGAGGGGCGTATCCTAGTGGCCCCCATCCGGTCTCCGTTTTGGAAGACCCGCCTCGGCACAGCCAGGCTCAGTCCGGCCTTG
CGGTAAGCCTTCGGCCGCGGCTGCCCGGTAGTCCCGGCGGCGGCGGACAGACGAGCTGACAGGCACCAGGGTCTAAGGCGGCTCCTCAGT
CCGGCTGCTGTCTCCACGCCTGGGGTCGGGCACCGCTCCTTCTGACCTTCCTTTCCCCGTTTGTCCCGCTGAGAAAAGATGACAGCAATC
AAGCATGCATTACAAAGAGACATTTTTACACCAAATGATGAACGCCTGCTGAGCATTGTGAATGTCTGCAAAGCAGGAAAAAAGAAAAAG
AACTGTTTTTTATGTGCCACAGTGACAACTGAACGCCCTGTGCAGGTTAAGGTGGTCAAAGTCAAGAAATCCGATAAGGGAGATTTCTAC
AAAAGGCAGATTGCATGGGCCCTTCGAGATCTTGCTGTGGTAGATGCCAAAGATGCTATCAAAGATGCCAAAGAAGACCATGAAAGAACA
CATCAAATGGTCTTACTGAGAAAGCTTTGTCTGCCAATGTTGTGTTTTCTGCTTCATACGATATTGCACAGTACTGGTCAGTATCAGGAA
TGCCTACAGTTAGCAGATATGGTATCCTCTGAGCGCCACAAACTGTACCTGGTATTTTCTAAGGAAGAGCTAAGGAAGTTGCTGCAGAAG
CTCAGAGAGTCCTCTCTAATGCTCCTAGACCAGGGACTTGACCCATTAGGGTATGAAATTCAGTTATAGTTTAATCTTTGTAATCTCACT
AATTTTCATGATAAATGAAGTTTTTAATAAAATATACTTGTTATTAGTAATTTTTTCTTTTGCATTACCATGTAAAATTTAGACATTTGA
ATTTTGTACTTTTCAGAATATTATCGTGACACTTTCAACATGTAGGGATATCAGCGTTTCTCTGTGTGCTTGTTAATAAAACTATATAAA
AATTAAAATTTTCTGTTTTTACAAATTCCAGGGTTGTCTCTTTTTCATGTAATAAGAAAATTAAATTTTCTGTTCTAGTTTTTTCTGTAA
TCATAAGCATTCTGATATTTTAAAATCATAAAGATGATGGAAAGTAGATTTATTTTTAAGCCAGGTACGTAATTTTTTATTTATCATAAA
ATTTAGTATTTTTGAATATTAAAATTAAGAAGATGACTATAACAAGAATTTTTCTAACATAACATGCTATTATTATTTTAGTTATTTTGA

>In-frame_EXOC1_ENST00000381295_chr4_56726707_+_NUP107_ENST00000378905_chr12_69135593_+_1100nt
CTTCCTTCTCTACGCGGTCAACTTCCGGCGCGGAGTTTGTCACGTGCCCGGATATAGGAAGTGTTGGGGGAACGGCCGCTTCCCGTTCAA
CGCTTTATTGAGGGGCGTATCCTAGTGGCCCCCATCCGGTCTCCGTTTTGGAAGACCCGCCTCGGCACAGCCAGGCTCAGTCCGGCCTTG
CGGTAAGCCTTCGGCCGCGGCTGCCCGGTAGTCCCGGCGGCGGCGGACAGACGAGCTGACAGGCACCAGGGTCTAAGGCGGCTCCTCAGT
CCGGCTGCTGTCTCCACGCCTGGGGTCGGGCACCGCTCCTTCTGACCTTCCTTTCCCCGTTTGTCCCGCTGAGAAAAGATGACAGCAATC
AAGCATGCATTACAAAGAGACATTTTTACACCAAATGATGAACGCCTGCTGAGCATTGTGAATGTCTGCAAAGCAGGAAAAAAGAAAAAG
AACTGTTTTTTATGTGCCACAGTGACAACTGAACGCCCTGTGCAGGTTAAGGTGGTCAAAGTCAAGAAATCCGATAAGGGAGATTTCTAC
AAAAGGCAGATTGCATGGGCCCTTCGAGATCTTGCTGTGGTAGATGCCAAAGATGCTATCAAAGATGCCAAAGAAGACCATGAAAGAACA
CATCAAATGGTCTTACTGAGAAAGCTTTGTCTGCCAATGTTGTGTTTTCTGCTTCATACGATATTGCACAGTACTGGTCAGTATCAGGAA
TGCCTACAGTTAGCAGATATGGTATCCTCTGAGCGCCACAAACTGTACCTGGTATTTTCTAAGGAAGAGCTAAGGAAGTTGCTGCAGAAG
CTCAGAGAGTCCTCTCTAATGCTCCTAGACCAGGGACTTGACCCATTAGGGTATGAAATTCAGTTATAGTTTAATCTTTGTAATCTCACT
AATTTTCATGATAAATGAAGTTTTTAATAAAATATACTTGTTATTAGTAATTTTTTCTTTTGCATTACCATGTAAAATTTAGACATTTGA
ATTTTGTACTTTTCAGAATATTATCGTGACACTTTCAACATGTAGGGATATCAGCGTTTCTCTGTGTGCTTGTTAATAAAACTATATAAA

>In-frame_EXOC1_ENST00000381295_chr4_56726707_+_NUP107_ENST00000539906_chr12_69135593_+_948nt
CTTCCTTCTCTACGCGGTCAACTTCCGGCGCGGAGTTTGTCACGTGCCCGGATATAGGAAGTGTTGGGGGAACGGCCGCTTCCCGTTCAA
CGCTTTATTGAGGGGCGTATCCTAGTGGCCCCCATCCGGTCTCCGTTTTGGAAGACCCGCCTCGGCACAGCCAGGCTCAGTCCGGCCTTG
CGGTAAGCCTTCGGCCGCGGCTGCCCGGTAGTCCCGGCGGCGGCGGACAGACGAGCTGACAGGCACCAGGGTCTAAGGCGGCTCCTCAGT
CCGGCTGCTGTCTCCACGCCTGGGGTCGGGCACCGCTCCTTCTGACCTTCCTTTCCCCGTTTGTCCCGCTGAGAAAAGATGACAGCAATC
AAGCATGCATTACAAAGAGACATTTTTACACCAAATGATGAACGCCTGCTGAGCATTGTGAATGTCTGCAAAGCAGGAAAAAAGAAAAAG
AACTGTTTTTTATGTGCCACAGTGACAACTGAACGCCCTGTGCAGGTTAAGGTGGTCAAAGTCAAGAAATCCGATAAGGGAGATTTCTAC
AAAAGGCAGATTGCATGGGCCCTTCGAGATCTTGCTGTGGTAGATGCCAAAGATGCTATCAAAGATGCCAAAGAAGACCATGAAAGAACA
CATCAAATGGTCTTACTGAGAAAGCTTTGTCTGCCAATGTTGTGTTTTCTGCTTCATACGATATTGCACAGTACTGGTCAGTATCAGGAA
TGCCTACAGTTAGCAGATATGGTATCCTCTGAGCGCCACAAACTGTACCTGGTATTTTCTAAGGAAGAGCTAAGGAAGTTGCTGCAGAAG
CTCAGAGAGTCCTCTCTAATGCTCCTAGACCAGGGACTTGACCCATTAGGGTATGAAATTCAGTTATAGTTTAATCTTTGTAATCTCACT

>In-frame_EXOC1_ENST00000346134_chr4_56726707_+_NUP107_ENST00000229179_chr12_69135593_+_1207nt
AGTGTTGGGGGAACGGCCGCTTCCCGTTCAACGCTTTATTGAGGGGCGTATCCTAGTGGCCCCCATCCGGTCTCCGTTTTGGAAGACCCG
CCTCGGCACAGCCAGGCTCAGTCCGGCCTTGCGCTGAGAAAAGATGACAGCAATCAAGCATGCATTACAAAGAGACATTTTTACACCAAA
TGATGAACGCCTGCTGAGCATTGTGAATGTCTGCAAAGCAGGAAAAAAGAAAAAGAACTGTTTTTTATGTGCCACAGTGACAACTGAACG
CCCTGTGCAGGTTAAGGTGGTCAAAGTCAAGAAATCCGATAAGGGAGATTTCTACAAAAGGCAGATTGCATGGGCCCTTCGAGATCTTGC
TGTGGTAGATGCCAAAGATGCTATCAAAGATGCCAAAGAAGACCATGAAAGAACACATCAAATGGTCTTACTGAGAAAGCTTTGTCTGCC
AATGTTGTGTTTTCTGCTTCATACGATATTGCACAGTACTGGTCAGTATCAGGAATGCCTACAGTTAGCAGATATGGTATCCTCTGAGCG
CCACAAACTGTACCTGGTATTTTCTAAGGAAGAGCTAAGGAAGTTGCTGCAGAAGCTCAGAGAGTCCTCTCTAATGCTCCTAGACCAGGG
ACTTGACCCATTAGGGTATGAAATTCAGTTATAGTTTAATCTTTGTAATCTCACTAATTTTCATGATAAATGAAGTTTTTAATAAAATAT
ACTTGTTATTAGTAATTTTTTCTTTTGCATTACCATGTAAAATTTAGACATTTGAATTTTGTACTTTTCAGAATATTATCGTGACACTTT
CAACATGTAGGGATATCAGCGTTTCTCTGTGTGCTTGTTAATAAAACTATATAAAAATTAAAATTTTCTGTTTTTACAAATTCCAGGGTT
GTCTCTTTTTCATGTAATAAGAAAATTAAATTTTCTGTTCTAGTTTTTTCTGTAATCATAAGCATTCTGATATTTTAAAATCATAAAGAT
GATGGAAAGTAGATTTATTTTTAAGCCAGGTACGTAATTTTTTATTTATCATAAAATTTAGTATTTTTGAATATTAAAATTAAGAAGATG
ACTATAACAAGAATTTTTCTAACATAACATGCTATTATTATTTTAGTTATTTTGAAGACATTTCTAGTTTAACTTTCATTTAGCAAACTT

>In-frame_EXOC1_ENST00000346134_chr4_56726707_+_NUP107_ENST00000378905_chr12_69135593_+_885nt
AGTGTTGGGGGAACGGCCGCTTCCCGTTCAACGCTTTATTGAGGGGCGTATCCTAGTGGCCCCCATCCGGTCTCCGTTTTGGAAGACCCG
CCTCGGCACAGCCAGGCTCAGTCCGGCCTTGCGCTGAGAAAAGATGACAGCAATCAAGCATGCATTACAAAGAGACATTTTTACACCAAA
TGATGAACGCCTGCTGAGCATTGTGAATGTCTGCAAAGCAGGAAAAAAGAAAAAGAACTGTTTTTTATGTGCCACAGTGACAACTGAACG
CCCTGTGCAGGTTAAGGTGGTCAAAGTCAAGAAATCCGATAAGGGAGATTTCTACAAAAGGCAGATTGCATGGGCCCTTCGAGATCTTGC
TGTGGTAGATGCCAAAGATGCTATCAAAGATGCCAAAGAAGACCATGAAAGAACACATCAAATGGTCTTACTGAGAAAGCTTTGTCTGCC
AATGTTGTGTTTTCTGCTTCATACGATATTGCACAGTACTGGTCAGTATCAGGAATGCCTACAGTTAGCAGATATGGTATCCTCTGAGCG
CCACAAACTGTACCTGGTATTTTCTAAGGAAGAGCTAAGGAAGTTGCTGCAGAAGCTCAGAGAGTCCTCTCTAATGCTCCTAGACCAGGG
ACTTGACCCATTAGGGTATGAAATTCAGTTATAGTTTAATCTTTGTAATCTCACTAATTTTCATGATAAATGAAGTTTTTAATAAAATAT
ACTTGTTATTAGTAATTTTTTCTTTTGCATTACCATGTAAAATTTAGACATTTGAATTTTGTACTTTTCAGAATATTATCGTGACACTTT

>In-frame_EXOC1_ENST00000346134_chr4_56726707_+_NUP107_ENST00000539906_chr12_69135593_+_733nt
AGTGTTGGGGGAACGGCCGCTTCCCGTTCAACGCTTTATTGAGGGGCGTATCCTAGTGGCCCCCATCCGGTCTCCGTTTTGGAAGACCCG
CCTCGGCACAGCCAGGCTCAGTCCGGCCTTGCGCTGAGAAAAGATGACAGCAATCAAGCATGCATTACAAAGAGACATTTTTACACCAAA
TGATGAACGCCTGCTGAGCATTGTGAATGTCTGCAAAGCAGGAAAAAAGAAAAAGAACTGTTTTTTATGTGCCACAGTGACAACTGAACG
CCCTGTGCAGGTTAAGGTGGTCAAAGTCAAGAAATCCGATAAGGGAGATTTCTACAAAAGGCAGATTGCATGGGCCCTTCGAGATCTTGC
TGTGGTAGATGCCAAAGATGCTATCAAAGATGCCAAAGAAGACCATGAAAGAACACATCAAATGGTCTTACTGAGAAAGCTTTGTCTGCC
AATGTTGTGTTTTCTGCTTCATACGATATTGCACAGTACTGGTCAGTATCAGGAATGCCTACAGTTAGCAGATATGGTATCCTCTGAGCG
CCACAAACTGTACCTGGTATTTTCTAAGGAAGAGCTAAGGAAGTTGCTGCAGAAGCTCAGAGAGTCCTCTCTAATGCTCCTAGACCAGGG
ACTTGACCCATTAGGGTATGAAATTCAGTTATAGTTTAATCTTTGTAATCTCACTAATTTTCATGATAAATGAAGTTTTTAATAAAATAT

>In-frame_EXOC1_ENST00000349598_chr4_56726707_+_NUP107_ENST00000229179_chr12_69135593_+_1143nt
ATCCGGTCTCCGTTTTGGAAGACCCGCCTCGGCACAGCCAGGCTCAGTCCGGCCTTGCGCTGAGAAAAGATGACAGCAATCAAGCATGCA
TTACAAAGAGACATTTTTACACCAAATGATGAACGCCTGCTGAGCATTGTGAATGTCTGCAAAGCAGGAAAAAAGAAAAAGAACTGTTTT
TTATGTGCCACAGTGACAACTGAACGCCCTGTGCAGGTTAAGGTGGTCAAAGTCAAGAAATCCGATAAGGGAGATTTCTACAAAAGGCAG
ATTGCATGGGCCCTTCGAGATCTTGCTGTGGTAGATGCCAAAGATGCTATCAAAGATGCCAAAGAAGACCATGAAAGAACACATCAAATG
GTCTTACTGAGAAAGCTTTGTCTGCCAATGTTGTGTTTTCTGCTTCATACGATATTGCACAGTACTGGTCAGTATCAGGAATGCCTACAG
TTAGCAGATATGGTATCCTCTGAGCGCCACAAACTGTACCTGGTATTTTCTAAGGAAGAGCTAAGGAAGTTGCTGCAGAAGCTCAGAGAG
TCCTCTCTAATGCTCCTAGACCAGGGACTTGACCCATTAGGGTATGAAATTCAGTTATAGTTTAATCTTTGTAATCTCACTAATTTTCAT
GATAAATGAAGTTTTTAATAAAATATACTTGTTATTAGTAATTTTTTCTTTTGCATTACCATGTAAAATTTAGACATTTGAATTTTGTAC
TTTTCAGAATATTATCGTGACACTTTCAACATGTAGGGATATCAGCGTTTCTCTGTGTGCTTGTTAATAAAACTATATAAAAATTAAAAT
TTTCTGTTTTTACAAATTCCAGGGTTGTCTCTTTTTCATGTAATAAGAAAATTAAATTTTCTGTTCTAGTTTTTTCTGTAATCATAAGCA
TTCTGATATTTTAAAATCATAAAGATGATGGAAAGTAGATTTATTTTTAAGCCAGGTACGTAATTTTTTATTTATCATAAAATTTAGTAT
TTTTGAATATTAAAATTAAGAAGATGACTATAACAAGAATTTTTCTAACATAACATGCTATTATTATTTTAGTTATTTTGAAGACATTTC

>In-frame_EXOC1_ENST00000349598_chr4_56726707_+_NUP107_ENST00000378905_chr12_69135593_+_821nt
ATCCGGTCTCCGTTTTGGAAGACCCGCCTCGGCACAGCCAGGCTCAGTCCGGCCTTGCGCTGAGAAAAGATGACAGCAATCAAGCATGCA
TTACAAAGAGACATTTTTACACCAAATGATGAACGCCTGCTGAGCATTGTGAATGTCTGCAAAGCAGGAAAAAAGAAAAAGAACTGTTTT
TTATGTGCCACAGTGACAACTGAACGCCCTGTGCAGGTTAAGGTGGTCAAAGTCAAGAAATCCGATAAGGGAGATTTCTACAAAAGGCAG
ATTGCATGGGCCCTTCGAGATCTTGCTGTGGTAGATGCCAAAGATGCTATCAAAGATGCCAAAGAAGACCATGAAAGAACACATCAAATG
GTCTTACTGAGAAAGCTTTGTCTGCCAATGTTGTGTTTTCTGCTTCATACGATATTGCACAGTACTGGTCAGTATCAGGAATGCCTACAG
TTAGCAGATATGGTATCCTCTGAGCGCCACAAACTGTACCTGGTATTTTCTAAGGAAGAGCTAAGGAAGTTGCTGCAGAAGCTCAGAGAG
TCCTCTCTAATGCTCCTAGACCAGGGACTTGACCCATTAGGGTATGAAATTCAGTTATAGTTTAATCTTTGTAATCTCACTAATTTTCAT
GATAAATGAAGTTTTTAATAAAATATACTTGTTATTAGTAATTTTTTCTTTTGCATTACCATGTAAAATTTAGACATTTGAATTTTGTAC
TTTTCAGAATATTATCGTGACACTTTCAACATGTAGGGATATCAGCGTTTCTCTGTGTGCTTGTTAATAAAACTATATAAAAATTAAAAT

>In-frame_EXOC1_ENST00000349598_chr4_56726707_+_NUP107_ENST00000539906_chr12_69135593_+_669nt
ATCCGGTCTCCGTTTTGGAAGACCCGCCTCGGCACAGCCAGGCTCAGTCCGGCCTTGCGCTGAGAAAAGATGACAGCAATCAAGCATGCA
TTACAAAGAGACATTTTTACACCAAATGATGAACGCCTGCTGAGCATTGTGAATGTCTGCAAAGCAGGAAAAAAGAAAAAGAACTGTTTT
TTATGTGCCACAGTGACAACTGAACGCCCTGTGCAGGTTAAGGTGGTCAAAGTCAAGAAATCCGATAAGGGAGATTTCTACAAAAGGCAG
ATTGCATGGGCCCTTCGAGATCTTGCTGTGGTAGATGCCAAAGATGCTATCAAAGATGCCAAAGAAGACCATGAAAGAACACATCAAATG
GTCTTACTGAGAAAGCTTTGTCTGCCAATGTTGTGTTTTCTGCTTCATACGATATTGCACAGTACTGGTCAGTATCAGGAATGCCTACAG
TTAGCAGATATGGTATCCTCTGAGCGCCACAAACTGTACCTGGTATTTTCTAAGGAAGAGCTAAGGAAGTTGCTGCAGAAGCTCAGAGAG
TCCTCTCTAATGCTCCTAGACCAGGGACTTGACCCATTAGGGTATGAAATTCAGTTATAGTTTAATCTTTGTAATCTCACTAATTTTCAT


Top

FusionGenePPI for EXOC1_NUP107


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
EXOC1CDC5L, DISC1, TRAF3IP1, TRIO, DST, LUC7L2, EXOC4, SYBU, SPTAN1, SFR1, CCSER2, CCDC93, CCDC88A, KDM1A, NUF2, MACF1, SRGAP2, GOLGA4, SH3BP5, CEP295, KIAA1551, KIF5A, TRIM9, KANSL1, COLEC12, IQCB1, KIAA0226, RB1CC1, ATG14, SNAP29, BSG, CD274, THAP7, KIR2DS2, CA14, DTNBP1, TMEFF1, SCN2B, EXOC2, EXOC3, NTRK1, MED4, SNW1, EXOC6, NCKAP5L, TUFT1, GRIPAP1, CLOCK, FKBP15, PTRF, BLOC1S4, IKBIP, RABEP2, RABGAP1L, NDC80, PHF21A, IL1R2, EXOC6B, EXOC8, VPS53, RABGEF1, CCDC6, CCDC132, TRIM32, EXOC5, KXD1, GIT2, POTEE, ARHGEF7, SNAPIN, VPS51, BLOC1S2, EXOC7, USP4, THAP11, TSKS, JUN, TSSC1, TNFRSF8, CCHCR1, SIKE1, GIT1, KIF5B, RABEP1, NUP54, TNIP1, GOLGA5, COG6, KIF5C, STRN3, STRN, APLNR, PCNT, CCDC122, EDNRB, ZWINT, VTI1B, TMED1, RALB, MTNR1ANUP107SEH1L, NUP133, NUP85, NUP160, NUP43, NUP37, SEC13, TPR, NUP214, KPNB1, SIRT7, NUP98, WRNIP1, CUL3, CENPF, NUP153, TP53BP1, PNPT1, EIF4B, CORO1B, MYL1, C1QBP, CPSF6, VCP, PYCARD, CUL7, OBSL1, SUZ12, EED, PNKD, NTRK1, IFI16, SYNE1, APC, PRKDC, RRP1B, NALCN, CD1E, ACTBL2, HSP90AB1, XPO1, SENP1, SENP2, AHCTF1, RANGAP1, H2AFV, NUP50, RANBP2, B9D2, ACLY, RCC1, GLE1, ITPR2, KPNA4, NUP88, RAN, UBE2I, SUMO1, AAAS, RAE1, NUP155, NUP93, NUPL1, WDR1, NXF1, IPO7, NUPL2, NUP205, NUP210, NUP188, NUP62, NXT1, SEC61A1, NUP54, TMEM214, SMPD4, NDC1, KRAS, IP6K3, TMEM209, NUP35, RPUSD3, RGPD8, POM121C, FOXA3, FOXI2, FOXK2, FOXL1, FOXP3, FOXQ1, CDC5L, ZNF746, DUSP13, SPAST, UXS1, SIGLECL1, CD70, RAF1, PDHA1, TRIM25, BRCA1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for EXOC1_NUP107


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for EXOC1_NUP107


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneNUP107C4225228NEPHROTIC SYNDROME, TYPE 111UNIPROT