FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 12237

FusionGeneSummary for EWSR1_NFATC2

check button Fusion gene summary
Fusion gene informationFusion gene name: EWSR1_NFATC2
Fusion gene ID: 12237
HgeneTgene
Gene symbol

EWSR1

NFATC2

Gene ID

2130

4773

Gene nameEWS RNA binding protein 1nuclear factor of activated T cells 2
SynonymsEWS|EWS-FLI1|bK984G1.4NFAT1|NFATP
Cytomap

22q12.2

20q13.2

Type of geneprotein-codingprotein-coding
DescriptionRNA-binding protein EWSEWS RNA-binding protein variant 6Ewing sarcoma breakpoint region 1Ewings sarcoma EWS-Fli1 (type 1) oncogenenuclear factor of activated T-cells, cytoplasmic 2NF-ATc2NFAT pre-existing subunitNFAT transcription complex, preexisting componentT cell transcription factor NFAT1nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2nuclear fact
Modification date2018052720180523
UniProtAcc

Q01844

Q13469

Ensembl transtripts involved in fusion geneENST00000332050, ENST00000397938, 
ENST00000406548, ENST00000331029, 
ENST00000414183, ENST00000333395, 
ENST00000332035, 
ENST00000371564, 
ENST00000396009, ENST00000609943, 
ENST00000610033, ENST00000414705, 
ENST00000609507, 
Fusion gene scores* DoF score17 X 31 X 5=26352 X 2 X 2=8
# samples 534
** MAII scorelog2(53/2635*10)=-2.31373869707402
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/8*10)=2.32192809488736
Context

PubMed: EWSR1 [Title/Abstract] AND NFATC2 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneNFATC2

GO:0016477

cell migration

21871017

TgeneNFATC2

GO:0045893

positive regulation of transcription, DNA-templated

15790681

TgeneNFATC2

GO:1905064

negative regulation of vascular smooth muscle cell differentiation

23853098


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
ChiTaRS3.1FJ573261EWSR1chr22

29684775

+NFATC2chr20

50133495

-
ChiTaRS3.1FJ573260EWSR1chr22

29684775

+NFATC2chr20

50133495

-
ChiTaRS3.1FJ573259EWSR1chr22

29684775

+NFATC2chr20

50133495

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
intron-3CDSENST00000332050ENST00000371564EWSR1chr22

29684775

+NFATC2chr20

50133495

-
intron-3CDSENST00000332050ENST00000396009EWSR1chr22

29684775

+NFATC2chr20

50133495

-
intron-3CDSENST00000332050ENST00000609943EWSR1chr22

29684775

+NFATC2chr20

50133495

-
intron-3CDSENST00000332050ENST00000610033EWSR1chr22

29684775

+NFATC2chr20

50133495

-
intron-3CDSENST00000332050ENST00000414705EWSR1chr22

29684775

+NFATC2chr20

50133495

-
intron-3CDSENST00000332050ENST00000609507EWSR1chr22

29684775

+NFATC2chr20

50133495

-
In-frameENST00000397938ENST00000371564EWSR1chr22

29684775

+NFATC2chr20

50133495

-
In-frameENST00000397938ENST00000396009EWSR1chr22

29684775

+NFATC2chr20

50133495

-
In-frameENST00000397938ENST00000609943EWSR1chr22

29684775

+NFATC2chr20

50133495

-
In-frameENST00000397938ENST00000610033EWSR1chr22

29684775

+NFATC2chr20

50133495

-
In-frameENST00000397938ENST00000414705EWSR1chr22

29684775

+NFATC2chr20

50133495

-
In-frameENST00000397938ENST00000609507EWSR1chr22

29684775

+NFATC2chr20

50133495

-
In-frameENST00000406548ENST00000371564EWSR1chr22

29684775

+NFATC2chr20

50133495

-
In-frameENST00000406548ENST00000396009EWSR1chr22

29684775

+NFATC2chr20

50133495

-
In-frameENST00000406548ENST00000609943EWSR1chr22

29684775

+NFATC2chr20

50133495

-
In-frameENST00000406548ENST00000610033EWSR1chr22

29684775

+NFATC2chr20

50133495

-
In-frameENST00000406548ENST00000414705EWSR1chr22

29684775

+NFATC2chr20

50133495

-
In-frameENST00000406548ENST00000609507EWSR1chr22

29684775

+NFATC2chr20

50133495

-
intron-3CDSENST00000331029ENST00000371564EWSR1chr22

29684775

+NFATC2chr20

50133495

-
intron-3CDSENST00000331029ENST00000396009EWSR1chr22

29684775

+NFATC2chr20

50133495

-
intron-3CDSENST00000331029ENST00000609943EWSR1chr22

29684775

+NFATC2chr20

50133495

-
intron-3CDSENST00000331029ENST00000610033EWSR1chr22

29684775

+NFATC2chr20

50133495

-
intron-3CDSENST00000331029ENST00000414705EWSR1chr22

29684775

+NFATC2chr20

50133495

-
intron-3CDSENST00000331029ENST00000609507EWSR1chr22

29684775

+NFATC2chr20

50133495

-
In-frameENST00000414183ENST00000371564EWSR1chr22

29684775

+NFATC2chr20

50133495

-
In-frameENST00000414183ENST00000396009EWSR1chr22

29684775

+NFATC2chr20

50133495

-
In-frameENST00000414183ENST00000609943EWSR1chr22

29684775

+NFATC2chr20

50133495

-
In-frameENST00000414183ENST00000610033EWSR1chr22

29684775

+NFATC2chr20

50133495

-
In-frameENST00000414183ENST00000414705EWSR1chr22

29684775

+NFATC2chr20

50133495

-
In-frameENST00000414183ENST00000609507EWSR1chr22

29684775

+NFATC2chr20

50133495

-
In-frameENST00000333395ENST00000371564EWSR1chr22

29684775

+NFATC2chr20

50133495

-
In-frameENST00000333395ENST00000396009EWSR1chr22

29684775

+NFATC2chr20

50133495

-
In-frameENST00000333395ENST00000609943EWSR1chr22

29684775

+NFATC2chr20

50133495

-
In-frameENST00000333395ENST00000610033EWSR1chr22

29684775

+NFATC2chr20

50133495

-
In-frameENST00000333395ENST00000414705EWSR1chr22

29684775

+NFATC2chr20

50133495

-
In-frameENST00000333395ENST00000609507EWSR1chr22

29684775

+NFATC2chr20

50133495

-
In-frameENST00000332035ENST00000371564EWSR1chr22

29684775

+NFATC2chr20

50133495

-
In-frameENST00000332035ENST00000396009EWSR1chr22

29684775

+NFATC2chr20

50133495

-
In-frameENST00000332035ENST00000609943EWSR1chr22

29684775

+NFATC2chr20

50133495

-
In-frameENST00000332035ENST00000610033EWSR1chr22

29684775

+NFATC2chr20

50133495

-
In-frameENST00000332035ENST00000414705EWSR1chr22

29684775

+NFATC2chr20

50133495

-
In-frameENST00000332035ENST00000609507EWSR1chr22

29684775

+NFATC2chr20

50133495

-

Top

FusionProtFeatures for EWSR1_NFATC2


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
EWSR1

Q01844

NFATC2

Q13469

Might normally function as a transcriptional repressor.EWS-fusion-proteins (EFPS) may play a role in the tumorigenicprocess. They may disturb gene expression by mimicking, orinterfering with the normal function of CTD-POLII within thetranscription initiation complex. They may also contribute to anaberrant activation of the fusion protein target genes.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for EWSR1_NFATC2


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_EWSR1_ENST00000397938_chr22_29684775_+_NFATC2_ENST00000371564_chr20_50133495_-_1320aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQSSFRQD
HPSSMGVTGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGAGSSRRRRRRRSASPGASRTRCARRAVPGPGVRPY
EERDPAARAASASPTARGPRASRARPRPRPRSLPALRAMNAPERQPQPDGGDAPGHEPGGSPQDELDFSILFDTETLNPNEEEPNAHKVA
SPPSGPAYPDDVLDTGLKPYSPLASLSGEPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHELIQAVGPLRMRDAGLLVEQPPL
AGVAASPRFTLPVPGFEGYREPLCLSPASSGSSASFISDTFSPYTSPCVSPNNGGPDDLCPQFQNIPAHTSPRTSPIMSPRTSLAEDSCL
GRHSPVPRPASRSSSPGAKRRHSCAEALVALPPGASPQRSRSPSPQPSSHVAPQDHGSPAGYPPVAGSAVIMDALNSLATDSPCGIPPKM
WKTSPDPSPVSAAPSKAGLPRHIYPAVEFLGPCEQGERRNSAPESILLVPPTWPKPLVPAIPICSIPVTASLPPLEWPLSSQSGSYELRI
EVQPKPHHRAHTETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSTEKIVGNTKVLEIP
LEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVTG
GQQMILTGQNFTSESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPETRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPVPAIK
TEPTDETDPTLICSPTHGGLGSQPYYPQHPMVAESPSCLVATMAPCQQFRTGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGTQQPALMA
APLSLADAHRSVLVHAGSQGQSSALLHPSPTNQQASPVIHYSPTNQQLRCGSHQEFQHIMYCENFAPGTTRPGPPPVSQGQRLSPGSYPT

>In-frame_EWSR1_ENST00000397938_chr22_29684775_+_NFATC2_ENST00000396009_chr20_50133495_-_864aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQSSFRQD
HPSSMGVTGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGIPVTASLPPLEWPLSSQSGSYELRIEVQPKPHHRA
HTETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSTEKIVGNTKVLEIPLEPKNNMRAT
IDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVTGGQQMILTGQN
FTSESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPETRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPVPAIKTEPTDETDPT
LICSPTHGGLGSQPYYPQHPMVAESPSCLVATMAPCQQFRTGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGTQQPALMAAPLSLADAHR
SVLVHAGSQGQSSALLHPSPTNQQASPVIHYSPTNQQLRCGSHQEFQHIMYCENFAPGTTRPGPPPVSQGQRLSPGSYPTVIQQQNATSQ

>In-frame_EWSR1_ENST00000397938_chr22_29684775_+_NFATC2_ENST00000609943_chr20_50133495_-_864aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQSSFRQD
HPSSMGVTGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGIPVTASLPPLEWPLSSQSGSYELRIEVQPKPHHRA
HTETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSTEKIVGNTKVLEIPLEPKNNMRAT
IDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVTGGQQMILTGQN
FTSESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPETRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPVPAIKTEPTDETDPT
LICSPTHGGLGSQPYYPQHPMVAESPSCLVATMAPCQQFRTGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGTQQPALMAAPLSLADAHR
SVLVHAGSQGQSSALLHPSPTNQQASPVIHYSPTNQQLRCGSHQEFQHIMYCENFAPGTTRPGPPPVSQGQRLSPGSYPTVIQQQNATSQ

>In-frame_EWSR1_ENST00000406548_chr22_29684775_+_NFATC2_ENST00000371564_chr20_50133495_-_1320aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQSSFRQD
HPSSMGVTGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGAGSSRRRRRRRSASPGASRTRCARRAVPGPGVRPY
EERDPAARAASASPTARGPRASRARPRPRPRSLPALRAMNAPERQPQPDGGDAPGHEPGGSPQDELDFSILFDTETLNPNEEEPNAHKVA
SPPSGPAYPDDVLDTGLKPYSPLASLSGEPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHELIQAVGPLRMRDAGLLVEQPPL
AGVAASPRFTLPVPGFEGYREPLCLSPASSGSSASFISDTFSPYTSPCVSPNNGGPDDLCPQFQNIPAHTSPRTSPIMSPRTSLAEDSCL
GRHSPVPRPASRSSSPGAKRRHSCAEALVALPPGASPQRSRSPSPQPSSHVAPQDHGSPAGYPPVAGSAVIMDALNSLATDSPCGIPPKM
WKTSPDPSPVSAAPSKAGLPRHIYPAVEFLGPCEQGERRNSAPESILLVPPTWPKPLVPAIPICSIPVTASLPPLEWPLSSQSGSYELRI
EVQPKPHHRAHTETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSTEKIVGNTKVLEIP
LEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVTG
GQQMILTGQNFTSESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPETRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPVPAIK
TEPTDETDPTLICSPTHGGLGSQPYYPQHPMVAESPSCLVATMAPCQQFRTGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGTQQPALMA
APLSLADAHRSVLVHAGSQGQSSALLHPSPTNQQASPVIHYSPTNQQLRCGSHQEFQHIMYCENFAPGTTRPGPPPVSQGQRLSPGSYPT

>In-frame_EWSR1_ENST00000406548_chr22_29684775_+_NFATC2_ENST00000396009_chr20_50133495_-_864aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQSSFRQD
HPSSMGVTGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGIPVTASLPPLEWPLSSQSGSYELRIEVQPKPHHRA
HTETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSTEKIVGNTKVLEIPLEPKNNMRAT
IDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVTGGQQMILTGQN
FTSESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPETRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPVPAIKTEPTDETDPT
LICSPTHGGLGSQPYYPQHPMVAESPSCLVATMAPCQQFRTGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGTQQPALMAAPLSLADAHR
SVLVHAGSQGQSSALLHPSPTNQQASPVIHYSPTNQQLRCGSHQEFQHIMYCENFAPGTTRPGPPPVSQGQRLSPGSYPTVIQQQNATSQ

>In-frame_EWSR1_ENST00000406548_chr22_29684775_+_NFATC2_ENST00000609943_chr20_50133495_-_864aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQSSFRQD
HPSSMGVTGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGIPVTASLPPLEWPLSSQSGSYELRIEVQPKPHHRA
HTETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSTEKIVGNTKVLEIPLEPKNNMRAT
IDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVTGGQQMILTGQN
FTSESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPETRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPVPAIKTEPTDETDPT
LICSPTHGGLGSQPYYPQHPMVAESPSCLVATMAPCQQFRTGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGTQQPALMAAPLSLADAHR
SVLVHAGSQGQSSALLHPSPTNQQASPVIHYSPTNQQLRCGSHQEFQHIMYCENFAPGTTRPGPPPVSQGQRLSPGSYPTVIQQQNATSQ

>In-frame_EWSR1_ENST00000414183_chr22_29684775_+_NFATC2_ENST00000371564_chr20_50133495_-_1326aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTVEGTSTGTTTPTAPQ
AYSQPVQGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQ
VPGSYPMQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQ
SSFRQDHPSSMGVTGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGAGSSRRRRRRRSASPGASRTRCARRAVPG
PGVRPYEERDPAARAASASPTARGPRASRARPRPRPRSLPALRAMNAPERQPQPDGGDAPGHEPGGSPQDELDFSILFDTETLNPNEEEP
NAHKVASPPSGPAYPDDVLDTGLKPYSPLASLSGEPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHELIQAVGPLRMRDAGLL
VEQPPLAGVAASPRFTLPVPGFEGYREPLCLSPASSGSSASFISDTFSPYTSPCVSPNNGGPDDLCPQFQNIPAHTSPRTSPIMSPRTSL
AEDSCLGRHSPVPRPASRSSSPGAKRRHSCAEALVALPPGASPQRSRSPSPQPSSHVAPQDHGSPAGYPPVAGSAVIMDALNSLATDSPC
GIPPKMWKTSPDPSPVSAAPSKAGLPRHIYPAVEFLGPCEQGERRNSAPESILLVPPTWPKPLVPAIPICSIPVTASLPPLEWPLSSQSG
SYELRIEVQPKPHHRAHTETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSTEKIVGNT
KVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDTD
SCLVTGGQQMILTGQNFTSESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPETRNKHIRTPVKVNFYVINGKRKRSQPQHFTYH
PVPAIKTEPTDETDPTLICSPTHGGLGSQPYYPQHPMVAESPSCLVATMAPCQQFRTGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGTQ
QPALMAAPLSLADAHRSVLVHAGSQGQSSALLHPSPTNQQASPVIHYSPTNQQLRCGSHQEFQHIMYCENFAPGTTRPGPPPVSQGQRLS

>In-frame_EWSR1_ENST00000414183_chr22_29684775_+_NFATC2_ENST00000396009_chr20_50133495_-_870aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTVEGTSTGTTTPTAPQ
AYSQPVQGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQ
VPGSYPMQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQ
SSFRQDHPSSMGVTGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGIPVTASLPPLEWPLSSQSGSYELRIEVQP
KPHHRAHTETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSTEKIVGNTKVLEIPLEPK
NNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVTGGQQM
ILTGQNFTSESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPETRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPVPAIKTEPT
DETDPTLICSPTHGGLGSQPYYPQHPMVAESPSCLVATMAPCQQFRTGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGTQQPALMAAPLS
LADAHRSVLVHAGSQGQSSALLHPSPTNQQASPVIHYSPTNQQLRCGSHQEFQHIMYCENFAPGTTRPGPPPVSQGQRLSPGSYPTVIQQ

>In-frame_EWSR1_ENST00000414183_chr22_29684775_+_NFATC2_ENST00000609943_chr20_50133495_-_870aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTVEGTSTGTTTPTAPQ
AYSQPVQGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQ
VPGSYPMQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQ
SSFRQDHPSSMGVTGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGIPVTASLPPLEWPLSSQSGSYELRIEVQP
KPHHRAHTETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSTEKIVGNTKVLEIPLEPK
NNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVTGGQQM
ILTGQNFTSESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPETRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPVPAIKTEPT
DETDPTLICSPTHGGLGSQPYYPQHPMVAESPSCLVATMAPCQQFRTGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGTQQPALMAAPLS
LADAHRSVLVHAGSQGQSSALLHPSPTNQQASPVIHYSPTNQQLRCGSHQEFQHIMYCENFAPGTTRPGPPPVSQGQRLSPGSYPTVIQQ

>In-frame_EWSR1_ENST00000333395_chr22_29684775_+_NFATC2_ENST00000371564_chr20_50133495_-_1320aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQSSFRQD
HPSSMGVTGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGAGSSRRRRRRRSASPGASRTRCARRAVPGPGVRPY
EERDPAARAASASPTARGPRASRARPRPRPRSLPALRAMNAPERQPQPDGGDAPGHEPGGSPQDELDFSILFDTETLNPNEEEPNAHKVA
SPPSGPAYPDDVLDTGLKPYSPLASLSGEPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHELIQAVGPLRMRDAGLLVEQPPL
AGVAASPRFTLPVPGFEGYREPLCLSPASSGSSASFISDTFSPYTSPCVSPNNGGPDDLCPQFQNIPAHTSPRTSPIMSPRTSLAEDSCL
GRHSPVPRPASRSSSPGAKRRHSCAEALVALPPGASPQRSRSPSPQPSSHVAPQDHGSPAGYPPVAGSAVIMDALNSLATDSPCGIPPKM
WKTSPDPSPVSAAPSKAGLPRHIYPAVEFLGPCEQGERRNSAPESILLVPPTWPKPLVPAIPICSIPVTASLPPLEWPLSSQSGSYELRI
EVQPKPHHRAHTETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSTEKIVGNTKVLEIP
LEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVTG
GQQMILTGQNFTSESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPETRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPVPAIK
TEPTDETDPTLICSPTHGGLGSQPYYPQHPMVAESPSCLVATMAPCQQFRTGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGTQQPALMA
APLSLADAHRSVLVHAGSQGQSSALLHPSPTNQQASPVIHYSPTNQQLRCGSHQEFQHIMYCENFAPGTTRPGPPPVSQGQRLSPGSYPT

>In-frame_EWSR1_ENST00000333395_chr22_29684775_+_NFATC2_ENST00000396009_chr20_50133495_-_864aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQSSFRQD
HPSSMGVTGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGIPVTASLPPLEWPLSSQSGSYELRIEVQPKPHHRA
HTETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSTEKIVGNTKVLEIPLEPKNNMRAT
IDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVTGGQQMILTGQN
FTSESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPETRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPVPAIKTEPTDETDPT
LICSPTHGGLGSQPYYPQHPMVAESPSCLVATMAPCQQFRTGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGTQQPALMAAPLSLADAHR
SVLVHAGSQGQSSALLHPSPTNQQASPVIHYSPTNQQLRCGSHQEFQHIMYCENFAPGTTRPGPPPVSQGQRLSPGSYPTVIQQQNATSQ

>In-frame_EWSR1_ENST00000333395_chr22_29684775_+_NFATC2_ENST00000609943_chr20_50133495_-_864aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQSSFRQD
HPSSMGVTGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGIPVTASLPPLEWPLSSQSGSYELRIEVQPKPHHRA
HTETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSTEKIVGNTKVLEIPLEPKNNMRAT
IDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVTGGQQMILTGQN
FTSESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPETRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPVPAIKTEPTDETDPT
LICSPTHGGLGSQPYYPQHPMVAESPSCLVATMAPCQQFRTGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGTQQPALMAAPLSLADAHR
SVLVHAGSQGQSSALLHPSPTNQQASPVIHYSPTNQQLRCGSHQEFQHIMYCENFAPGTTRPGPPPVSQGQRLSPGSYPTVIQQQNATSQ

>In-frame_EWSR1_ENST00000332035_chr22_29684775_+_NFATC2_ENST00000371564_chr20_50133495_-_1264aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQP
PTSYPPQTGSYSQAPSQTSQQSSSYGQQSSFRQDHPSSMGVTGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGA
GSSRRRRRRRSASPGASRTRCARRAVPGPGVRPYEERDPAARAASASPTARGPRASRARPRPRPRSLPALRAMNAPERQPQPDGGDAPGH
EPGGSPQDELDFSILFDTETLNPNEEEPNAHKVASPPSGPAYPDDVLDTGLKPYSPLASLSGEPPGRFGEPDRVGPQKFLSAAKPAGASG
LSPRIEITPSHELIQAVGPLRMRDAGLLVEQPPLAGVAASPRFTLPVPGFEGYREPLCLSPASSGSSASFISDTFSPYTSPCVSPNNGGP
DDLCPQFQNIPAHTSPRTSPIMSPRTSLAEDSCLGRHSPVPRPASRSSSPGAKRRHSCAEALVALPPGASPQRSRSPSPQPSSHVAPQDH
GSPAGYPPVAGSAVIMDALNSLATDSPCGIPPKMWKTSPDPSPVSAAPSKAGLPRHIYPAVEFLGPCEQGERRNSAPESILLVPPTWPKP
LVPAIPICSIPVTASLPPLEWPLSSQSGSYELRIEVQPKPHHRAHTETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERIL
KPHAFYQVHRITGKTVTTTSTEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIV
SLQTASNPIECSQRSAHELPMVERQDTDSCLVTGGQQMILTGQNFTSESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPETRNK
HIRTPVKVNFYVINGKRKRSQPQHFTYHPVPAIKTEPTDETDPTLICSPTHGGLGSQPYYPQHPMVAESPSCLVATMAPCQQFRTGLSSP
DARYQQQNPAAVLYQRSKSLSPSLLGTQQPALMAAPLSLADAHRSVLVHAGSQGQSSALLHPSPTNQQASPVIHYSPTNQQLRCGSHQEF
QHIMYCENFAPGTTRPGPPPVSQGQRLSPGSYPTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNLDQTYLDDELIDTHLSWIQ

>In-frame_EWSR1_ENST00000332035_chr22_29684775_+_NFATC2_ENST00000396009_chr20_50133495_-_808aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQP
PTSYPPQTGSYSQAPSQTSQQSSSYGQQSSFRQDHPSSMGVTGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGI
PVTASLPPLEWPLSSQSGSYELRIEVQPKPHHRAHTETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHR
ITGKTVTTTSTEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSLQTASNPIE
CSQRSAHELPMVERQDTDSCLVTGGQQMILTGQNFTSESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPETRNKHIRTPVKVNF
YVINGKRKRSQPQHFTYHPVPAIKTEPTDETDPTLICSPTHGGLGSQPYYPQHPMVAESPSCLVATMAPCQQFRTGLSSPDARYQQQNPA
AVLYQRSKSLSPSLLGTQQPALMAAPLSLADAHRSVLVHAGSQGQSSALLHPSPTNQQASPVIHYSPTNQQLRCGSHQEFQHIMYCENFA

>In-frame_EWSR1_ENST00000332035_chr22_29684775_+_NFATC2_ENST00000609943_chr20_50133495_-_808aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQP
PTSYPPQTGSYSQAPSQTSQQSSSYGQQSSFRQDHPSSMGVTGQESGGFSGPGENRSMSGPDNRGRGRGGFDRGGMSRGGRGGGRGGMGI
PVTASLPPLEWPLSSQSGSYELRIEVQPKPHHRAHTETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHR
ITGKTVTTTSTEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSLQTASNPIE
CSQRSAHELPMVERQDTDSCLVTGGQQMILTGQNFTSESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPETRNKHIRTPVKVNF
YVINGKRKRSQPQHFTYHPVPAIKTEPTDETDPTLICSPTHGGLGSQPYYPQHPMVAESPSCLVATMAPCQQFRTGLSSPDARYQQQNPA
AVLYQRSKSLSPSLLGTQQPALMAAPLSLADAHRSVLVHAGSQGQSSALLHPSPTNQQASPVIHYSPTNQQLRCGSHQEFQHIMYCENFA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_EWSR1_ENST00000397938_chr22_29684775_+_NFATC2_ENST00000371564_chr20_50133495_-_3960nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGAC
CACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGG
GGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGTGGAATGGGAGCAGGAAGCTCGCGC
CGCCGTCGCCGCCGCCGCTCAGCTTCCCCGGGCGCGTCCAGGACCCGCTGCGCCAGGCGCGCCGTCCCCGGACCCGGCGTGCGTCCCTAC
GAGGAAAGGGACCCCGCCGCTCGAGCCGCCTCCGCCAGCCCCACTGCGAGGGGTCCCAGAGCCAGCCGCGCCCGCCCTCGCCCCCGGCCC
CGCAGCCTTCCCGCCCTGCGCGCCATGAACGCCCCCGAGCGGCAGCCCCAACCCGACGGCGGGGACGCCCCAGGCCACGAGCCTGGGGGC
AGCCCCCAAGACGAGCTTGACTTCTCCATCCTCTTCGACTATGAGTATTTGAATCCGAACGAAGAAGAGCCGAATGCACATAAGGTCGCC
AGCCCACCCTCCGGACCCGCATACCCCGATGATGTCCTGGACTATGGCCTCAAGCCATACAGCCCCCTTGCTAGTCTCTCTGGCGAGCCC
CCCGGCCGATTCGGAGAGCCGGATAGGGTAGGGCCGCAGAAGTTTCTGAGCGCGGCCAAGCCAGCAGGGGCCTCGGGCCTGAGCCCTCGG
ATCGAGATCACTCCGTCCCACGAACTGATCCAGGCAGTGGGGCCCCTCCGCATGAGAGACGCGGGCCTCCTGGTGGAGCAGCCGCCCCTG
GCCGGGGTGGCCGCCAGCCCGAGGTTCACCCTGCCCGTGCCCGGCTTCGAGGGCTACCGCGAGCCGCTTTGCTTGAGCCCCGCTAGCAGC
GGCTCCTCTGCCAGCTTCATTTCTGACACCTTCTCCCCCTACACCTCGCCCTGCGTCTCGCCCAATAACGGCGGGCCCGACGACCTGTGT
CCGCAGTTTCAAAACATCCCTGCTCATTATTCCCCCAGAACCTCGCCAATAATGTCACCTCGAACCAGCCTCGCCGAGGACAGCTGCCTG
GGCCGCCACTCGCCCGTGCCCCGTCCGGCCTCCCGCTCCTCATCGCCTGGTGCCAAGCGGAGGCATTCGTGCGCCGAGGCCTTGGTTGCC
CTGCCGCCCGGAGCCTCACCCCAGCGCTCCCGGAGCCCCTCGCCGCAGCCCTCATCTCACGTGGCACCCCAGGACCACGGCTCCCCGGCT
GGGTACCCCCCTGTGGCTGGCTCTGCCGTGATCATGGATGCCCTGAACAGCCTCGCCACGGACTCGCCTTGTGGGATCCCCCCCAAGATG
TGGAAGACCAGCCCTGACCCCTCGCCGGTGTCTGCCGCCCCATCCAAGGCCGGCCTGCCTCGCCACATCTACCCGGCCGTGGAGTTCCTG
GGGCCCTGCGAGCAGGGCGAGAGGAGAAACTCGGCTCCAGAATCCATCCTGCTGGTTCCGCCCACTTGGCCCAAGCCGCTGGTGCCTGCC
ATTCCCATCTGCAGCATCCCAGTGACTGCATCCCTCCCTCCACTTGAGTGGCCGCTGTCCAGTCAGTCAGGCTCTTACGAGCTGCGGATC
GAGGTGCAGCCCAAGCCACATCACCGGGCCCACTATGAGACAGAAGGCAGCCGAGGGGCTGTCAAAGCTCCAACTGGAGGCCACCCTGTG
GTTCAGCTCCATGGCTACATGGAAAACAAGCCTCTGGGACTTCAGATCTTCATTGGGACAGCTGATGAGCGGATCCTTAAGCCGCACGCC
TTCTACCAGGTGCACCGAATCACGGGGAAAACTGTCACCACCACCAGCTATGAGAAGATAGTGGGCAACACCAAAGTCCTGGAGATACCC
TTGGAGCCCAAAAACAACATGAGGGCAACCATCGACTGTGCGGGGATCTTGAAGCTTAGAAACGCCGACATTGAGCTGCGGAAAGGCGAG
ACGGACATTGGAAGAAAGAACACGCGGGTGAGACTGGTTTTCCGAGTTCACATCCCAGAGTCCAGTGGCAGAATCGTCTCTTTACAGACT
GCATCTAACCCCATCGAGTGCTCCCAGCGATCTGCTCACGAGCTGCCCATGGTTGAAAGACAAGACACAGACAGCTGCCTGGTCTATGGC
GGCCAGCAAATGATCCTCACGGGGCAGAACTTTACATCCGAGTCCAAAGTTGTGTTTACTGAGAAGACCACAGATGGACAGCAAATTTGG
GAGATGGAAGCCACGGTGGATAAGGACAAGAGCCAGCCCAACATGCTTTTTGTTGAGATCCCTGAATATCGGAACAAGCATATCCGCACA
CCTGTAAAAGTGAACTTCTACGTCATCAATGGGAAGAGAAAACGAAGTCAGCCTCAGCACTTTACCTACCACCCAGTCCCAGCCATCAAG
ACGGAGCCCACGGATGAATATGACCCCACTCTGATCTGCAGCCCCACCCATGGAGGCCTGGGGAGCCAGCCTTACTACCCCCAGCACCCG
ATGGTGGCCGAGTCCCCCTCCTGCCTCGTGGCCACCATGGCTCCCTGCCAGCAGTTCCGCACGGGGCTCTCATCCCCTGACGCCCGCTAC
CAGCAACAGAACCCAGCGGCCGTACTCTACCAGCGGAGCAAGAGCCTGAGCCCCAGCCTGCTGGGCTATCAGCAGCCGGCCCTCATGGCC
GCCCCGCTGTCCCTTGCGGACGCTCACCGCTCTGTGCTGGTGCACGCCGGCTCCCAGGGCCAGAGCTCAGCCCTGCTCCACCCCTCTCCG
ACCAACCAGCAGGCCTCGCCTGTGATCCACTACTCACCCACCAACCAGCAGCTGCGCTGCGGAAGCCACCAGGAGTTCCAGCACATCATG
TACTGCGAGAATTTCGCACCAGGCACCACCAGACCTGGCCCGCCCCCGGTCAGTCAAGGTCAGAGGCTGAGCCCGGGTTCCTACCCCACA
GTCATTCAGCAGCAGAATGCCACGAGCCAAAGAGCCGCCAAAAACGGACCCCCGGTCAGTGACCAAAAGGAAGTATTACCTGCGGGGGTG
ACCATTAAACAGGAGCAGAACTTGGACCAGACCTACTTGGATGATGAGCTGATAGACACACACCTTAGCTGGATACAAAACATATTATGA

>In-frame_EWSR1_ENST00000397938_chr22_29684775_+_NFATC2_ENST00000396009_chr20_50133495_-_2592nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGAC
CACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGG
GGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGTGGAATGGGCATCCCAGTGACTGCA
TCCCTCCCTCCACTTGAGTGGCCGCTGTCCAGTCAGTCAGGCTCTTACGAGCTGCGGATCGAGGTGCAGCCCAAGCCACATCACCGGGCC
CACTATGAGACAGAAGGCAGCCGAGGGGCTGTCAAAGCTCCAACTGGAGGCCACCCTGTGGTTCAGCTCCATGGCTACATGGAAAACAAG
CCTCTGGGACTTCAGATCTTCATTGGGACAGCTGATGAGCGGATCCTTAAGCCGCACGCCTTCTACCAGGTGCACCGAATCACGGGGAAA
ACTGTCACCACCACCAGCTATGAGAAGATAGTGGGCAACACCAAAGTCCTGGAGATACCCTTGGAGCCCAAAAACAACATGAGGGCAACC
ATCGACTGTGCGGGGATCTTGAAGCTTAGAAACGCCGACATTGAGCTGCGGAAAGGCGAGACGGACATTGGAAGAAAGAACACGCGGGTG
AGACTGGTTTTCCGAGTTCACATCCCAGAGTCCAGTGGCAGAATCGTCTCTTTACAGACTGCATCTAACCCCATCGAGTGCTCCCAGCGA
TCTGCTCACGAGCTGCCCATGGTTGAAAGACAAGACACAGACAGCTGCCTGGTCTATGGCGGCCAGCAAATGATCCTCACGGGGCAGAAC
TTTACATCCGAGTCCAAAGTTGTGTTTACTGAGAAGACCACAGATGGACAGCAAATTTGGGAGATGGAAGCCACGGTGGATAAGGACAAG
AGCCAGCCCAACATGCTTTTTGTTGAGATCCCTGAATATCGGAACAAGCATATCCGCACACCTGTAAAAGTGAACTTCTACGTCATCAAT
GGGAAGAGAAAACGAAGTCAGCCTCAGCACTTTACCTACCACCCAGTCCCAGCCATCAAGACGGAGCCCACGGATGAATATGACCCCACT
CTGATCTGCAGCCCCACCCATGGAGGCCTGGGGAGCCAGCCTTACTACCCCCAGCACCCGATGGTGGCCGAGTCCCCCTCCTGCCTCGTG
GCCACCATGGCTCCCTGCCAGCAGTTCCGCACGGGGCTCTCATCCCCTGACGCCCGCTACCAGCAACAGAACCCAGCGGCCGTACTCTAC
CAGCGGAGCAAGAGCCTGAGCCCCAGCCTGCTGGGCTATCAGCAGCCGGCCCTCATGGCCGCCCCGCTGTCCCTTGCGGACGCTCACCGC
TCTGTGCTGGTGCACGCCGGCTCCCAGGGCCAGAGCTCAGCCCTGCTCCACCCCTCTCCGACCAACCAGCAGGCCTCGCCTGTGATCCAC
TACTCACCCACCAACCAGCAGCTGCGCTGCGGAAGCCACCAGGAGTTCCAGCACATCATGTACTGCGAGAATTTCGCACCAGGCACCACC
AGACCTGGCCCGCCCCCGGTCAGTCAAGGTCAGAGGCTGAGCCCGGGTTCCTACCCCACAGTCATTCAGCAGCAGAATGCCACGAGCCAA
AGAGCCGCCAAAAACGGACCCCCGGTCAGTGACCAAAAGGAAGTATTACCTGCGGGGGTGACCATTAAACAGGAGCAGAACTTGGACCAG

>In-frame_EWSR1_ENST00000397938_chr22_29684775_+_NFATC2_ENST00000609943_chr20_50133495_-_2592nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGAC
CACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGG
GGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGTGGAATGGGCATCCCAGTGACTGCA
TCCCTCCCTCCACTTGAGTGGCCGCTGTCCAGTCAGTCAGGCTCTTACGAGCTGCGGATCGAGGTGCAGCCCAAGCCACATCACCGGGCC
CACTATGAGACAGAAGGCAGCCGAGGGGCTGTCAAAGCTCCAACTGGAGGCCACCCTGTGGTTCAGCTCCATGGCTACATGGAAAACAAG
CCTCTGGGACTTCAGATCTTCATTGGGACAGCTGATGAGCGGATCCTTAAGCCGCACGCCTTCTACCAGGTGCACCGAATCACGGGGAAA
ACTGTCACCACCACCAGCTATGAGAAGATAGTGGGCAACACCAAAGTCCTGGAGATACCCTTGGAGCCCAAAAACAACATGAGGGCAACC
ATCGACTGTGCGGGGATCTTGAAGCTTAGAAACGCCGACATTGAGCTGCGGAAAGGCGAGACGGACATTGGAAGAAAGAACACGCGGGTG
AGACTGGTTTTCCGAGTTCACATCCCAGAGTCCAGTGGCAGAATCGTCTCTTTACAGACTGCATCTAACCCCATCGAGTGCTCCCAGCGA
TCTGCTCACGAGCTGCCCATGGTTGAAAGACAAGACACAGACAGCTGCCTGGTCTATGGCGGCCAGCAAATGATCCTCACGGGGCAGAAC
TTTACATCCGAGTCCAAAGTTGTGTTTACTGAGAAGACCACAGATGGACAGCAAATTTGGGAGATGGAAGCCACGGTGGATAAGGACAAG
AGCCAGCCCAACATGCTTTTTGTTGAGATCCCTGAATATCGGAACAAGCATATCCGCACACCTGTAAAAGTGAACTTCTACGTCATCAAT
GGGAAGAGAAAACGAAGTCAGCCTCAGCACTTTACCTACCACCCAGTCCCAGCCATCAAGACGGAGCCCACGGATGAATATGACCCCACT
CTGATCTGCAGCCCCACCCATGGAGGCCTGGGGAGCCAGCCTTACTACCCCCAGCACCCGATGGTGGCCGAGTCCCCCTCCTGCCTCGTG
GCCACCATGGCTCCCTGCCAGCAGTTCCGCACGGGGCTCTCATCCCCTGACGCCCGCTACCAGCAACAGAACCCAGCGGCCGTACTCTAC
CAGCGGAGCAAGAGCCTGAGCCCCAGCCTGCTGGGCTATCAGCAGCCGGCCCTCATGGCCGCCCCGCTGTCCCTTGCGGACGCTCACCGC
TCTGTGCTGGTGCACGCCGGCTCCCAGGGCCAGAGCTCAGCCCTGCTCCACCCCTCTCCGACCAACCAGCAGGCCTCGCCTGTGATCCAC
TACTCACCCACCAACCAGCAGCTGCGCTGCGGAAGCCACCAGGAGTTCCAGCACATCATGTACTGCGAGAATTTCGCACCAGGCACCACC
AGACCTGGCCCGCCCCCGGTCAGTCAAGGTCAGAGGCTGAGCCCGGGTTCCTACCCCACAGTCATTCAGCAGCAGAATGCCACGAGCCAA
AGAGCCGCCAAAAACGGACCCCCGGTCAGTGACCAAAAGGAAGTATTACCTGCGGGGGTGACCATTAAACAGGAGCAGAACTTGGACCAG

>In-frame_EWSR1_ENST00000406548_chr22_29684775_+_NFATC2_ENST00000371564_chr20_50133495_-_3960nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGAC
CACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGG
GGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGTGGAATGGGAGCAGGAAGCTCGCGC
CGCCGTCGCCGCCGCCGCTCAGCTTCCCCGGGCGCGTCCAGGACCCGCTGCGCCAGGCGCGCCGTCCCCGGACCCGGCGTGCGTCCCTAC
GAGGAAAGGGACCCCGCCGCTCGAGCCGCCTCCGCCAGCCCCACTGCGAGGGGTCCCAGAGCCAGCCGCGCCCGCCCTCGCCCCCGGCCC
CGCAGCCTTCCCGCCCTGCGCGCCATGAACGCCCCCGAGCGGCAGCCCCAACCCGACGGCGGGGACGCCCCAGGCCACGAGCCTGGGGGC
AGCCCCCAAGACGAGCTTGACTTCTCCATCCTCTTCGACTATGAGTATTTGAATCCGAACGAAGAAGAGCCGAATGCACATAAGGTCGCC
AGCCCACCCTCCGGACCCGCATACCCCGATGATGTCCTGGACTATGGCCTCAAGCCATACAGCCCCCTTGCTAGTCTCTCTGGCGAGCCC
CCCGGCCGATTCGGAGAGCCGGATAGGGTAGGGCCGCAGAAGTTTCTGAGCGCGGCCAAGCCAGCAGGGGCCTCGGGCCTGAGCCCTCGG
ATCGAGATCACTCCGTCCCACGAACTGATCCAGGCAGTGGGGCCCCTCCGCATGAGAGACGCGGGCCTCCTGGTGGAGCAGCCGCCCCTG
GCCGGGGTGGCCGCCAGCCCGAGGTTCACCCTGCCCGTGCCCGGCTTCGAGGGCTACCGCGAGCCGCTTTGCTTGAGCCCCGCTAGCAGC
GGCTCCTCTGCCAGCTTCATTTCTGACACCTTCTCCCCCTACACCTCGCCCTGCGTCTCGCCCAATAACGGCGGGCCCGACGACCTGTGT
CCGCAGTTTCAAAACATCCCTGCTCATTATTCCCCCAGAACCTCGCCAATAATGTCACCTCGAACCAGCCTCGCCGAGGACAGCTGCCTG
GGCCGCCACTCGCCCGTGCCCCGTCCGGCCTCCCGCTCCTCATCGCCTGGTGCCAAGCGGAGGCATTCGTGCGCCGAGGCCTTGGTTGCC
CTGCCGCCCGGAGCCTCACCCCAGCGCTCCCGGAGCCCCTCGCCGCAGCCCTCATCTCACGTGGCACCCCAGGACCACGGCTCCCCGGCT
GGGTACCCCCCTGTGGCTGGCTCTGCCGTGATCATGGATGCCCTGAACAGCCTCGCCACGGACTCGCCTTGTGGGATCCCCCCCAAGATG
TGGAAGACCAGCCCTGACCCCTCGCCGGTGTCTGCCGCCCCATCCAAGGCCGGCCTGCCTCGCCACATCTACCCGGCCGTGGAGTTCCTG
GGGCCCTGCGAGCAGGGCGAGAGGAGAAACTCGGCTCCAGAATCCATCCTGCTGGTTCCGCCCACTTGGCCCAAGCCGCTGGTGCCTGCC
ATTCCCATCTGCAGCATCCCAGTGACTGCATCCCTCCCTCCACTTGAGTGGCCGCTGTCCAGTCAGTCAGGCTCTTACGAGCTGCGGATC
GAGGTGCAGCCCAAGCCACATCACCGGGCCCACTATGAGACAGAAGGCAGCCGAGGGGCTGTCAAAGCTCCAACTGGAGGCCACCCTGTG
GTTCAGCTCCATGGCTACATGGAAAACAAGCCTCTGGGACTTCAGATCTTCATTGGGACAGCTGATGAGCGGATCCTTAAGCCGCACGCC
TTCTACCAGGTGCACCGAATCACGGGGAAAACTGTCACCACCACCAGCTATGAGAAGATAGTGGGCAACACCAAAGTCCTGGAGATACCC
TTGGAGCCCAAAAACAACATGAGGGCAACCATCGACTGTGCGGGGATCTTGAAGCTTAGAAACGCCGACATTGAGCTGCGGAAAGGCGAG
ACGGACATTGGAAGAAAGAACACGCGGGTGAGACTGGTTTTCCGAGTTCACATCCCAGAGTCCAGTGGCAGAATCGTCTCTTTACAGACT
GCATCTAACCCCATCGAGTGCTCCCAGCGATCTGCTCACGAGCTGCCCATGGTTGAAAGACAAGACACAGACAGCTGCCTGGTCTATGGC
GGCCAGCAAATGATCCTCACGGGGCAGAACTTTACATCCGAGTCCAAAGTTGTGTTTACTGAGAAGACCACAGATGGACAGCAAATTTGG
GAGATGGAAGCCACGGTGGATAAGGACAAGAGCCAGCCCAACATGCTTTTTGTTGAGATCCCTGAATATCGGAACAAGCATATCCGCACA
CCTGTAAAAGTGAACTTCTACGTCATCAATGGGAAGAGAAAACGAAGTCAGCCTCAGCACTTTACCTACCACCCAGTCCCAGCCATCAAG
ACGGAGCCCACGGATGAATATGACCCCACTCTGATCTGCAGCCCCACCCATGGAGGCCTGGGGAGCCAGCCTTACTACCCCCAGCACCCG
ATGGTGGCCGAGTCCCCCTCCTGCCTCGTGGCCACCATGGCTCCCTGCCAGCAGTTCCGCACGGGGCTCTCATCCCCTGACGCCCGCTAC
CAGCAACAGAACCCAGCGGCCGTACTCTACCAGCGGAGCAAGAGCCTGAGCCCCAGCCTGCTGGGCTATCAGCAGCCGGCCCTCATGGCC
GCCCCGCTGTCCCTTGCGGACGCTCACCGCTCTGTGCTGGTGCACGCCGGCTCCCAGGGCCAGAGCTCAGCCCTGCTCCACCCCTCTCCG
ACCAACCAGCAGGCCTCGCCTGTGATCCACTACTCACCCACCAACCAGCAGCTGCGCTGCGGAAGCCACCAGGAGTTCCAGCACATCATG
TACTGCGAGAATTTCGCACCAGGCACCACCAGACCTGGCCCGCCCCCGGTCAGTCAAGGTCAGAGGCTGAGCCCGGGTTCCTACCCCACA
GTCATTCAGCAGCAGAATGCCACGAGCCAAAGAGCCGCCAAAAACGGACCCCCGGTCAGTGACCAAAAGGAAGTATTACCTGCGGGGGTG
ACCATTAAACAGGAGCAGAACTTGGACCAGACCTACTTGGATGATGAGCTGATAGACACACACCTTAGCTGGATACAAAACATATTATGA

>In-frame_EWSR1_ENST00000406548_chr22_29684775_+_NFATC2_ENST00000396009_chr20_50133495_-_2592nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGAC
CACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGG
GGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGTGGAATGGGCATCCCAGTGACTGCA
TCCCTCCCTCCACTTGAGTGGCCGCTGTCCAGTCAGTCAGGCTCTTACGAGCTGCGGATCGAGGTGCAGCCCAAGCCACATCACCGGGCC
CACTATGAGACAGAAGGCAGCCGAGGGGCTGTCAAAGCTCCAACTGGAGGCCACCCTGTGGTTCAGCTCCATGGCTACATGGAAAACAAG
CCTCTGGGACTTCAGATCTTCATTGGGACAGCTGATGAGCGGATCCTTAAGCCGCACGCCTTCTACCAGGTGCACCGAATCACGGGGAAA
ACTGTCACCACCACCAGCTATGAGAAGATAGTGGGCAACACCAAAGTCCTGGAGATACCCTTGGAGCCCAAAAACAACATGAGGGCAACC
ATCGACTGTGCGGGGATCTTGAAGCTTAGAAACGCCGACATTGAGCTGCGGAAAGGCGAGACGGACATTGGAAGAAAGAACACGCGGGTG
AGACTGGTTTTCCGAGTTCACATCCCAGAGTCCAGTGGCAGAATCGTCTCTTTACAGACTGCATCTAACCCCATCGAGTGCTCCCAGCGA
TCTGCTCACGAGCTGCCCATGGTTGAAAGACAAGACACAGACAGCTGCCTGGTCTATGGCGGCCAGCAAATGATCCTCACGGGGCAGAAC
TTTACATCCGAGTCCAAAGTTGTGTTTACTGAGAAGACCACAGATGGACAGCAAATTTGGGAGATGGAAGCCACGGTGGATAAGGACAAG
AGCCAGCCCAACATGCTTTTTGTTGAGATCCCTGAATATCGGAACAAGCATATCCGCACACCTGTAAAAGTGAACTTCTACGTCATCAAT
GGGAAGAGAAAACGAAGTCAGCCTCAGCACTTTACCTACCACCCAGTCCCAGCCATCAAGACGGAGCCCACGGATGAATATGACCCCACT
CTGATCTGCAGCCCCACCCATGGAGGCCTGGGGAGCCAGCCTTACTACCCCCAGCACCCGATGGTGGCCGAGTCCCCCTCCTGCCTCGTG
GCCACCATGGCTCCCTGCCAGCAGTTCCGCACGGGGCTCTCATCCCCTGACGCCCGCTACCAGCAACAGAACCCAGCGGCCGTACTCTAC
CAGCGGAGCAAGAGCCTGAGCCCCAGCCTGCTGGGCTATCAGCAGCCGGCCCTCATGGCCGCCCCGCTGTCCCTTGCGGACGCTCACCGC
TCTGTGCTGGTGCACGCCGGCTCCCAGGGCCAGAGCTCAGCCCTGCTCCACCCCTCTCCGACCAACCAGCAGGCCTCGCCTGTGATCCAC
TACTCACCCACCAACCAGCAGCTGCGCTGCGGAAGCCACCAGGAGTTCCAGCACATCATGTACTGCGAGAATTTCGCACCAGGCACCACC
AGACCTGGCCCGCCCCCGGTCAGTCAAGGTCAGAGGCTGAGCCCGGGTTCCTACCCCACAGTCATTCAGCAGCAGAATGCCACGAGCCAA
AGAGCCGCCAAAAACGGACCCCCGGTCAGTGACCAAAAGGAAGTATTACCTGCGGGGGTGACCATTAAACAGGAGCAGAACTTGGACCAG

>In-frame_EWSR1_ENST00000406548_chr22_29684775_+_NFATC2_ENST00000609943_chr20_50133495_-_2592nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGAC
CACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGG
GGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGTGGAATGGGCATCCCAGTGACTGCA
TCCCTCCCTCCACTTGAGTGGCCGCTGTCCAGTCAGTCAGGCTCTTACGAGCTGCGGATCGAGGTGCAGCCCAAGCCACATCACCGGGCC
CACTATGAGACAGAAGGCAGCCGAGGGGCTGTCAAAGCTCCAACTGGAGGCCACCCTGTGGTTCAGCTCCATGGCTACATGGAAAACAAG
CCTCTGGGACTTCAGATCTTCATTGGGACAGCTGATGAGCGGATCCTTAAGCCGCACGCCTTCTACCAGGTGCACCGAATCACGGGGAAA
ACTGTCACCACCACCAGCTATGAGAAGATAGTGGGCAACACCAAAGTCCTGGAGATACCCTTGGAGCCCAAAAACAACATGAGGGCAACC
ATCGACTGTGCGGGGATCTTGAAGCTTAGAAACGCCGACATTGAGCTGCGGAAAGGCGAGACGGACATTGGAAGAAAGAACACGCGGGTG
AGACTGGTTTTCCGAGTTCACATCCCAGAGTCCAGTGGCAGAATCGTCTCTTTACAGACTGCATCTAACCCCATCGAGTGCTCCCAGCGA
TCTGCTCACGAGCTGCCCATGGTTGAAAGACAAGACACAGACAGCTGCCTGGTCTATGGCGGCCAGCAAATGATCCTCACGGGGCAGAAC
TTTACATCCGAGTCCAAAGTTGTGTTTACTGAGAAGACCACAGATGGACAGCAAATTTGGGAGATGGAAGCCACGGTGGATAAGGACAAG
AGCCAGCCCAACATGCTTTTTGTTGAGATCCCTGAATATCGGAACAAGCATATCCGCACACCTGTAAAAGTGAACTTCTACGTCATCAAT
GGGAAGAGAAAACGAAGTCAGCCTCAGCACTTTACCTACCACCCAGTCCCAGCCATCAAGACGGAGCCCACGGATGAATATGACCCCACT
CTGATCTGCAGCCCCACCCATGGAGGCCTGGGGAGCCAGCCTTACTACCCCCAGCACCCGATGGTGGCCGAGTCCCCCTCCTGCCTCGTG
GCCACCATGGCTCCCTGCCAGCAGTTCCGCACGGGGCTCTCATCCCCTGACGCCCGCTACCAGCAACAGAACCCAGCGGCCGTACTCTAC
CAGCGGAGCAAGAGCCTGAGCCCCAGCCTGCTGGGCTATCAGCAGCCGGCCCTCATGGCCGCCCCGCTGTCCCTTGCGGACGCTCACCGC
TCTGTGCTGGTGCACGCCGGCTCCCAGGGCCAGAGCTCAGCCCTGCTCCACCCCTCTCCGACCAACCAGCAGGCCTCGCCTGTGATCCAC
TACTCACCCACCAACCAGCAGCTGCGCTGCGGAAGCCACCAGGAGTTCCAGCACATCATGTACTGCGAGAATTTCGCACCAGGCACCACC
AGACCTGGCCCGCCCCCGGTCAGTCAAGGTCAGAGGCTGAGCCCGGGTTCCTACCCCACAGTCATTCAGCAGCAGAATGCCACGAGCCAA
AGAGCCGCCAAAAACGGACCCCCGGTCAGTGACCAAAAGGAAGTATTACCTGCGGGGGTGACCATTAAACAGGAGCAGAACTTGGACCAG

>In-frame_EWSR1_ENST00000414183_chr22_29684775_+_NFATC2_ENST00000371564_chr20_50133495_-_3978nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGTAGAAGGGACCAGTACAGGTTATACTACTCCAACTGCCCCCCAG
GCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCT
CAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAG
CCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAG
GTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGAT
CAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAG
CAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAG
AGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGGAGCATG
AGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGTGGAATG
GGAGCAGGAAGCTCGCGCCGCCGTCGCCGCCGCCGCTCAGCTTCCCCGGGCGCGTCCAGGACCCGCTGCGCCAGGCGCGCCGTCCCCGGA
CCCGGCGTGCGTCCCTACGAGGAAAGGGACCCCGCCGCTCGAGCCGCCTCCGCCAGCCCCACTGCGAGGGGTCCCAGAGCCAGCCGCGCC
CGCCCTCGCCCCCGGCCCCGCAGCCTTCCCGCCCTGCGCGCCATGAACGCCCCCGAGCGGCAGCCCCAACCCGACGGCGGGGACGCCCCA
GGCCACGAGCCTGGGGGCAGCCCCCAAGACGAGCTTGACTTCTCCATCCTCTTCGACTATGAGTATTTGAATCCGAACGAAGAAGAGCCG
AATGCACATAAGGTCGCCAGCCCACCCTCCGGACCCGCATACCCCGATGATGTCCTGGACTATGGCCTCAAGCCATACAGCCCCCTTGCT
AGTCTCTCTGGCGAGCCCCCCGGCCGATTCGGAGAGCCGGATAGGGTAGGGCCGCAGAAGTTTCTGAGCGCGGCCAAGCCAGCAGGGGCC
TCGGGCCTGAGCCCTCGGATCGAGATCACTCCGTCCCACGAACTGATCCAGGCAGTGGGGCCCCTCCGCATGAGAGACGCGGGCCTCCTG
GTGGAGCAGCCGCCCCTGGCCGGGGTGGCCGCCAGCCCGAGGTTCACCCTGCCCGTGCCCGGCTTCGAGGGCTACCGCGAGCCGCTTTGC
TTGAGCCCCGCTAGCAGCGGCTCCTCTGCCAGCTTCATTTCTGACACCTTCTCCCCCTACACCTCGCCCTGCGTCTCGCCCAATAACGGC
GGGCCCGACGACCTGTGTCCGCAGTTTCAAAACATCCCTGCTCATTATTCCCCCAGAACCTCGCCAATAATGTCACCTCGAACCAGCCTC
GCCGAGGACAGCTGCCTGGGCCGCCACTCGCCCGTGCCCCGTCCGGCCTCCCGCTCCTCATCGCCTGGTGCCAAGCGGAGGCATTCGTGC
GCCGAGGCCTTGGTTGCCCTGCCGCCCGGAGCCTCACCCCAGCGCTCCCGGAGCCCCTCGCCGCAGCCCTCATCTCACGTGGCACCCCAG
GACCACGGCTCCCCGGCTGGGTACCCCCCTGTGGCTGGCTCTGCCGTGATCATGGATGCCCTGAACAGCCTCGCCACGGACTCGCCTTGT
GGGATCCCCCCCAAGATGTGGAAGACCAGCCCTGACCCCTCGCCGGTGTCTGCCGCCCCATCCAAGGCCGGCCTGCCTCGCCACATCTAC
CCGGCCGTGGAGTTCCTGGGGCCCTGCGAGCAGGGCGAGAGGAGAAACTCGGCTCCAGAATCCATCCTGCTGGTTCCGCCCACTTGGCCC
AAGCCGCTGGTGCCTGCCATTCCCATCTGCAGCATCCCAGTGACTGCATCCCTCCCTCCACTTGAGTGGCCGCTGTCCAGTCAGTCAGGC
TCTTACGAGCTGCGGATCGAGGTGCAGCCCAAGCCACATCACCGGGCCCACTATGAGACAGAAGGCAGCCGAGGGGCTGTCAAAGCTCCA
ACTGGAGGCCACCCTGTGGTTCAGCTCCATGGCTACATGGAAAACAAGCCTCTGGGACTTCAGATCTTCATTGGGACAGCTGATGAGCGG
ATCCTTAAGCCGCACGCCTTCTACCAGGTGCACCGAATCACGGGGAAAACTGTCACCACCACCAGCTATGAGAAGATAGTGGGCAACACC
AAAGTCCTGGAGATACCCTTGGAGCCCAAAAACAACATGAGGGCAACCATCGACTGTGCGGGGATCTTGAAGCTTAGAAACGCCGACATT
GAGCTGCGGAAAGGCGAGACGGACATTGGAAGAAAGAACACGCGGGTGAGACTGGTTTTCCGAGTTCACATCCCAGAGTCCAGTGGCAGA
ATCGTCTCTTTACAGACTGCATCTAACCCCATCGAGTGCTCCCAGCGATCTGCTCACGAGCTGCCCATGGTTGAAAGACAAGACACAGAC
AGCTGCCTGGTCTATGGCGGCCAGCAAATGATCCTCACGGGGCAGAACTTTACATCCGAGTCCAAAGTTGTGTTTACTGAGAAGACCACA
GATGGACAGCAAATTTGGGAGATGGAAGCCACGGTGGATAAGGACAAGAGCCAGCCCAACATGCTTTTTGTTGAGATCCCTGAATATCGG
AACAAGCATATCCGCACACCTGTAAAAGTGAACTTCTACGTCATCAATGGGAAGAGAAAACGAAGTCAGCCTCAGCACTTTACCTACCAC
CCAGTCCCAGCCATCAAGACGGAGCCCACGGATGAATATGACCCCACTCTGATCTGCAGCCCCACCCATGGAGGCCTGGGGAGCCAGCCT
TACTACCCCCAGCACCCGATGGTGGCCGAGTCCCCCTCCTGCCTCGTGGCCACCATGGCTCCCTGCCAGCAGTTCCGCACGGGGCTCTCA
TCCCCTGACGCCCGCTACCAGCAACAGAACCCAGCGGCCGTACTCTACCAGCGGAGCAAGAGCCTGAGCCCCAGCCTGCTGGGCTATCAG
CAGCCGGCCCTCATGGCCGCCCCGCTGTCCCTTGCGGACGCTCACCGCTCTGTGCTGGTGCACGCCGGCTCCCAGGGCCAGAGCTCAGCC
CTGCTCCACCCCTCTCCGACCAACCAGCAGGCCTCGCCTGTGATCCACTACTCACCCACCAACCAGCAGCTGCGCTGCGGAAGCCACCAG
GAGTTCCAGCACATCATGTACTGCGAGAATTTCGCACCAGGCACCACCAGACCTGGCCCGCCCCCGGTCAGTCAAGGTCAGAGGCTGAGC
CCGGGTTCCTACCCCACAGTCATTCAGCAGCAGAATGCCACGAGCCAAAGAGCCGCCAAAAACGGACCCCCGGTCAGTGACCAAAAGGAA
GTATTACCTGCGGGGGTGACCATTAAACAGGAGCAGAACTTGGACCAGACCTACTTGGATGATGAGCTGATAGACACACACCTTAGCTGG

>In-frame_EWSR1_ENST00000414183_chr22_29684775_+_NFATC2_ENST00000396009_chr20_50133495_-_2610nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGTAGAAGGGACCAGTACAGGTTATACTACTCCAACTGCCCCCCAG
GCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCT
CAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAG
CCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAG
GTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGAT
CAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAG
CAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAG
AGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGGAGCATG
AGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGTGGAATG
GGCATCCCAGTGACTGCATCCCTCCCTCCACTTGAGTGGCCGCTGTCCAGTCAGTCAGGCTCTTACGAGCTGCGGATCGAGGTGCAGCCC
AAGCCACATCACCGGGCCCACTATGAGACAGAAGGCAGCCGAGGGGCTGTCAAAGCTCCAACTGGAGGCCACCCTGTGGTTCAGCTCCAT
GGCTACATGGAAAACAAGCCTCTGGGACTTCAGATCTTCATTGGGACAGCTGATGAGCGGATCCTTAAGCCGCACGCCTTCTACCAGGTG
CACCGAATCACGGGGAAAACTGTCACCACCACCAGCTATGAGAAGATAGTGGGCAACACCAAAGTCCTGGAGATACCCTTGGAGCCCAAA
AACAACATGAGGGCAACCATCGACTGTGCGGGGATCTTGAAGCTTAGAAACGCCGACATTGAGCTGCGGAAAGGCGAGACGGACATTGGA
AGAAAGAACACGCGGGTGAGACTGGTTTTCCGAGTTCACATCCCAGAGTCCAGTGGCAGAATCGTCTCTTTACAGACTGCATCTAACCCC
ATCGAGTGCTCCCAGCGATCTGCTCACGAGCTGCCCATGGTTGAAAGACAAGACACAGACAGCTGCCTGGTCTATGGCGGCCAGCAAATG
ATCCTCACGGGGCAGAACTTTACATCCGAGTCCAAAGTTGTGTTTACTGAGAAGACCACAGATGGACAGCAAATTTGGGAGATGGAAGCC
ACGGTGGATAAGGACAAGAGCCAGCCCAACATGCTTTTTGTTGAGATCCCTGAATATCGGAACAAGCATATCCGCACACCTGTAAAAGTG
AACTTCTACGTCATCAATGGGAAGAGAAAACGAAGTCAGCCTCAGCACTTTACCTACCACCCAGTCCCAGCCATCAAGACGGAGCCCACG
GATGAATATGACCCCACTCTGATCTGCAGCCCCACCCATGGAGGCCTGGGGAGCCAGCCTTACTACCCCCAGCACCCGATGGTGGCCGAG
TCCCCCTCCTGCCTCGTGGCCACCATGGCTCCCTGCCAGCAGTTCCGCACGGGGCTCTCATCCCCTGACGCCCGCTACCAGCAACAGAAC
CCAGCGGCCGTACTCTACCAGCGGAGCAAGAGCCTGAGCCCCAGCCTGCTGGGCTATCAGCAGCCGGCCCTCATGGCCGCCCCGCTGTCC
CTTGCGGACGCTCACCGCTCTGTGCTGGTGCACGCCGGCTCCCAGGGCCAGAGCTCAGCCCTGCTCCACCCCTCTCCGACCAACCAGCAG
GCCTCGCCTGTGATCCACTACTCACCCACCAACCAGCAGCTGCGCTGCGGAAGCCACCAGGAGTTCCAGCACATCATGTACTGCGAGAAT
TTCGCACCAGGCACCACCAGACCTGGCCCGCCCCCGGTCAGTCAAGGTCAGAGGCTGAGCCCGGGTTCCTACCCCACAGTCATTCAGCAG
CAGAATGCCACGAGCCAAAGAGCCGCCAAAAACGGACCCCCGGTCAGTGACCAAAAGGAAGTATTACCTGCGGGGGTGACCATTAAACAG
GAGCAGAACTTGGACCAGACCTACTTGGATGATGTTAATGAAATTATCAGGAAGGAGTTTTCAGGACCTCCTGCCAGAAATCAGACGTAA

>In-frame_EWSR1_ENST00000414183_chr22_29684775_+_NFATC2_ENST00000609943_chr20_50133495_-_2610nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGTAGAAGGGACCAGTACAGGTTATACTACTCCAACTGCCCCCCAG
GCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCT
CAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAG
CCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAG
GTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGAT
CAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAG
CAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAG
AGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGGAGCATG
AGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGTGGAATG
GGCATCCCAGTGACTGCATCCCTCCCTCCACTTGAGTGGCCGCTGTCCAGTCAGTCAGGCTCTTACGAGCTGCGGATCGAGGTGCAGCCC
AAGCCACATCACCGGGCCCACTATGAGACAGAAGGCAGCCGAGGGGCTGTCAAAGCTCCAACTGGAGGCCACCCTGTGGTTCAGCTCCAT
GGCTACATGGAAAACAAGCCTCTGGGACTTCAGATCTTCATTGGGACAGCTGATGAGCGGATCCTTAAGCCGCACGCCTTCTACCAGGTG
CACCGAATCACGGGGAAAACTGTCACCACCACCAGCTATGAGAAGATAGTGGGCAACACCAAAGTCCTGGAGATACCCTTGGAGCCCAAA
AACAACATGAGGGCAACCATCGACTGTGCGGGGATCTTGAAGCTTAGAAACGCCGACATTGAGCTGCGGAAAGGCGAGACGGACATTGGA
AGAAAGAACACGCGGGTGAGACTGGTTTTCCGAGTTCACATCCCAGAGTCCAGTGGCAGAATCGTCTCTTTACAGACTGCATCTAACCCC
ATCGAGTGCTCCCAGCGATCTGCTCACGAGCTGCCCATGGTTGAAAGACAAGACACAGACAGCTGCCTGGTCTATGGCGGCCAGCAAATG
ATCCTCACGGGGCAGAACTTTACATCCGAGTCCAAAGTTGTGTTTACTGAGAAGACCACAGATGGACAGCAAATTTGGGAGATGGAAGCC
ACGGTGGATAAGGACAAGAGCCAGCCCAACATGCTTTTTGTTGAGATCCCTGAATATCGGAACAAGCATATCCGCACACCTGTAAAAGTG
AACTTCTACGTCATCAATGGGAAGAGAAAACGAAGTCAGCCTCAGCACTTTACCTACCACCCAGTCCCAGCCATCAAGACGGAGCCCACG
GATGAATATGACCCCACTCTGATCTGCAGCCCCACCCATGGAGGCCTGGGGAGCCAGCCTTACTACCCCCAGCACCCGATGGTGGCCGAG
TCCCCCTCCTGCCTCGTGGCCACCATGGCTCCCTGCCAGCAGTTCCGCACGGGGCTCTCATCCCCTGACGCCCGCTACCAGCAACAGAAC
CCAGCGGCCGTACTCTACCAGCGGAGCAAGAGCCTGAGCCCCAGCCTGCTGGGCTATCAGCAGCCGGCCCTCATGGCCGCCCCGCTGTCC
CTTGCGGACGCTCACCGCTCTGTGCTGGTGCACGCCGGCTCCCAGGGCCAGAGCTCAGCCCTGCTCCACCCCTCTCCGACCAACCAGCAG
GCCTCGCCTGTGATCCACTACTCACCCACCAACCAGCAGCTGCGCTGCGGAAGCCACCAGGAGTTCCAGCACATCATGTACTGCGAGAAT
TTCGCACCAGGCACCACCAGACCTGGCCCGCCCCCGGTCAGTCAAGGTCAGAGGCTGAGCCCGGGTTCCTACCCCACAGTCATTCAGCAG
CAGAATGCCACGAGCCAAAGAGCCGCCAAAAACGGACCCCCGGTCAGTGACCAAAAGGAAGTATTACCTGCGGGGGTGACCATTAAACAG
GAGCAGAACTTGGACCAGACCTACTTGGATGATGTTAATGAAATTATCAGGAAGGAGTTTTCAGGACCTCCTGCCAGAAATCAGACGTAA

>In-frame_EWSR1_ENST00000333395_chr22_29684775_+_NFATC2_ENST00000371564_chr20_50133495_-_3960nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGAC
CACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGG
GGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGTGGAATGGGAGCAGGAAGCTCGCGC
CGCCGTCGCCGCCGCCGCTCAGCTTCCCCGGGCGCGTCCAGGACCCGCTGCGCCAGGCGCGCCGTCCCCGGACCCGGCGTGCGTCCCTAC
GAGGAAAGGGACCCCGCCGCTCGAGCCGCCTCCGCCAGCCCCACTGCGAGGGGTCCCAGAGCCAGCCGCGCCCGCCCTCGCCCCCGGCCC
CGCAGCCTTCCCGCCCTGCGCGCCATGAACGCCCCCGAGCGGCAGCCCCAACCCGACGGCGGGGACGCCCCAGGCCACGAGCCTGGGGGC
AGCCCCCAAGACGAGCTTGACTTCTCCATCCTCTTCGACTATGAGTATTTGAATCCGAACGAAGAAGAGCCGAATGCACATAAGGTCGCC
AGCCCACCCTCCGGACCCGCATACCCCGATGATGTCCTGGACTATGGCCTCAAGCCATACAGCCCCCTTGCTAGTCTCTCTGGCGAGCCC
CCCGGCCGATTCGGAGAGCCGGATAGGGTAGGGCCGCAGAAGTTTCTGAGCGCGGCCAAGCCAGCAGGGGCCTCGGGCCTGAGCCCTCGG
ATCGAGATCACTCCGTCCCACGAACTGATCCAGGCAGTGGGGCCCCTCCGCATGAGAGACGCGGGCCTCCTGGTGGAGCAGCCGCCCCTG
GCCGGGGTGGCCGCCAGCCCGAGGTTCACCCTGCCCGTGCCCGGCTTCGAGGGCTACCGCGAGCCGCTTTGCTTGAGCCCCGCTAGCAGC
GGCTCCTCTGCCAGCTTCATTTCTGACACCTTCTCCCCCTACACCTCGCCCTGCGTCTCGCCCAATAACGGCGGGCCCGACGACCTGTGT
CCGCAGTTTCAAAACATCCCTGCTCATTATTCCCCCAGAACCTCGCCAATAATGTCACCTCGAACCAGCCTCGCCGAGGACAGCTGCCTG
GGCCGCCACTCGCCCGTGCCCCGTCCGGCCTCCCGCTCCTCATCGCCTGGTGCCAAGCGGAGGCATTCGTGCGCCGAGGCCTTGGTTGCC
CTGCCGCCCGGAGCCTCACCCCAGCGCTCCCGGAGCCCCTCGCCGCAGCCCTCATCTCACGTGGCACCCCAGGACCACGGCTCCCCGGCT
GGGTACCCCCCTGTGGCTGGCTCTGCCGTGATCATGGATGCCCTGAACAGCCTCGCCACGGACTCGCCTTGTGGGATCCCCCCCAAGATG
TGGAAGACCAGCCCTGACCCCTCGCCGGTGTCTGCCGCCCCATCCAAGGCCGGCCTGCCTCGCCACATCTACCCGGCCGTGGAGTTCCTG
GGGCCCTGCGAGCAGGGCGAGAGGAGAAACTCGGCTCCAGAATCCATCCTGCTGGTTCCGCCCACTTGGCCCAAGCCGCTGGTGCCTGCC
ATTCCCATCTGCAGCATCCCAGTGACTGCATCCCTCCCTCCACTTGAGTGGCCGCTGTCCAGTCAGTCAGGCTCTTACGAGCTGCGGATC
GAGGTGCAGCCCAAGCCACATCACCGGGCCCACTATGAGACAGAAGGCAGCCGAGGGGCTGTCAAAGCTCCAACTGGAGGCCACCCTGTG
GTTCAGCTCCATGGCTACATGGAAAACAAGCCTCTGGGACTTCAGATCTTCATTGGGACAGCTGATGAGCGGATCCTTAAGCCGCACGCC
TTCTACCAGGTGCACCGAATCACGGGGAAAACTGTCACCACCACCAGCTATGAGAAGATAGTGGGCAACACCAAAGTCCTGGAGATACCC
TTGGAGCCCAAAAACAACATGAGGGCAACCATCGACTGTGCGGGGATCTTGAAGCTTAGAAACGCCGACATTGAGCTGCGGAAAGGCGAG
ACGGACATTGGAAGAAAGAACACGCGGGTGAGACTGGTTTTCCGAGTTCACATCCCAGAGTCCAGTGGCAGAATCGTCTCTTTACAGACT
GCATCTAACCCCATCGAGTGCTCCCAGCGATCTGCTCACGAGCTGCCCATGGTTGAAAGACAAGACACAGACAGCTGCCTGGTCTATGGC
GGCCAGCAAATGATCCTCACGGGGCAGAACTTTACATCCGAGTCCAAAGTTGTGTTTACTGAGAAGACCACAGATGGACAGCAAATTTGG
GAGATGGAAGCCACGGTGGATAAGGACAAGAGCCAGCCCAACATGCTTTTTGTTGAGATCCCTGAATATCGGAACAAGCATATCCGCACA
CCTGTAAAAGTGAACTTCTACGTCATCAATGGGAAGAGAAAACGAAGTCAGCCTCAGCACTTTACCTACCACCCAGTCCCAGCCATCAAG
ACGGAGCCCACGGATGAATATGACCCCACTCTGATCTGCAGCCCCACCCATGGAGGCCTGGGGAGCCAGCCTTACTACCCCCAGCACCCG
ATGGTGGCCGAGTCCCCCTCCTGCCTCGTGGCCACCATGGCTCCCTGCCAGCAGTTCCGCACGGGGCTCTCATCCCCTGACGCCCGCTAC
CAGCAACAGAACCCAGCGGCCGTACTCTACCAGCGGAGCAAGAGCCTGAGCCCCAGCCTGCTGGGCTATCAGCAGCCGGCCCTCATGGCC
GCCCCGCTGTCCCTTGCGGACGCTCACCGCTCTGTGCTGGTGCACGCCGGCTCCCAGGGCCAGAGCTCAGCCCTGCTCCACCCCTCTCCG
ACCAACCAGCAGGCCTCGCCTGTGATCCACTACTCACCCACCAACCAGCAGCTGCGCTGCGGAAGCCACCAGGAGTTCCAGCACATCATG
TACTGCGAGAATTTCGCACCAGGCACCACCAGACCTGGCCCGCCCCCGGTCAGTCAAGGTCAGAGGCTGAGCCCGGGTTCCTACCCCACA
GTCATTCAGCAGCAGAATGCCACGAGCCAAAGAGCCGCCAAAAACGGACCCCCGGTCAGTGACCAAAAGGAAGTATTACCTGCGGGGGTG
ACCATTAAACAGGAGCAGAACTTGGACCAGACCTACTTGGATGATGAGCTGATAGACACACACCTTAGCTGGATACAAAACATATTATGA

>In-frame_EWSR1_ENST00000333395_chr22_29684775_+_NFATC2_ENST00000396009_chr20_50133495_-_2592nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGAC
CACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGG
GGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGTGGAATGGGCATCCCAGTGACTGCA
TCCCTCCCTCCACTTGAGTGGCCGCTGTCCAGTCAGTCAGGCTCTTACGAGCTGCGGATCGAGGTGCAGCCCAAGCCACATCACCGGGCC
CACTATGAGACAGAAGGCAGCCGAGGGGCTGTCAAAGCTCCAACTGGAGGCCACCCTGTGGTTCAGCTCCATGGCTACATGGAAAACAAG
CCTCTGGGACTTCAGATCTTCATTGGGACAGCTGATGAGCGGATCCTTAAGCCGCACGCCTTCTACCAGGTGCACCGAATCACGGGGAAA
ACTGTCACCACCACCAGCTATGAGAAGATAGTGGGCAACACCAAAGTCCTGGAGATACCCTTGGAGCCCAAAAACAACATGAGGGCAACC
ATCGACTGTGCGGGGATCTTGAAGCTTAGAAACGCCGACATTGAGCTGCGGAAAGGCGAGACGGACATTGGAAGAAAGAACACGCGGGTG
AGACTGGTTTTCCGAGTTCACATCCCAGAGTCCAGTGGCAGAATCGTCTCTTTACAGACTGCATCTAACCCCATCGAGTGCTCCCAGCGA
TCTGCTCACGAGCTGCCCATGGTTGAAAGACAAGACACAGACAGCTGCCTGGTCTATGGCGGCCAGCAAATGATCCTCACGGGGCAGAAC
TTTACATCCGAGTCCAAAGTTGTGTTTACTGAGAAGACCACAGATGGACAGCAAATTTGGGAGATGGAAGCCACGGTGGATAAGGACAAG
AGCCAGCCCAACATGCTTTTTGTTGAGATCCCTGAATATCGGAACAAGCATATCCGCACACCTGTAAAAGTGAACTTCTACGTCATCAAT
GGGAAGAGAAAACGAAGTCAGCCTCAGCACTTTACCTACCACCCAGTCCCAGCCATCAAGACGGAGCCCACGGATGAATATGACCCCACT
CTGATCTGCAGCCCCACCCATGGAGGCCTGGGGAGCCAGCCTTACTACCCCCAGCACCCGATGGTGGCCGAGTCCCCCTCCTGCCTCGTG
GCCACCATGGCTCCCTGCCAGCAGTTCCGCACGGGGCTCTCATCCCCTGACGCCCGCTACCAGCAACAGAACCCAGCGGCCGTACTCTAC
CAGCGGAGCAAGAGCCTGAGCCCCAGCCTGCTGGGCTATCAGCAGCCGGCCCTCATGGCCGCCCCGCTGTCCCTTGCGGACGCTCACCGC
TCTGTGCTGGTGCACGCCGGCTCCCAGGGCCAGAGCTCAGCCCTGCTCCACCCCTCTCCGACCAACCAGCAGGCCTCGCCTGTGATCCAC
TACTCACCCACCAACCAGCAGCTGCGCTGCGGAAGCCACCAGGAGTTCCAGCACATCATGTACTGCGAGAATTTCGCACCAGGCACCACC
AGACCTGGCCCGCCCCCGGTCAGTCAAGGTCAGAGGCTGAGCCCGGGTTCCTACCCCACAGTCATTCAGCAGCAGAATGCCACGAGCCAA
AGAGCCGCCAAAAACGGACCCCCGGTCAGTGACCAAAAGGAAGTATTACCTGCGGGGGTGACCATTAAACAGGAGCAGAACTTGGACCAG

>In-frame_EWSR1_ENST00000333395_chr22_29684775_+_NFATC2_ENST00000609943_chr20_50133495_-_2592nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGAC
CACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGG
GGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGTGGAATGGGCATCCCAGTGACTGCA
TCCCTCCCTCCACTTGAGTGGCCGCTGTCCAGTCAGTCAGGCTCTTACGAGCTGCGGATCGAGGTGCAGCCCAAGCCACATCACCGGGCC
CACTATGAGACAGAAGGCAGCCGAGGGGCTGTCAAAGCTCCAACTGGAGGCCACCCTGTGGTTCAGCTCCATGGCTACATGGAAAACAAG
CCTCTGGGACTTCAGATCTTCATTGGGACAGCTGATGAGCGGATCCTTAAGCCGCACGCCTTCTACCAGGTGCACCGAATCACGGGGAAA
ACTGTCACCACCACCAGCTATGAGAAGATAGTGGGCAACACCAAAGTCCTGGAGATACCCTTGGAGCCCAAAAACAACATGAGGGCAACC
ATCGACTGTGCGGGGATCTTGAAGCTTAGAAACGCCGACATTGAGCTGCGGAAAGGCGAGACGGACATTGGAAGAAAGAACACGCGGGTG
AGACTGGTTTTCCGAGTTCACATCCCAGAGTCCAGTGGCAGAATCGTCTCTTTACAGACTGCATCTAACCCCATCGAGTGCTCCCAGCGA
TCTGCTCACGAGCTGCCCATGGTTGAAAGACAAGACACAGACAGCTGCCTGGTCTATGGCGGCCAGCAAATGATCCTCACGGGGCAGAAC
TTTACATCCGAGTCCAAAGTTGTGTTTACTGAGAAGACCACAGATGGACAGCAAATTTGGGAGATGGAAGCCACGGTGGATAAGGACAAG
AGCCAGCCCAACATGCTTTTTGTTGAGATCCCTGAATATCGGAACAAGCATATCCGCACACCTGTAAAAGTGAACTTCTACGTCATCAAT
GGGAAGAGAAAACGAAGTCAGCCTCAGCACTTTACCTACCACCCAGTCCCAGCCATCAAGACGGAGCCCACGGATGAATATGACCCCACT
CTGATCTGCAGCCCCACCCATGGAGGCCTGGGGAGCCAGCCTTACTACCCCCAGCACCCGATGGTGGCCGAGTCCCCCTCCTGCCTCGTG
GCCACCATGGCTCCCTGCCAGCAGTTCCGCACGGGGCTCTCATCCCCTGACGCCCGCTACCAGCAACAGAACCCAGCGGCCGTACTCTAC
CAGCGGAGCAAGAGCCTGAGCCCCAGCCTGCTGGGCTATCAGCAGCCGGCCCTCATGGCCGCCCCGCTGTCCCTTGCGGACGCTCACCGC
TCTGTGCTGGTGCACGCCGGCTCCCAGGGCCAGAGCTCAGCCCTGCTCCACCCCTCTCCGACCAACCAGCAGGCCTCGCCTGTGATCCAC
TACTCACCCACCAACCAGCAGCTGCGCTGCGGAAGCCACCAGGAGTTCCAGCACATCATGTACTGCGAGAATTTCGCACCAGGCACCACC
AGACCTGGCCCGCCCCCGGTCAGTCAAGGTCAGAGGCTGAGCCCGGGTTCCTACCCCACAGTCATTCAGCAGCAGAATGCCACGAGCCAA
AGAGCCGCCAAAAACGGACCCCCGGTCAGTGACCAAAAGGAAGTATTACCTGCGGGGGTGACCATTAAACAGGAGCAGAACTTGGACCAG

>In-frame_EWSR1_ENST00000332035_chr22_29684775_+_NFATC2_ENST00000371564_chr20_50133495_-_3792nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGC
AGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCT
CCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTTCA
TTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGC
CCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGTGGAATGGGAGCA
GGAAGCTCGCGCCGCCGTCGCCGCCGCCGCTCAGCTTCCCCGGGCGCGTCCAGGACCCGCTGCGCCAGGCGCGCCGTCCCCGGACCCGGC
GTGCGTCCCTACGAGGAAAGGGACCCCGCCGCTCGAGCCGCCTCCGCCAGCCCCACTGCGAGGGGTCCCAGAGCCAGCCGCGCCCGCCCT
CGCCCCCGGCCCCGCAGCCTTCCCGCCCTGCGCGCCATGAACGCCCCCGAGCGGCAGCCCCAACCCGACGGCGGGGACGCCCCAGGCCAC
GAGCCTGGGGGCAGCCCCCAAGACGAGCTTGACTTCTCCATCCTCTTCGACTATGAGTATTTGAATCCGAACGAAGAAGAGCCGAATGCA
CATAAGGTCGCCAGCCCACCCTCCGGACCCGCATACCCCGATGATGTCCTGGACTATGGCCTCAAGCCATACAGCCCCCTTGCTAGTCTC
TCTGGCGAGCCCCCCGGCCGATTCGGAGAGCCGGATAGGGTAGGGCCGCAGAAGTTTCTGAGCGCGGCCAAGCCAGCAGGGGCCTCGGGC
CTGAGCCCTCGGATCGAGATCACTCCGTCCCACGAACTGATCCAGGCAGTGGGGCCCCTCCGCATGAGAGACGCGGGCCTCCTGGTGGAG
CAGCCGCCCCTGGCCGGGGTGGCCGCCAGCCCGAGGTTCACCCTGCCCGTGCCCGGCTTCGAGGGCTACCGCGAGCCGCTTTGCTTGAGC
CCCGCTAGCAGCGGCTCCTCTGCCAGCTTCATTTCTGACACCTTCTCCCCCTACACCTCGCCCTGCGTCTCGCCCAATAACGGCGGGCCC
GACGACCTGTGTCCGCAGTTTCAAAACATCCCTGCTCATTATTCCCCCAGAACCTCGCCAATAATGTCACCTCGAACCAGCCTCGCCGAG
GACAGCTGCCTGGGCCGCCACTCGCCCGTGCCCCGTCCGGCCTCCCGCTCCTCATCGCCTGGTGCCAAGCGGAGGCATTCGTGCGCCGAG
GCCTTGGTTGCCCTGCCGCCCGGAGCCTCACCCCAGCGCTCCCGGAGCCCCTCGCCGCAGCCCTCATCTCACGTGGCACCCCAGGACCAC
GGCTCCCCGGCTGGGTACCCCCCTGTGGCTGGCTCTGCCGTGATCATGGATGCCCTGAACAGCCTCGCCACGGACTCGCCTTGTGGGATC
CCCCCCAAGATGTGGAAGACCAGCCCTGACCCCTCGCCGGTGTCTGCCGCCCCATCCAAGGCCGGCCTGCCTCGCCACATCTACCCGGCC
GTGGAGTTCCTGGGGCCCTGCGAGCAGGGCGAGAGGAGAAACTCGGCTCCAGAATCCATCCTGCTGGTTCCGCCCACTTGGCCCAAGCCG
CTGGTGCCTGCCATTCCCATCTGCAGCATCCCAGTGACTGCATCCCTCCCTCCACTTGAGTGGCCGCTGTCCAGTCAGTCAGGCTCTTAC
GAGCTGCGGATCGAGGTGCAGCCCAAGCCACATCACCGGGCCCACTATGAGACAGAAGGCAGCCGAGGGGCTGTCAAAGCTCCAACTGGA
GGCCACCCTGTGGTTCAGCTCCATGGCTACATGGAAAACAAGCCTCTGGGACTTCAGATCTTCATTGGGACAGCTGATGAGCGGATCCTT
AAGCCGCACGCCTTCTACCAGGTGCACCGAATCACGGGGAAAACTGTCACCACCACCAGCTATGAGAAGATAGTGGGCAACACCAAAGTC
CTGGAGATACCCTTGGAGCCCAAAAACAACATGAGGGCAACCATCGACTGTGCGGGGATCTTGAAGCTTAGAAACGCCGACATTGAGCTG
CGGAAAGGCGAGACGGACATTGGAAGAAAGAACACGCGGGTGAGACTGGTTTTCCGAGTTCACATCCCAGAGTCCAGTGGCAGAATCGTC
TCTTTACAGACTGCATCTAACCCCATCGAGTGCTCCCAGCGATCTGCTCACGAGCTGCCCATGGTTGAAAGACAAGACACAGACAGCTGC
CTGGTCTATGGCGGCCAGCAAATGATCCTCACGGGGCAGAACTTTACATCCGAGTCCAAAGTTGTGTTTACTGAGAAGACCACAGATGGA
CAGCAAATTTGGGAGATGGAAGCCACGGTGGATAAGGACAAGAGCCAGCCCAACATGCTTTTTGTTGAGATCCCTGAATATCGGAACAAG
CATATCCGCACACCTGTAAAAGTGAACTTCTACGTCATCAATGGGAAGAGAAAACGAAGTCAGCCTCAGCACTTTACCTACCACCCAGTC
CCAGCCATCAAGACGGAGCCCACGGATGAATATGACCCCACTCTGATCTGCAGCCCCACCCATGGAGGCCTGGGGAGCCAGCCTTACTAC
CCCCAGCACCCGATGGTGGCCGAGTCCCCCTCCTGCCTCGTGGCCACCATGGCTCCCTGCCAGCAGTTCCGCACGGGGCTCTCATCCCCT
GACGCCCGCTACCAGCAACAGAACCCAGCGGCCGTACTCTACCAGCGGAGCAAGAGCCTGAGCCCCAGCCTGCTGGGCTATCAGCAGCCG
GCCCTCATGGCCGCCCCGCTGTCCCTTGCGGACGCTCACCGCTCTGTGCTGGTGCACGCCGGCTCCCAGGGCCAGAGCTCAGCCCTGCTC
CACCCCTCTCCGACCAACCAGCAGGCCTCGCCTGTGATCCACTACTCACCCACCAACCAGCAGCTGCGCTGCGGAAGCCACCAGGAGTTC
CAGCACATCATGTACTGCGAGAATTTCGCACCAGGCACCACCAGACCTGGCCCGCCCCCGGTCAGTCAAGGTCAGAGGCTGAGCCCGGGT
TCCTACCCCACAGTCATTCAGCAGCAGAATGCCACGAGCCAAAGAGCCGCCAAAAACGGACCCCCGGTCAGTGACCAAAAGGAAGTATTA
CCTGCGGGGGTGACCATTAAACAGGAGCAGAACTTGGACCAGACCTACTTGGATGATGAGCTGATAGACACACACCTTAGCTGGATACAA

>In-frame_EWSR1_ENST00000332035_chr22_29684775_+_NFATC2_ENST00000396009_chr20_50133495_-_2424nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGC
AGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCT
CCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTTCA
TTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGC
CCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGTGGAATGGGCATC
CCAGTGACTGCATCCCTCCCTCCACTTGAGTGGCCGCTGTCCAGTCAGTCAGGCTCTTACGAGCTGCGGATCGAGGTGCAGCCCAAGCCA
CATCACCGGGCCCACTATGAGACAGAAGGCAGCCGAGGGGCTGTCAAAGCTCCAACTGGAGGCCACCCTGTGGTTCAGCTCCATGGCTAC
ATGGAAAACAAGCCTCTGGGACTTCAGATCTTCATTGGGACAGCTGATGAGCGGATCCTTAAGCCGCACGCCTTCTACCAGGTGCACCGA
ATCACGGGGAAAACTGTCACCACCACCAGCTATGAGAAGATAGTGGGCAACACCAAAGTCCTGGAGATACCCTTGGAGCCCAAAAACAAC
ATGAGGGCAACCATCGACTGTGCGGGGATCTTGAAGCTTAGAAACGCCGACATTGAGCTGCGGAAAGGCGAGACGGACATTGGAAGAAAG
AACACGCGGGTGAGACTGGTTTTCCGAGTTCACATCCCAGAGTCCAGTGGCAGAATCGTCTCTTTACAGACTGCATCTAACCCCATCGAG
TGCTCCCAGCGATCTGCTCACGAGCTGCCCATGGTTGAAAGACAAGACACAGACAGCTGCCTGGTCTATGGCGGCCAGCAAATGATCCTC
ACGGGGCAGAACTTTACATCCGAGTCCAAAGTTGTGTTTACTGAGAAGACCACAGATGGACAGCAAATTTGGGAGATGGAAGCCACGGTG
GATAAGGACAAGAGCCAGCCCAACATGCTTTTTGTTGAGATCCCTGAATATCGGAACAAGCATATCCGCACACCTGTAAAAGTGAACTTC
TACGTCATCAATGGGAAGAGAAAACGAAGTCAGCCTCAGCACTTTACCTACCACCCAGTCCCAGCCATCAAGACGGAGCCCACGGATGAA
TATGACCCCACTCTGATCTGCAGCCCCACCCATGGAGGCCTGGGGAGCCAGCCTTACTACCCCCAGCACCCGATGGTGGCCGAGTCCCCC
TCCTGCCTCGTGGCCACCATGGCTCCCTGCCAGCAGTTCCGCACGGGGCTCTCATCCCCTGACGCCCGCTACCAGCAACAGAACCCAGCG
GCCGTACTCTACCAGCGGAGCAAGAGCCTGAGCCCCAGCCTGCTGGGCTATCAGCAGCCGGCCCTCATGGCCGCCCCGCTGTCCCTTGCG
GACGCTCACCGCTCTGTGCTGGTGCACGCCGGCTCCCAGGGCCAGAGCTCAGCCCTGCTCCACCCCTCTCCGACCAACCAGCAGGCCTCG
CCTGTGATCCACTACTCACCCACCAACCAGCAGCTGCGCTGCGGAAGCCACCAGGAGTTCCAGCACATCATGTACTGCGAGAATTTCGCA
CCAGGCACCACCAGACCTGGCCCGCCCCCGGTCAGTCAAGGTCAGAGGCTGAGCCCGGGTTCCTACCCCACAGTCATTCAGCAGCAGAAT
GCCACGAGCCAAAGAGCCGCCAAAAACGGACCCCCGGTCAGTGACCAAAAGGAAGTATTACCTGCGGGGGTGACCATTAAACAGGAGCAG

>In-frame_EWSR1_ENST00000332035_chr22_29684775_+_NFATC2_ENST00000609943_chr20_50133495_-_2424nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGC
AGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCT
CCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTTCA
TTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGC
CCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGTGGAATGGGCATC
CCAGTGACTGCATCCCTCCCTCCACTTGAGTGGCCGCTGTCCAGTCAGTCAGGCTCTTACGAGCTGCGGATCGAGGTGCAGCCCAAGCCA
CATCACCGGGCCCACTATGAGACAGAAGGCAGCCGAGGGGCTGTCAAAGCTCCAACTGGAGGCCACCCTGTGGTTCAGCTCCATGGCTAC
ATGGAAAACAAGCCTCTGGGACTTCAGATCTTCATTGGGACAGCTGATGAGCGGATCCTTAAGCCGCACGCCTTCTACCAGGTGCACCGA
ATCACGGGGAAAACTGTCACCACCACCAGCTATGAGAAGATAGTGGGCAACACCAAAGTCCTGGAGATACCCTTGGAGCCCAAAAACAAC
ATGAGGGCAACCATCGACTGTGCGGGGATCTTGAAGCTTAGAAACGCCGACATTGAGCTGCGGAAAGGCGAGACGGACATTGGAAGAAAG
AACACGCGGGTGAGACTGGTTTTCCGAGTTCACATCCCAGAGTCCAGTGGCAGAATCGTCTCTTTACAGACTGCATCTAACCCCATCGAG
TGCTCCCAGCGATCTGCTCACGAGCTGCCCATGGTTGAAAGACAAGACACAGACAGCTGCCTGGTCTATGGCGGCCAGCAAATGATCCTC
ACGGGGCAGAACTTTACATCCGAGTCCAAAGTTGTGTTTACTGAGAAGACCACAGATGGACAGCAAATTTGGGAGATGGAAGCCACGGTG
GATAAGGACAAGAGCCAGCCCAACATGCTTTTTGTTGAGATCCCTGAATATCGGAACAAGCATATCCGCACACCTGTAAAAGTGAACTTC
TACGTCATCAATGGGAAGAGAAAACGAAGTCAGCCTCAGCACTTTACCTACCACCCAGTCCCAGCCATCAAGACGGAGCCCACGGATGAA
TATGACCCCACTCTGATCTGCAGCCCCACCCATGGAGGCCTGGGGAGCCAGCCTTACTACCCCCAGCACCCGATGGTGGCCGAGTCCCCC
TCCTGCCTCGTGGCCACCATGGCTCCCTGCCAGCAGTTCCGCACGGGGCTCTCATCCCCTGACGCCCGCTACCAGCAACAGAACCCAGCG
GCCGTACTCTACCAGCGGAGCAAGAGCCTGAGCCCCAGCCTGCTGGGCTATCAGCAGCCGGCCCTCATGGCCGCCCCGCTGTCCCTTGCG
GACGCTCACCGCTCTGTGCTGGTGCACGCCGGCTCCCAGGGCCAGAGCTCAGCCCTGCTCCACCCCTCTCCGACCAACCAGCAGGCCTCG
CCTGTGATCCACTACTCACCCACCAACCAGCAGCTGCGCTGCGGAAGCCACCAGGAGTTCCAGCACATCATGTACTGCGAGAATTTCGCA
CCAGGCACCACCAGACCTGGCCCGCCCCCGGTCAGTCAAGGTCAGAGGCTGAGCCCGGGTTCCTACCCCACAGTCATTCAGCAGCAGAAT
GCCACGAGCCAAAGAGCCGCCAAAAACGGACCCCCGGTCAGTGACCAAAAGGAAGTATTACCTGCGGGGGTGACCATTAAACAGGAGCAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_EWSR1_ENST00000397938_chr22_29684775_+_NFATC2_ENST00000371564_chr20_50133495_-_7438nt
GGACGGAACCATTCCAAACAGCCTAGTCTCGTGCTGAGAGCCTCTCCGGTTTCACGCTGAGACCCGCTCACCCCCGCTCTGGCCCCTTAG
ATGCTATTTTGGCCCGAGTGTCACGTCGGGCGCTCTTTAGAGAGGACTGGGACAAGAGTTGCGGACGCGAAGAACGAGTAAGCGGTGGTT
CATCCCTCCTGACCCCACCCCCGTGGCCTGGCCCGATGGTCGCGCCCGGGGTTGCGAGATTTGCGCCTGCGCAGTGCGGCGCCTAGAGGG
AAAGCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGC
GCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTA
TGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCC
CACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTAC
AGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCAC
TGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGG
ATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAG
CTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAG
TAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATA
TAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGG
ATTTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAG
AGGTGGGCGGGGAGGAGGACGCGGTGGAATGGGCATCCCAGTGACTGCATCCCTCCCTCCACTTGAGTGGCCGCTGTCCAGTCAGTCAGG
CTCTTACGAGCTGCGGATCGAGGTGCAGCCCAAGCCACATCACCGGGCCCACTATGAGACAGAAGGCAGCCGAGGGGCTGTCAAAGCTCC
AACTGGAGGCCACCCTGTGGTTCAGCTCCATGGCTACATGGAAAACAAGCCTCTGGGACTTCAGATCTTCATTGGGACAGCTGATGAGCG
GATCCTTAAGCCGCACGCCTTCTACCAGGTGCACCGAATCACGGGGAAAACTGTCACCACCACCAGCTATGAGAAGATAGTGGGCAACAC
CAAAGTCCTGGAGATACCCTTGGAGCCCAAAAACAACATGAGGGCAACCATCGACTGTGCGGGGATCTTGAAGCTTAGAAACGCCGACAT
TGAGCTGCGGAAAGGCGAGACGGACATTGGAAGAAAGAACACGCGGGTGAGACTGGTTTTCCGAGTTCACATCCCAGAGTCCAGTGGCAG
AATCGTCTCTTTACAGACTGCATCTAACCCCATCGAGTGCTCCCAGCGATCTGCTCACGAGCTGCCCATGGTTGAAAGACAAGACACAGA
CAGCTGCCTGGTCTATGGCGGCCAGCAAATGATCCTCACGGGGCAGAACTTTACATCCGAGTCCAAAGTTGTGTTTACTGAGAAGACCAC
AGATGGACAGCAAATTTGGGAGATGGAAGCCACGGTGGATAAGGACAAGAGCCAGCCCAACATGCTTTTTGTTGAGATCCCTGAATATCG
GAACAAGCATATCCGCACACCTGTAAAAGTGAACTTCTACGTCATCAATGGGAAGAGAAAACGAAGTCAGCCTCAGCACTTTACCTACCA
CCCAGTCCCAGCCATCAAGACGGAGCCCACGGATGAATATGACCCCACTCTGATCTGCAGCCCCACCCATGGAGGCCTGGGGAGCCAGCC
TTACTACCCCCAGCACCCGATGGTGGCCGAGTCCCCCTCCTGCCTCGTGGCCACCATGGCTCCCTGCCAGCAGTTCCGCACGGGGCTCTC
ATCCCCTGACGCCCGCTACCAGCAACAGAACCCAGCGGCCGTACTCTACCAGCGGAGCAAGAGCCTGAGCCCCAGCCTGCTGGGCTATCA
GCAGCCGGCCCTCATGGCCGCCCCGCTGTCCCTTGCGGACGCTCACCGCTCTGTGCTGGTGCACGCCGGCTCCCAGGGCCAGAGCTCAGC
CCTGCTCCACCCCTCTCCGACCAACCAGCAGGCCTCGCCTGTGATCCACTACTCACCCACCAACCAGCAGCTGCGCTGCGGAAGCCACCA
GGAGTTCCAGCACATCATGTACTGCGAGAATTTCGCACCAGGCACCACCAGACCTGGCCCGCCCCCGGTCAGTCAAGGTCAGAGGCTGAG
CCCGGGTTCCTACCCCACAGTCATTCAGCAGCAGAATGCCACGAGCCAAAGAGCCGCCAAAAACGGACCCCCGGTCAGTGACCAAAAGGA
AGTATTACCTGCGGGGGTGACCATTAAACAGGAGCAGAACTTGGACCAGACCTACTTGGATGATGAGCTGATAGACACACACCTTAGCTG
GATACAAAACATATTATGAAACAGAATGACTGTGATCTTTGATCCGAGAAATCAAAGTTAAAGTTAATGAAATTATCAGGAAGGAGTTTT
CAGGACCTCCTGCCAGAAATCAGACGTAAAAGAAGCCATTATAGCAAGACACCTTCTGTATCTGACCCCTCGGAGCCCTCCACAGCCCCT
CACCTTCTGTCTCCTTTCATGTTCATCTCCCAGCCCGGAGTCCACACGCGGATCAATGTATGGGCACTAAGCGGACTCTCACTTAAGGAG
CTCGCCACCTCCCTCTAAACACCAGAGAGAACTCTTCTTTTCGGTTTATGTTTTAAATCCCAGAGAGCATCCTGGTTGATCTTAATGGTG
TTCCGTCCAAATAGTAAGCACCTGCTGACCAAAAGCACATTCTACATGAGACAGGACACTGGAACTCTCCTGAGAACAGAGTGACTGGAG
CTTGGGGGGATGGACGGGGGACAGAAGATGTGGGCACTGTGATTAAACCCCAGCCCTTGCGTTCGTTTTTCCAGGTCACAGATACAGCTC
CTGTACCTTTTGAAGGCAAGGAGTTCTCAGAGCAACCAAAGGAACGTGACCCAAGAGCCCAGCTTACAGGCTGAAGAAACCCAAAACCCT
CGATAGAGACAGAAACTGAACTGTCAGTCCTTAGAGCTCGCCCAGTCCATGCCACAACTGGGCCACAGCTAAAGCTTTATTTTTGAATTC
TCATTCCAAAACCAAACTGTCTTGCCCAGACAAGATCACCTGTTAAGACTTCTTGGCGTTAAGTTATGACATGTATACGCGTTTGTTATT
ATTATTTTTTCTGCTTTAAAAGGCTGACCAGGGCACCTAGCCCTGGAGCTGTCTTGGCGAGCTGTTCTTTAACCCCTGCAGCACGCAGTC
CTGCTAACACAATTTCCATAGACTTGGGGGGCTGACCCAGGCTGCAGAGAGCAAGCACCTGTCTGCTGCAGCTGTACAACCTGGATGCTT
TGCAAGGTTCCGGCTTGCTTTCTTCCTAGCAGCCAGAGTGCTTTTCCGTAAAGCGGTGGAGAATCTCAAGCATGTGCATTTAATTGAGGA
ATAGCAGAAGGGCTAAAGCAACCAAGAAAAGAAGTGTGGGTATTTTTGTTAAGTAAAACAGCCCAAGTGCTTCTGGAGGTGGGTTTCTAC
CAAGATAGAGGAAAAGGGCTGAATTCCCTCTAAGTGGGACAGCCGAGCTCAGGATGTGCTTCCCAGCTTCACTGGTTAATTTGACCTGAA
CCTATTTAAAGATCCCTTCTGCCCCTGAAGACCTATCCGCACTCAAATTCTAACATGAAGAAATCTACTCGAATGCATCCTTTACTTTGA
ATGAGCTCTATTCGGTTGCATGTTATATGTGATTTCCTTCCTCCCAACTGTTTCCACTGAGCGCACCCAGTCTCCCCTAGTCTTCCTCTG
TGGGTGTGATTTTTGTGATTTTTACAAACAAAACCCTTGAAGTTCTTGGCAGATGTGTTTGTTTCTGTTTGCATGTACTGCAGATACCCC
AGGACAAGCGGGGGATTCATTTTTCAGCCATTCAGTTGTTTCCTCAATAATCCGCAGCAAAGTGAAAATATTCTTAGCACTCAGACTGTA
CTTAGAGTGTTTTCTCAGTCCAGTCTGTACAGTCTGTAGGCAGAAGGCCTCAGAAGAAAGTCATGGCCACTCAGTGCCCACTGTGGGCTT
TGTAAGTCCTGGCTCTCCCGTCAAGGTTACCCAGAGGTAAAAGCTTCCTGGGAGTGGGGCCAGGTGTGTTTGGCACTCCAGATAGAAGGC
AAAATGCTCAGATTCGGGCCTGTGCACTTGTATGCAACCTGTCGGTCGATACCTAGCATTTATTTTTCCCTGACAATGAACGACCTTTCC
CTCACCCACCCTAAGCTCAAAGAGTTTAGCAAAATTCTCTTTTAAATAAACAGAATGCCAGTAAGAGGTTGACCCCTACCATGGAACTTC
TGGGATGCTAAATACTTCCTCATGAACAAAATAAGTTCCTTATTATAAGTTCCTTATACTAGCAGCTTCACCTAAAGAATTTTCTCTCCA
GCAATATTGACTTCACTGGGGAAAAGCCAAGAGTGTGTGGTGAGTGATTTGTTCTCACTCGACCTGGCTAGGACTGGCTAGGAGCTGTTT
TTTGTACATGAGGGAATTTGGGCTTTCCTCAGTTATCTGAATGTTTTACCCAAGTGCCTTCCTGCTATTGTAGCAAAGTAGCTCAGCTTC
CTTGTCCACAGGGTGAAAAAGGACTAATGCATTTTCCATCAGTTTTCTAACTATGTTAGCAAAAACGGCCTCCTGGTAGCTCAACCTCCT
GTACGCGTGTGTGTGTGTAATACACACACAAATAAACCCCTCTGTTTTTCTAAGACATCTTAGCTGGATATTATAGGAAGCACTTTCATA
AACAACTGTAACAAATCGCAAAGGAAAGAGAAACAAAAGCATTAGATTTGAGACATAAACAGGCAAGAGAAAGTGTATTAGGAACTGACA
GCTATCAAGGAAGTTTTGTCAGTTACAAATGCTAGGAGGAAATTTTGCCAAGAAGGATGGCTCATGAAATATTTCCAGTACGGGAAGAGG
CAATAAGATCCTCTAAGAGAATGAGAAAGTAGGGGTGTCTAAATGGTAAAGATGGGTGTGTTGCACGTGTGTTAGAAGGATCTCAGTTGA
GTGAAGGTTTGCACTGCTACATCTAAGTTAATGTAAATATGTAGCACTCTGACAGGTCTACCGTGTTGCTGAATGTAGTATATTTCCAAA
GTTTGCAAGTCTTCCTGTATTGTACAAAGATGCTGCTGCTTGATAATATGTATAGCAATCCAGATTAGTATGTTATTAAATTTTATTTTC
TTACCTGTATTTTTATGCTTTTTACCTGTCCTCAAAATATTACACCCCTGTTGGAATTAGATTTATATTTATAAATGGTCAGAAATCTTT
TTAAGTGTCTCTTTTTACACATAGGTTGATTTTTTTTTCTTAAGAGAAATGATGTATTCTTGAAACATTTGTTACTCATTCCAGGAAACA
AAAACCCATATAATAAAACCCCCACTCAGAGCCTGTTAGTCACCTCTCTAGAAGATGGCATCTCAGGAGAAGGAATGGCTTTGTGGAAGA
AGGAATCACCTTTTTCTTGCTCAAGAATTATGCTGACTTCAGCCCTGAGCCTGGATCTGGTCACTGAGAATCATCAAGTGTCTAGATCCT
CCCCCCAAAATAACTAATTTAGTAGGTGATTTTGATTTTAAAAAATTGACACCAAAACCCTGCCTGCATTGTAATGGAATTCGAAAAGAA
TTCATGTTCACAGAACTCAACGTTCAGGCTAATATTTACAGAAGGGACCAAATCTAAATCCTGGTAGATAACTCCTGTATGCTTTATCCA
AAGGACACCCACAGTTTTCCAGCATAGATATAACCAAGGATGAATTGATTCCTTCAAAGAACTGGGAGGCACGGATATTGCATTTTTTGT
TTACATCCAGTAGCCAAGACGCCTCAGTGAGCCAGTCTTGGGCAGAGGCTGTCACATTTAGGCAGATTGGAAGTTGGTATGTTCTAATTC
TCACTCTGGACTACAGTGAGGCTGAATTTATCATGTCAAAAAAAAAAAAAAAAAAAGACCTTTCCAAGTGCTTTCTATTGCTCAGAATTG
AAAGAATGTTTTCATTTCAAGTTTACAAGAGGCATGGATGGAGTTGTGACGTTCTTGACAAGCTGGGCTAACCTTTCCCGAACTTGTTTC
CCGGAGGCAAGGTGCTCGGTGACCCAGCGCATCTTAACCTTGGGTCTCCTAGGCTCGAGGCTAGGGCATTACGTTTCGTGGAACCAAAGC
AGCCAATTGCATAGCAAGTATTTTCCTGCATTCCAATTAAATGCTTAAGAAAAAGCAGCATCCTATAAAATTGTGATCATAAACATCCAT
TTCCCTCAGCTTTTGTGAGTGCCTTGACTTACAGCCAACATCACTGTTTAACTCAGTCTGTTTAAAAACAAACTTTTCTGGTGGTTGATA
ACAGAGAGTTGCTCCCTGAGCCATCAGGGTCCTGGGAGCTGGAAGTGAAAGGGTTATTAACATTCTACCTTTATGCAGCTGTTGGCTGAC
CAGAATAAACTCCCTGCTGAGTTCAAGCTTTGAATGGAATGGATGCAAATGATGTTGTTTCCATTAGAGCAGGTGCTCACAGCATTCTGA
TTGGCCTGAGCAGACCGAGGCTATGGCTGTTGGGACAAGCTTAGCATCCTGGACATCTTGTCAAAGAACCTCACTCACCCCTCTGGCCTC
TACAGCCCTCAGAGGAGAGAAAACCAATTCTCCAACAAACAGGTCTCTCCAACATGGTGGTGCTGGCAGGCTTAGGTTTAGAAAATCCTG
ACTGTTAAAGGCGTTTGAATACATCACATTCCTATGCAAATGTTTTTAATCTCCAGTTTAATGTAGTTTATTTTTCCTATATGTAAAGTA

>In-frame_EWSR1_ENST00000397938_chr22_29684775_+_NFATC2_ENST00000396009_chr20_50133495_-_7350nt
GGACGGAACCATTCCAAACAGCCTAGTCTCGTGCTGAGAGCCTCTCCGGTTTCACGCTGAGACCCGCTCACCCCCGCTCTGGCCCCTTAG
ATGCTATTTTGGCCCGAGTGTCACGTCGGGCGCTCTTTAGAGAGGACTGGGACAAGAGTTGCGGACGCGAAGAACGAGTAAGCGGTGGTT
CATCCCTCCTGACCCCACCCCCGTGGCCTGGCCCGATGGTCGCGCCCGGGGTTGCGAGATTTGCGCCTGCGCAGTGCGGCGCCTAGAGGG
AAAGCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGC
GCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTA
TGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCC
CACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTAC
AGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCAC
TGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGG
ATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAG
CTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAG
TAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATA
TAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGG
ATTTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAG
AGGTGGGCGGGGAGGAGGACGCGGTGGAATGGGCATCCCAGTGACTGCATCCCTCCCTCCACTTGAGTGGCCGCTGTCCAGTCAGTCAGG
CTCTTACGAGCTGCGGATCGAGGTGCAGCCCAAGCCACATCACCGGGCCCACTATGAGACAGAAGGCAGCCGAGGGGCTGTCAAAGCTCC
AACTGGAGGCCACCCTGTGGTTCAGCTCCATGGCTACATGGAAAACAAGCCTCTGGGACTTCAGATCTTCATTGGGACAGCTGATGAGCG
GATCCTTAAGCCGCACGCCTTCTACCAGGTGCACCGAATCACGGGGAAAACTGTCACCACCACCAGCTATGAGAAGATAGTGGGCAACAC
CAAAGTCCTGGAGATACCCTTGGAGCCCAAAAACAACATGAGGGCAACCATCGACTGTGCGGGGATCTTGAAGCTTAGAAACGCCGACAT
TGAGCTGCGGAAAGGCGAGACGGACATTGGAAGAAAGAACACGCGGGTGAGACTGGTTTTCCGAGTTCACATCCCAGAGTCCAGTGGCAG
AATCGTCTCTTTACAGACTGCATCTAACCCCATCGAGTGCTCCCAGCGATCTGCTCACGAGCTGCCCATGGTTGAAAGACAAGACACAGA
CAGCTGCCTGGTCTATGGCGGCCAGCAAATGATCCTCACGGGGCAGAACTTTACATCCGAGTCCAAAGTTGTGTTTACTGAGAAGACCAC
AGATGGACAGCAAATTTGGGAGATGGAAGCCACGGTGGATAAGGACAAGAGCCAGCCCAACATGCTTTTTGTTGAGATCCCTGAATATCG
GAACAAGCATATCCGCACACCTGTAAAAGTGAACTTCTACGTCATCAATGGGAAGAGAAAACGAAGTCAGCCTCAGCACTTTACCTACCA
CCCAGTCCCAGCCATCAAGACGGAGCCCACGGATGAATATGACCCCACTCTGATCTGCAGCCCCACCCATGGAGGCCTGGGGAGCCAGCC
TTACTACCCCCAGCACCCGATGGTGGCCGAGTCCCCCTCCTGCCTCGTGGCCACCATGGCTCCCTGCCAGCAGTTCCGCACGGGGCTCTC
ATCCCCTGACGCCCGCTACCAGCAACAGAACCCAGCGGCCGTACTCTACCAGCGGAGCAAGAGCCTGAGCCCCAGCCTGCTGGGCTATCA
GCAGCCGGCCCTCATGGCCGCCCCGCTGTCCCTTGCGGACGCTCACCGCTCTGTGCTGGTGCACGCCGGCTCCCAGGGCCAGAGCTCAGC
CCTGCTCCACCCCTCTCCGACCAACCAGCAGGCCTCGCCTGTGATCCACTACTCACCCACCAACCAGCAGCTGCGCTGCGGAAGCCACCA
GGAGTTCCAGCACATCATGTACTGCGAGAATTTCGCACCAGGCACCACCAGACCTGGCCCGCCCCCGGTCAGTCAAGGTCAGAGGCTGAG
CCCGGGTTCCTACCCCACAGTCATTCAGCAGCAGAATGCCACGAGCCAAAGAGCCGCCAAAAACGGACCCCCGGTCAGTGACCAAAAGGA
AGTATTACCTGCGGGGGTGACCATTAAACAGGAGCAGAACTTGGACCAGACCTACTTGGATGATGTTAATGAAATTATCAGGAAGGAGTT
TTCAGGACCTCCTGCCAGAAATCAGACGTAAAAGAAGCCATTATAGCAAGACACCTTCTGTATCTGACCCCTCGGAGCCCTCCACAGCCC
CTCACCTTCTGTCTCCTTTCATGTTCATCTCCCAGCCCGGAGTCCACACGCGGATCAATGTATGGGCACTAAGCGGACTCTCACTTAAGG
AGCTCGCCACCTCCCTCTAAACACCAGAGAGAACTCTTCTTTTCGGTTTATGTTTTAAATCCCAGAGAGCATCCTGGTTGATCTTAATGG
TGTTCCGTCCAAATAGTAAGCACCTGCTGACCAAAAGCACATTCTACATGAGACAGGACACTGGAACTCTCCTGAGAACAGAGTGACTGG
AGCTTGGGGGGATGGACGGGGGACAGAAGATGTGGGCACTGTGATTAAACCCCAGCCCTTGCGTTCGTTTTTCCAGGTCACAGATACAGC
TCCTGTACCTTTTGAAGGCAAGGAGTTCTCAGAGCAACCAAAGGAACGTGACCCAAGAGCCCAGCTTACAGGCTGAAGAAACCCAAAACC
CTCGATAGAGACAGAAACTGAACTGTCAGTCCTTAGAGCTCGCCCAGTCCATGCCACAACTGGGCCACAGCTAAAGCTTTATTTTTGAAT
TCTCATTCCAAAACCAAACTGTCTTGCCCAGACAAGATCACCTGTTAAGACTTCTTGGCGTTAAGTTATGACATGTATACGCGTTTGTTA
TTATTATTTTTTCTGCTTTAAAAGGCTGACCAGGGCACCTAGCCCTGGAGCTGTCTTGGCGAGCTGTTCTTTAACCCCTGCAGCACGCAG
TCCTGCTAACACAATTTCCATAGACTTGGGGGGCTGACCCAGGCTGCAGAGAGCAAGCACCTGTCTGCTGCAGCTGTACAACCTGGATGC
TTTGCAAGGTTCCGGCTTGCTTTCTTCCTAGCAGCCAGAGTGCTTTTCCGTAAAGCGGTGGAGAATCTCAAGCATGTGCATTTAATTGAG
GAATAGCAGAAGGGCTAAAGCAACCAAGAAAAGAAGTGTGGGTATTTTTGTTAAGTAAAACAGCCCAAGTGCTTCTGGAGGTGGGTTTCT
ACCAAGATAGAGGAAAAGGGCTGAATTCCCTCTAAGTGGGACAGCCGAGCTCAGGATGTGCTTCCCAGCTTCACTGGTTAATTTGACCTG
AACCTATTTAAAGATCCCTTCTGCCCCTGAAGACCTATCCGCACTCAAATTCTAACATGAAGAAATCTACTCGAATGCATCCTTTACTTT
GAATGAGCTCTATTCGGTTGCATGTTATATGTGATTTCCTTCCTCCCAACTGTTTCCACTGAGCGCACCCAGTCTCCCCTAGTCTTCCTC
TGTGGGTGTGATTTTTGTGATTTTTACAAACAAAACCCTTGAAGTTCTTGGCAGATGTGTTTGTTTCTGTTTGCATGTACTGCAGATACC
CCAGGACAAGCGGGGGATTCATTTTTCAGCCATTCAGTTGTTTCCTCAATAATCCGCAGCAAAGTGAAAATATTCTTAGCACTCAGACTG
TACTTAGAGTGTTTTCTCAGTCCAGTCTGTACAGTCTGTAGGCAGAAGGCCTCAGAAGAAAGTCATGGCCACTCAGTGCCCACTGTGGGC
TTTGTAAGTCCTGGCTCTCCCGTCAAGGTTACCCAGAGGTAAAAGCTTCCTGGGAGTGGGGCCAGGTGTGTTTGGCACTCCAGATAGAAG
GCAAAATGCTCAGATTCGGGCCTGTGCACTTGTATGCAACCTGTCGGTCGATACCTAGCATTTATTTTTCCCTGACAATGAACGACCTTT
CCCTCACCCACCCTAAGCTCAAAGAGTTTAGCAAAATTCTCTTTTAAATAAACAGAATGCCAGTAAGAGGTTGACCCCTACCATGGAACT
TCTGGGATGCTAAATACTTCCTCATGAACAAAATAAGTTCCTTATTATAAGTTCCTTATACTAGCAGCTTCACCTAAAGAATTTTCTCTC
CAGCAATATTGACTTCACTGGGGAAAAGCCAAGAGTGTGTGGTGAGTGATTTGTTCTCACTCGACCTGGCTAGGACTGGCTAGGAGCTGT
TTTTTGTACATGAGGGAATTTGGGCTTTCCTCAGTTATCTGAATGTTTTACCCAAGTGCCTTCCTGCTATTGTAGCAAAGTAGCTCAGCT
TCCTTGTCCACAGGGTGAAAAAGGACTAATGCATTTTCCATCAGTTTTCTAACTATGTTAGCAAAAACGGCCTCCTGGTAGCTCAACCTC
CTGTACGCGTGTGTGTGTGTAATACACACACAAATAAACCCCTCTGTTTTTCTAAGACATCTTAGCTGGATATTATAGGAAGCACTTTCA
TAAACAACTGTAACAAATCGCAAAGGAAAGAGAAACAAAAGCATTAGATTTGAGACATAAACAGGCAAGAGAAAGTGTATTAGGAACTGA
CAGCTATCAAGGAAGTTTTGTCAGTTACAAATGCTAGGAGGAAATTTTGCCAAGAAGGATGGCTCATGAAATATTTCCAGTACGGGAAGA
GGCAATAAGATCCTCTAAGAGAATGAGAAAGTAGGGGTGTCTAAATGGTAAAGATGGGTGTGTTGCACGTGTGTTAGAAGGATCTCAGTT
GAGTGAAGGTTTGCACTGCTACATCTAAGTTAATGTAAATATGTAGCACTCTGACAGGTCTACCGTGTTGCTGAATGTAGTATATTTCCA
AAGTTTGCAAGTCTTCCTGTATTGTACAAAGATGCTGCTGCTTGATAATATGTATAGCAATCCAGATTAGTATGTTATTAAATTTTATTT
TCTTACCTGTATTTTTATGCTTTTTACCTGTCCTCAAAATATTACACCCCTGTTGGAATTAGATTTATATTTATAAATGGTCAGAAATCT
TTTTAAGTGTCTCTTTTTACACATAGGTTGATTTTTTTTTCTTAAGAGAAATGATGTATTCTTGAAACATTTGTTACTCATTCCAGGAAA
CAAAAACCCATATAATAAAACCCCCACTCAGAGCCTGTTAGTCACCTCTCTAGAAGATGGCATCTCAGGAGAAGGAATGGCTTTGTGGAA
GAAGGAATCACCTTTTTCTTGCTCAAGAATTATGCTGACTTCAGCCCTGAGCCTGGATCTGGTCACTGAGAATCATCAAGTGTCTAGATC
CTCCCCCCAAAATAACTAATTTAGTAGGTGATTTTGATTTTAAAAAATTGACACCAAAACCCTGCCTGCATTGTAATGGAATTCGAAAAG
AATTCATGTTCACAGAACTCAACGTTCAGGCTAATATTTACAGAAGGGACCAAATCTAAATCCTGGTAGATAACTCCTGTATGCTTTATC
CAAAGGACACCCACAGTTTTCCAGCATAGATATAACCAAGGATGAATTGATTCCTTCAAAGAACTGGGAGGCACGGATATTGCATTTTTT
GTTTACATCCAGTAGCCAAGACGCCTCAGTGAGCCAGTCTTGGGCAGAGGCTGTCACATTTAGGCAGATTGGAAGTTGGTATGTTCTAAT
TCTCACTCTGGACTACAGTGAGGCTGAATTTATCATGTCAAAAAAAAAAAAAAAAAAAGACCTTTCCAAGTGCTTTCTATTGCTCAGAAT
TGAAAGAATGTTTTCATTTCAAGTTTACAAGAGGCATGGATGGAGTTGTGACGTTCTTGACAAGCTGGGCTAACCTTTCCCGAACTTGTT
TCCCGGAGGCAAGGTGCTCGGTGACCCAGCGCATCTTAACCTTGGGTCTCCTAGGCTCGAGGCTAGGGCATTACGTTTCGTGGAACCAAA
GCAGCCAATTGCATAGCAAGTATTTTCCTGCATTCCAATTAAATGCTTAAGAAAAAGCAGCATCCTATAAAATTGTGATCATAAACATCC
ATTTCCCTCAGCTTTTGTGAGTGCCTTGACTTACAGCCAACATCACTGTTTAACTCAGTCTGTTTAAAAACAAACTTTTCTGGTGGTTGA
TAACAGAGAGTTGCTCCCTGAGCCATCAGGGTCCTGGGAGCTGGAAGTGAAAGGGTTATTAACATTCTACCTTTATGCAGCTGTTGGCTG
ACCAGAATAAACTCCCTGCTGAGTTCAAGCTTTGAATGGAATGGATGCAAATGATGTTGTTTCCATTAGAGCAGGTGCTCACAGCATTCT
GATTGGCCTGAGCAGACCGAGGCTATGGCTGTTGGGACAAGCTTAGCATCCTGGACATCTTGTCAAAGAACCTCACTCACCCCTCTGGCC
TCTACAGCCCTCAGAGGAGAGAAAACCAATTCTCCAACAAACAGGTCTCTCCAACATGGTGGTGCTGGCAGGCTTAGGTTTAGAAAATCC
TGACTGTTAAAGGCGTTTGAATACATCACATTCCTATGCAAATGTTTTTAATCTCCAGTTTAATGTAGTTTATTTTTCCTATATGTAAAG

>In-frame_EWSR1_ENST00000397938_chr22_29684775_+_NFATC2_ENST00000609943_chr20_50133495_-_5681nt
GGACGGAACCATTCCAAACAGCCTAGTCTCGTGCTGAGAGCCTCTCCGGTTTCACGCTGAGACCCGCTCACCCCCGCTCTGGCCCCTTAG
ATGCTATTTTGGCCCGAGTGTCACGTCGGGCGCTCTTTAGAGAGGACTGGGACAAGAGTTGCGGACGCGAAGAACGAGTAAGCGGTGGTT
CATCCCTCCTGACCCCACCCCCGTGGCCTGGCCCGATGGTCGCGCCCGGGGTTGCGAGATTTGCGCCTGCGCAGTGCGGCGCCTAGAGGG
AAAGCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGC
GCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTA
TGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCC
CACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTAC
AGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCAC
TGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGG
ATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAG
CTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAG
TAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATA
TAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGG
ATTTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAG
AGGTGGGCGGGGAGGAGGACGCGGTGGAATGGGCATCCCAGTGACTGCATCCCTCCCTCCACTTGAGTGGCCGCTGTCCAGTCAGTCAGG
CTCTTACGAGCTGCGGATCGAGGTGCAGCCCAAGCCACATCACCGGGCCCACTATGAGACAGAAGGCAGCCGAGGGGCTGTCAAAGCTCC
AACTGGAGGCCACCCTGTGGTTCAGCTCCATGGCTACATGGAAAACAAGCCTCTGGGACTTCAGATCTTCATTGGGACAGCTGATGAGCG
GATCCTTAAGCCGCACGCCTTCTACCAGGTGCACCGAATCACGGGGAAAACTGTCACCACCACCAGCTATGAGAAGATAGTGGGCAACAC
CAAAGTCCTGGAGATACCCTTGGAGCCCAAAAACAACATGAGGGCAACCATCGACTGTGCGGGGATCTTGAAGCTTAGAAACGCCGACAT
TGAGCTGCGGAAAGGCGAGACGGACATTGGAAGAAAGAACACGCGGGTGAGACTGGTTTTCCGAGTTCACATCCCAGAGTCCAGTGGCAG
AATCGTCTCTTTACAGACTGCATCTAACCCCATCGAGTGCTCCCAGCGATCTGCTCACGAGCTGCCCATGGTTGAAAGACAAGACACAGA
CAGCTGCCTGGTCTATGGCGGCCAGCAAATGATCCTCACGGGGCAGAACTTTACATCCGAGTCCAAAGTTGTGTTTACTGAGAAGACCAC
AGATGGACAGCAAATTTGGGAGATGGAAGCCACGGTGGATAAGGACAAGAGCCAGCCCAACATGCTTTTTGTTGAGATCCCTGAATATCG
GAACAAGCATATCCGCACACCTGTAAAAGTGAACTTCTACGTCATCAATGGGAAGAGAAAACGAAGTCAGCCTCAGCACTTTACCTACCA
CCCAGTCCCAGCCATCAAGACGGAGCCCACGGATGAATATGACCCCACTCTGATCTGCAGCCCCACCCATGGAGGCCTGGGGAGCCAGCC
TTACTACCCCCAGCACCCGATGGTGGCCGAGTCCCCCTCCTGCCTCGTGGCCACCATGGCTCCCTGCCAGCAGTTCCGCACGGGGCTCTC
ATCCCCTGACGCCCGCTACCAGCAACAGAACCCAGCGGCCGTACTCTACCAGCGGAGCAAGAGCCTGAGCCCCAGCCTGCTGGGCTATCA
GCAGCCGGCCCTCATGGCCGCCCCGCTGTCCCTTGCGGACGCTCACCGCTCTGTGCTGGTGCACGCCGGCTCCCAGGGCCAGAGCTCAGC
CCTGCTCCACCCCTCTCCGACCAACCAGCAGGCCTCGCCTGTGATCCACTACTCACCCACCAACCAGCAGCTGCGCTGCGGAAGCCACCA
GGAGTTCCAGCACATCATGTACTGCGAGAATTTCGCACCAGGCACCACCAGACCTGGCCCGCCCCCGGTCAGTCAAGGTCAGAGGCTGAG
CCCGGGTTCCTACCCCACAGTCATTCAGCAGCAGAATGCCACGAGCCAAAGAGCCGCCAAAAACGGACCCCCGGTCAGTGACCAAAAGGA
AGTATTACCTGCGGGGGTGACCATTAAACAGGAGCAGAACTTGGACCAGACCTACTTGGATGATGTTAATGAAATTATCAGGAAGGAGTT
TTCAGGACCTCCTGCCAGAAATCAGACGTAAAAGAAGCCATTATAGCAAGACACCTTCTGTATCTGACCCCTCGGAGCCCTCCACAGCCC
CTCACCTTCTGTCTCCTTTCATGTTCATCTCCCAGCCCGGAGTCCACACGCGGATCAATGTATGGGCACTAAGCGGACTCTCACTTAAGG
AGCTCGCCACCTCCCTCTAAACACCAGAGAGAACTCTTCTTTTCGGTTTATGTTTTAAATCCCAGAGAGCATCCTGGTTGATCTTAATGG
TGTTCCGTCCAAATAGTAAGCACCTGCTGACCAAAAGCACATTCTACATGAGACAGGACACTGGAACTCTCCTGAGAACAGAGTGACTGG
AGCTTGGGGGGATGGACGGGGGACAGAAGATGTGGGCACTGTGATTAAACCCCAGCCCTTGCGTTCGTTTTTCCAGGTCACAGATACAGC
TCCTGTACCTTTTGAAGGCAAGGAGTTCTCAGAGCAACCAAAGGAACGTGACCCAAGAGCCCAGCTTACAGGCTGAAGAAACCCAAAACC
CTCGATAGAGACAGAAACTGAACTGTCAGTCCTTAGAGCTCGCCCAGTCCATGCCACAACTGGGCCACAGCTAAAGCTTTATTTTTGAAT
TCTCATTCCAAAACCAAACTGTCTTGCCCAGACAAGATCACCTGTTAAGACTTCTTGGCGTTAAGTTATGACATGTATACGCGTTTGTTA
TTATTATTTTTTCTGCTTTAAAAGGCTGACCAGGGCACCTAGCCCTGGAGCTGTCTTGGCGAGCTGTTCTTTAACCCCTGCAGCACGCAG
TCCTGCTAACACAATTTCCATAGACTTGGGGGGCTGACCCAGGCTGCAGAGAGCAAGCACCTGTCTGCTGCAGCTGTACAACCTGGATGC
TTTGCAAGGTTCCGGCTTGCTTTCTTCCTAGCAGCCAGAGTGCTTTTCCGTAAAGCGGTGGAGAATCTCAAGCATGTGCATTTAATTGAG
GAATAGCAGAAGGGCTAAAGCAACCAAGAAAAGAAGTGTGGGTATTTTTGTTAAGTAAAACAGCCCAAGTGCTTCTGGAGGTGGGTTTCT
ACCAAGATAGAGGAAAAGGGCTGAATTCCCTCTAAGTGGGACAGCCGAGCTCAGGATGTGCTTCCCAGCTTCACTGGTTAATTTGACCTG
AACCTATTTAAAGATCCCTTCTGCCCCTGAAGACCTATCCGCACTCAAATTCTAACATGAAGAAATCTACTCGAATGCATCCTTTACTTT
GAATGAGCTCTATTCGGTTGCATGTTATATGTGATTTCCTTCCTCCCAACTGTTTCCACTGAGCGCACCCAGTCTCCCCTAGTCTTCCTC
TGTGGGTGTGATTTTTGTGATTTTTACAAACAAAACCCTTGAAGTTCTTGGCAGATGTGTTTGTTTCTGTTTGCATGTACTGCAGATACC
CCAGGACAAGCGGGGGATTCATTTTTCAGCCATTCAGTTGTTTCCTCAATAATCCGCAGCAAAGTGAAAATATTCTTAGCACTCAGACTG
TACTTAGAGTGTTTTCTCAGTCCAGTCTGTACAGTCTGTAGGCAGAAGGCCTCAGAAGAAAGTCATGGCCACTCAGTGCCCACTGTGGGC
TTTGTAAGTCCTGGCTCTCCCGTCAAGGTTACCCAGAGGTAAAAGCTTCCTGGGAGTGGGGCCAGGTGTGTTTGGCACTCCAGATAGAAG
GCAAAATGCTCAGATTCGGGCCTGTGCACTTGTATGCAACCTGTCGGTCGATACCTAGCATTTATTTTTCCCTGACAATGAACGACCTTT
CCCTCACCCACCCTAAGCTCAAAGAGTTTAGCAAAATTCTCTTTTAAATAAACAGAATGCCAGTAAGAGGTTGACCCCTACCATGGAACT
TCTGGGATGCTAAATACTTCCTCATGAACAAAATAAGTTCCTTATTATAAGTTCCTTATACTAGCAGCTTCACCTAAAGAATTTTCTCTC
CAGCAATATTGACTTCACTGGGGAAAAGCCAAGAGTGTGTGGTGAGTGATTTGTTCTCACTCGACCTGGCTAGGACTGGCTAGGAGCTGT
TTTTTGTACATGAGGGAATTTGGGCTTTCCTCAGTTATCTGAATGTTTTACCCAAGTGCCTTCCTGCTATTGTAGCAAAGTAGCTCAGCT
TCCTTGTCCACAGGGTGAAAAAGGACTAATGCATTTTCCATCAGTTTTCTAACTATGTTAGCAAAAACGGCCTCCTGGTAGCTCAACCTC
CTGTACGCGTGTGTGTGTGTAATACACACACAAATAAACCCCTCTGTTTTTCTAAGACATCTTAGCTGGATATTATAGGAAGCACTTTCA
TAAACAACTGTAACAAATCGCAAAGGAAAGAGAAACAAAAGCATTAGATTTGAGACATAAACAGGCAAGAGAAAGTGTATTAGGAACTGA
CAGCTATCAAGGAAGTTTTGTCAGTTACAAATGCTAGGAGGAAATTTTGCCAAGAAGGATGGCTCATGAAATATTTCCAGTACGGGAAGA
GGCAATAAGATCCTCTAAGAGAATGAGAAAGTAGGGGTGTCTAAATGGTAAAGATGGGTGTGTTGCACGTGTGTTAGAAGGATCTCAGTT
GAGTGAAGGTTTGCACTGCTACATCTAAGTTAATGTAAATATGTAGCACTCTGACAGGTCTACCGTGTTGCTGAATGTAGTATATTTCCA
AAGTTTGCAAGTCTTCCTGTATTGTACAAAGATGCTGCTGCTTGATAATATGTATAGCAATCCAGATTAGTATGTTATTAAATTTTATTT

>In-frame_EWSR1_ENST00000397938_chr22_29684775_+_NFATC2_ENST00000610033_chr20_50133495_-_3167nt
GGACGGAACCATTCCAAACAGCCTAGTCTCGTGCTGAGAGCCTCTCCGGTTTCACGCTGAGACCCGCTCACCCCCGCTCTGGCCCCTTAG
ATGCTATTTTGGCCCGAGTGTCACGTCGGGCGCTCTTTAGAGAGGACTGGGACAAGAGTTGCGGACGCGAAGAACGAGTAAGCGGTGGTT
CATCCCTCCTGACCCCACCCCCGTGGCCTGGCCCGATGGTCGCGCCCGGGGTTGCGAGATTTGCGCCTGCGCAGTGCGGCGCCTAGAGGG
AAAGCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGC
GCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTA
TGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCC
CACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTAC
AGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCAC
TGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGG
ATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAG
CTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAG
TAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATA
TAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGG
ATTTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAG
AGGTGGGCGGGGAGGAGGACGCGGTGGAATGGGCATCCCAGTGACTGCATCCCTCCCTCCACTTGAGTGGCCGCTGTCCAGTCAGTCAGG
CTCTTACGAGCTGCGGATCGAGGTGCAGCCCAAGCCACATCACCGGGCCCACTATGAGACAGAAGGCAGCCGAGGGGCTGTCAAAGCTCC
AACTGGAGGCCACCCTGTGGTTCAGCTCCATGGCTACATGGAAAACAAGCCTCTGGGACTTCAGATCTTCATTGGGACAGCTGATGAGCG
GATCCTTAAGCCGCACGCCTTCTACCAGGTGCACCGAATCACGGGGAAAACTGTCACCACCACCAGCTATGAGAAGATAGTGGGCAACAC
CAAAGTCCTGGAGATACCCTTGGAGCCCAAAAACAACATGAGGGCAACCATCGACTGTGCGGGGATCTTGAAGCTTAGAAACGCCGACAT
TGAGCTGCGGAAAGGCGAGACGGACATTGGAAGAAAGAACACGCGGGTGAGACTGGTTTTCCGAGTTCACATCCCAGAGTCCAGTGGCAG
AATCGTCTCTTTACAGACTGCATCTAACCCCATCGAGTGCTCCCAGCGATCTGCTCACGAGCTGCCCATGGTTGAAAGACAAGACACAGA
CAGCTGCCTGGTCTATGGCGGCCAGCAAATGATCCTCACGGGGCAGAACTTTACATCCGAGTCCAAAGTTGTGTTTACTGAGAAGACCAC
AGATGGACAGCAAATTTGGGAGATGGAAGCCACGGTGGATAAGGACAAGAGCCAGCCCAACATGCTTTTTGTTGAGATCCCTGAATATCG
GAACAAGCATATCCGCACACCTGTAAAAGTGAACTTCTACGTCATCAATGGGAAGAGAAAACGAAGTCAGCCTCAGCACTTTACCTACCA
CCCAGTCCCAGCCATCAAGACGGAGCCCACGGATGAATATGACCCCACTCTGATCTGCAGCCCCACCCATGGAGGCCTGGGGAGCCAGCC
TTACTACCCCCAGCACCCGATGGTGGCCGAGTCCCCCTCCTGCCTCGTGGCCACCATGGCTCCCTGCCAGCAGTTCCGCACGGGGCTCTC
ATCCCCTGACGCCCGCTACCAGCAACAGAACCCAGCGGCCGTACTCTACCAGCGGAGCAAGAGCCTGAGCCCCAGCCTGCTGGGCTATCA
GCAGCCGGCCCTCATGGCCGCCCCGCTGTCCCTTGCGGACGCTCACCGCTCTGTGCTGGTGCACGCCGGCTCCCAGGGCCAGAGCTCAGC
CCTGCTCCACCCCTCTCCGACCAACCAGCAGGCCTCGCCTGTGATCCACTACTCACCCACCAACCAGCAGCTGCGCTGCGGAAGCCACCA
GGAGTTCCAGCACATCATGTACTGCGAGAATTTCGCACCAGGCACCACCAGACCTGGCCCGCCCCCGGTCAGTCAAGGTCAGAGGCTGAG
CCCGGGTTCCTACCCCACAGTCATTCAGCAGCAGAATGCCACGAGCCAAAGAGCCGCCAAAAACGGACCCCCGGTCAGTGACCAAAAGGA
AGTATTACCTGCGGGGGTGACCATTAAACAGGAGCAGAACTTGGACCAGACCTACTTGGATGATGAGCTGATAGACACACACCTTAGCTG
GATACAAAACATATTATGAAACAGAATGACTGTGATCTTTGATCCGAGAAATCAAAGTTAAAGTTAATGAAATTATCAGGAAGGAGTTTT
CAGGACCTCCTGCCAGAAATCAGACGTAAAAGAAGCCATTATAGCAAGACACCTTCTGTATCTGACCCCTCGGAGCCCTCCACAGCCCCT
CACCTTCTGTCTCCTTTCATGTTCATCTCCCAGCCCGGAGTCCACACGCGGATCAATGTATGGGCACTAAGCGGACTCTCACTTAAGGAG

>In-frame_EWSR1_ENST00000397938_chr22_29684775_+_NFATC2_ENST00000414705_chr20_50133495_-_3167nt
GGACGGAACCATTCCAAACAGCCTAGTCTCGTGCTGAGAGCCTCTCCGGTTTCACGCTGAGACCCGCTCACCCCCGCTCTGGCCCCTTAG
ATGCTATTTTGGCCCGAGTGTCACGTCGGGCGCTCTTTAGAGAGGACTGGGACAAGAGTTGCGGACGCGAAGAACGAGTAAGCGGTGGTT
CATCCCTCCTGACCCCACCCCCGTGGCCTGGCCCGATGGTCGCGCCCGGGGTTGCGAGATTTGCGCCTGCGCAGTGCGGCGCCTAGAGGG
AAAGCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGC
GCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTA
TGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCC
CACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTAC
AGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCAC
TGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGG
ATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAG
CTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAG
TAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATA
TAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGG
ATTTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAG
AGGTGGGCGGGGAGGAGGACGCGGTGGAATGGGCATCCCAGTGACTGCATCCCTCCCTCCACTTGAGTGGCCGCTGTCCAGTCAGTCAGG
CTCTTACGAGCTGCGGATCGAGGTGCAGCCCAAGCCACATCACCGGGCCCACTATGAGACAGAAGGCAGCCGAGGGGCTGTCAAAGCTCC
AACTGGAGGCCACCCTGTGGTTCAGCTCCATGGCTACATGGAAAACAAGCCTCTGGGACTTCAGATCTTCATTGGGACAGCTGATGAGCG
GATCCTTAAGCCGCACGCCTTCTACCAGGTGCACCGAATCACGGGGAAAACTGTCACCACCACCAGCTATGAGAAGATAGTGGGCAACAC
CAAAGTCCTGGAGATACCCTTGGAGCCCAAAAACAACATGAGGGCAACCATCGACTGTGCGGGGATCTTGAAGCTTAGAAACGCCGACAT
TGAGCTGCGGAAAGGCGAGACGGACATTGGAAGAAAGAACACGCGGGTGAGACTGGTTTTCCGAGTTCACATCCCAGAGTCCAGTGGCAG
AATCGTCTCTTTACAGACTGCATCTAACCCCATCGAGTGCTCCCAGCGATCTGCTCACGAGCTGCCCATGGTTGAAAGACAAGACACAGA
CAGCTGCCTGGTCTATGGCGGCCAGCAAATGATCCTCACGGGGCAGAACTTTACATCCGAGTCCAAAGTTGTGTTTACTGAGAAGACCAC
AGATGGACAGCAAATTTGGGAGATGGAAGCCACGGTGGATAAGGACAAGAGCCAGCCCAACATGCTTTTTGTTGAGATCCCTGAATATCG
GAACAAGCATATCCGCACACCTGTAAAAGTGAACTTCTACGTCATCAATGGGAAGAGAAAACGAAGTCAGCCTCAGCACTTTACCTACCA
CCCAGTCCCAGCCATCAAGACGGAGCCCACGGATGAATATGACCCCACTCTGATCTGCAGCCCCACCCATGGAGGCCTGGGGAGCCAGCC
TTACTACCCCCAGCACCCGATGGTGGCCGAGTCCCCCTCCTGCCTCGTGGCCACCATGGCTCCCTGCCAGCAGTTCCGCACGGGGCTCTC
ATCCCCTGACGCCCGCTACCAGCAACAGAACCCAGCGGCCGTACTCTACCAGCGGAGCAAGAGCCTGAGCCCCAGCCTGCTGGGCTATCA
GCAGCCGGCCCTCATGGCCGCCCCGCTGTCCCTTGCGGACGCTCACCGCTCTGTGCTGGTGCACGCCGGCTCCCAGGGCCAGAGCTCAGC
CCTGCTCCACCCCTCTCCGACCAACCAGCAGGCCTCGCCTGTGATCCACTACTCACCCACCAACCAGCAGCTGCGCTGCGGAAGCCACCA
GGAGTTCCAGCACATCATGTACTGCGAGAATTTCGCACCAGGCACCACCAGACCTGGCCCGCCCCCGGTCAGTCAAGGTCAGAGGCTGAG
CCCGGGTTCCTACCCCACAGTCATTCAGCAGCAGAATGCCACGAGCCAAAGAGCCGCCAAAAACGGACCCCCGGTCAGTGACCAAAAGGA
AGTATTACCTGCGGGGGTGACCATTAAACAGGAGCAGAACTTGGACCAGACCTACTTGGATGATGAGCTGATAGACACACACCTTAGCTG
GATACAAAACATATTATGAAACAGAATGACTGTGATCTTTGATCCGAGAAATCAAAGTTAAAGTTAATGAAATTATCAGGAAGGAGTTTT
CAGGACCTCCTGCCAGAAATCAGACGTAAAAGAAGCCATTATAGCAAGACACCTTCTGTATCTGACCCCTCGGAGCCCTCCACAGCCCCT
CACCTTCTGTCTCCTTTCATGTTCATCTCCCAGCCCGGAGTCCACACGCGGATCAATGTATGGGCACTAAGCGGACTCTCACTTAAGGAG

>In-frame_EWSR1_ENST00000397938_chr22_29684775_+_NFATC2_ENST00000609507_chr20_50133495_-_3167nt
GGACGGAACCATTCCAAACAGCCTAGTCTCGTGCTGAGAGCCTCTCCGGTTTCACGCTGAGACCCGCTCACCCCCGCTCTGGCCCCTTAG
ATGCTATTTTGGCCCGAGTGTCACGTCGGGCGCTCTTTAGAGAGGACTGGGACAAGAGTTGCGGACGCGAAGAACGAGTAAGCGGTGGTT
CATCCCTCCTGACCCCACCCCCGTGGCCTGGCCCGATGGTCGCGCCCGGGGTTGCGAGATTTGCGCCTGCGCAGTGCGGCGCCTAGAGGG
AAAGCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGC
GCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTA
TGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCC
CACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTAC
AGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCAC
TGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGG
ATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAG
CTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAG
TAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATA
TAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGG
ATTTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAG
AGGTGGGCGGGGAGGAGGACGCGGTGGAATGGGCATCCCAGTGACTGCATCCCTCCCTCCACTTGAGTGGCCGCTGTCCAGTCAGTCAGG
CTCTTACGAGCTGCGGATCGAGGTGCAGCCCAAGCCACATCACCGGGCCCACTATGAGACAGAAGGCAGCCGAGGGGCTGTCAAAGCTCC
AACTGGAGGCCACCCTGTGGTTCAGCTCCATGGCTACATGGAAAACAAGCCTCTGGGACTTCAGATCTTCATTGGGACAGCTGATGAGCG
GATCCTTAAGCCGCACGCCTTCTACCAGGTGCACCGAATCACGGGGAAAACTGTCACCACCACCAGCTATGAGAAGATAGTGGGCAACAC
CAAAGTCCTGGAGATACCCTTGGAGCCCAAAAACAACATGAGGGCAACCATCGACTGTGCGGGGATCTTGAAGCTTAGAAACGCCGACAT
TGAGCTGCGGAAAGGCGAGACGGACATTGGAAGAAAGAACACGCGGGTGAGACTGGTTTTCCGAGTTCACATCCCAGAGTCCAGTGGCAG
AATCGTCTCTTTACAGACTGCATCTAACCCCATCGAGTGCTCCCAGCGATCTGCTCACGAGCTGCCCATGGTTGAAAGACAAGACACAGA
CAGCTGCCTGGTCTATGGCGGCCAGCAAATGATCCTCACGGGGCAGAACTTTACATCCGAGTCCAAAGTTGTGTTTACTGAGAAGACCAC
AGATGGACAGCAAATTTGGGAGATGGAAGCCACGGTGGATAAGGACAAGAGCCAGCCCAACATGCTTTTTGTTGAGATCCCTGAATATCG
GAACAAGCATATCCGCACACCTGTAAAAGTGAACTTCTACGTCATCAATGGGAAGAGAAAACGAAGTCAGCCTCAGCACTTTACCTACCA
CCCAGTCCCAGCCATCAAGACGGAGCCCACGGATGAATATGACCCCACTCTGATCTGCAGCCCCACCCATGGAGGCCTGGGGAGCCAGCC
TTACTACCCCCAGCACCCGATGGTGGCCGAGTCCCCCTCCTGCCTCGTGGCCACCATGGCTCCCTGCCAGCAGTTCCGCACGGGGCTCTC
ATCCCCTGACGCCCGCTACCAGCAACAGAACCCAGCGGCCGTACTCTACCAGCGGAGCAAGAGCCTGAGCCCCAGCCTGCTGGGCTATCA
GCAGCCGGCCCTCATGGCCGCCCCGCTGTCCCTTGCGGACGCTCACCGCTCTGTGCTGGTGCACGCCGGCTCCCAGGGCCAGAGCTCAGC
CCTGCTCCACCCCTCTCCGACCAACCAGCAGGCCTCGCCTGTGATCCACTACTCACCCACCAACCAGCAGCTGCGCTGCGGAAGCCACCA
GGAGTTCCAGCACATCATGTACTGCGAGAATTTCGCACCAGGCACCACCAGACCTGGCCCGCCCCCGGTCAGTCAAGGTCAGAGGCTGAG
CCCGGGTTCCTACCCCACAGTCATTCAGCAGCAGAATGCCACGAGCCAAAGAGCCGCCAAAAACGGACCCCCGGTCAGTGACCAAAAGGA
AGTATTACCTGCGGGGGTGACCATTAAACAGGAGCAGAACTTGGACCAGACCTACTTGGATGATGAGCTGATAGACACACACCTTAGCTG
GATACAAAACATATTATGAAACAGAATGACTGTGATCTTTGATCCGAGAAATCAAAGTTAAAGTTAATGAAATTATCAGGAAGGAGTTTT
CAGGACCTCCTGCCAGAAATCAGACGTAAAAGAAGCCATTATAGCAAGACACCTTCTGTATCTGACCCCTCGGAGCCCTCCACAGCCCCT
CACCTTCTGTCTCCTTTCATGTTCATCTCCCAGCCCGGAGTCCACACGCGGATCAATGTATGGGCACTAAGCGGACTCTCACTTAAGGAG

>In-frame_EWSR1_ENST00000406548_chr22_29684775_+_NFATC2_ENST00000371564_chr20_50133495_-_7183nt
GCGGCGCCTAGAGGGAAAGCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTA
TAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACA
AAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTC
TTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGA
TACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCA
GCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAA
CCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATC
CTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAG
CTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCA
AGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGG
GCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCG
TGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGTGGAATGGGCATCCCAGTGACTGCATCCCTCCCTCCACTTGAGTGGCCGCT
GTCCAGTCAGTCAGGCTCTTACGAGCTGCGGATCGAGGTGCAGCCCAAGCCACATCACCGGGCCCACTATGAGACAGAAGGCAGCCGAGG
GGCTGTCAAAGCTCCAACTGGAGGCCACCCTGTGGTTCAGCTCCATGGCTACATGGAAAACAAGCCTCTGGGACTTCAGATCTTCATTGG
GACAGCTGATGAGCGGATCCTTAAGCCGCACGCCTTCTACCAGGTGCACCGAATCACGGGGAAAACTGTCACCACCACCAGCTATGAGAA
GATAGTGGGCAACACCAAAGTCCTGGAGATACCCTTGGAGCCCAAAAACAACATGAGGGCAACCATCGACTGTGCGGGGATCTTGAAGCT
TAGAAACGCCGACATTGAGCTGCGGAAAGGCGAGACGGACATTGGAAGAAAGAACACGCGGGTGAGACTGGTTTTCCGAGTTCACATCCC
AGAGTCCAGTGGCAGAATCGTCTCTTTACAGACTGCATCTAACCCCATCGAGTGCTCCCAGCGATCTGCTCACGAGCTGCCCATGGTTGA
AAGACAAGACACAGACAGCTGCCTGGTCTATGGCGGCCAGCAAATGATCCTCACGGGGCAGAACTTTACATCCGAGTCCAAAGTTGTGTT
TACTGAGAAGACCACAGATGGACAGCAAATTTGGGAGATGGAAGCCACGGTGGATAAGGACAAGAGCCAGCCCAACATGCTTTTTGTTGA
GATCCCTGAATATCGGAACAAGCATATCCGCACACCTGTAAAAGTGAACTTCTACGTCATCAATGGGAAGAGAAAACGAAGTCAGCCTCA
GCACTTTACCTACCACCCAGTCCCAGCCATCAAGACGGAGCCCACGGATGAATATGACCCCACTCTGATCTGCAGCCCCACCCATGGAGG
CCTGGGGAGCCAGCCTTACTACCCCCAGCACCCGATGGTGGCCGAGTCCCCCTCCTGCCTCGTGGCCACCATGGCTCCCTGCCAGCAGTT
CCGCACGGGGCTCTCATCCCCTGACGCCCGCTACCAGCAACAGAACCCAGCGGCCGTACTCTACCAGCGGAGCAAGAGCCTGAGCCCCAG
CCTGCTGGGCTATCAGCAGCCGGCCCTCATGGCCGCCCCGCTGTCCCTTGCGGACGCTCACCGCTCTGTGCTGGTGCACGCCGGCTCCCA
GGGCCAGAGCTCAGCCCTGCTCCACCCCTCTCCGACCAACCAGCAGGCCTCGCCTGTGATCCACTACTCACCCACCAACCAGCAGCTGCG
CTGCGGAAGCCACCAGGAGTTCCAGCACATCATGTACTGCGAGAATTTCGCACCAGGCACCACCAGACCTGGCCCGCCCCCGGTCAGTCA
AGGTCAGAGGCTGAGCCCGGGTTCCTACCCCACAGTCATTCAGCAGCAGAATGCCACGAGCCAAAGAGCCGCCAAAAACGGACCCCCGGT
CAGTGACCAAAAGGAAGTATTACCTGCGGGGGTGACCATTAAACAGGAGCAGAACTTGGACCAGACCTACTTGGATGATGAGCTGATAGA
CACACACCTTAGCTGGATACAAAACATATTATGAAACAGAATGACTGTGATCTTTGATCCGAGAAATCAAAGTTAAAGTTAATGAAATTA
TCAGGAAGGAGTTTTCAGGACCTCCTGCCAGAAATCAGACGTAAAAGAAGCCATTATAGCAAGACACCTTCTGTATCTGACCCCTCGGAG
CCCTCCACAGCCCCTCACCTTCTGTCTCCTTTCATGTTCATCTCCCAGCCCGGAGTCCACACGCGGATCAATGTATGGGCACTAAGCGGA
CTCTCACTTAAGGAGCTCGCCACCTCCCTCTAAACACCAGAGAGAACTCTTCTTTTCGGTTTATGTTTTAAATCCCAGAGAGCATCCTGG
TTGATCTTAATGGTGTTCCGTCCAAATAGTAAGCACCTGCTGACCAAAAGCACATTCTACATGAGACAGGACACTGGAACTCTCCTGAGA
ACAGAGTGACTGGAGCTTGGGGGGATGGACGGGGGACAGAAGATGTGGGCACTGTGATTAAACCCCAGCCCTTGCGTTCGTTTTTCCAGG
TCACAGATACAGCTCCTGTACCTTTTGAAGGCAAGGAGTTCTCAGAGCAACCAAAGGAACGTGACCCAAGAGCCCAGCTTACAGGCTGAA
GAAACCCAAAACCCTCGATAGAGACAGAAACTGAACTGTCAGTCCTTAGAGCTCGCCCAGTCCATGCCACAACTGGGCCACAGCTAAAGC
TTTATTTTTGAATTCTCATTCCAAAACCAAACTGTCTTGCCCAGACAAGATCACCTGTTAAGACTTCTTGGCGTTAAGTTATGACATGTA
TACGCGTTTGTTATTATTATTTTTTCTGCTTTAAAAGGCTGACCAGGGCACCTAGCCCTGGAGCTGTCTTGGCGAGCTGTTCTTTAACCC
CTGCAGCACGCAGTCCTGCTAACACAATTTCCATAGACTTGGGGGGCTGACCCAGGCTGCAGAGAGCAAGCACCTGTCTGCTGCAGCTGT
ACAACCTGGATGCTTTGCAAGGTTCCGGCTTGCTTTCTTCCTAGCAGCCAGAGTGCTTTTCCGTAAAGCGGTGGAGAATCTCAAGCATGT
GCATTTAATTGAGGAATAGCAGAAGGGCTAAAGCAACCAAGAAAAGAAGTGTGGGTATTTTTGTTAAGTAAAACAGCCCAAGTGCTTCTG
GAGGTGGGTTTCTACCAAGATAGAGGAAAAGGGCTGAATTCCCTCTAAGTGGGACAGCCGAGCTCAGGATGTGCTTCCCAGCTTCACTGG
TTAATTTGACCTGAACCTATTTAAAGATCCCTTCTGCCCCTGAAGACCTATCCGCACTCAAATTCTAACATGAAGAAATCTACTCGAATG
CATCCTTTACTTTGAATGAGCTCTATTCGGTTGCATGTTATATGTGATTTCCTTCCTCCCAACTGTTTCCACTGAGCGCACCCAGTCTCC
CCTAGTCTTCCTCTGTGGGTGTGATTTTTGTGATTTTTACAAACAAAACCCTTGAAGTTCTTGGCAGATGTGTTTGTTTCTGTTTGCATG
TACTGCAGATACCCCAGGACAAGCGGGGGATTCATTTTTCAGCCATTCAGTTGTTTCCTCAATAATCCGCAGCAAAGTGAAAATATTCTT
AGCACTCAGACTGTACTTAGAGTGTTTTCTCAGTCCAGTCTGTACAGTCTGTAGGCAGAAGGCCTCAGAAGAAAGTCATGGCCACTCAGT
GCCCACTGTGGGCTTTGTAAGTCCTGGCTCTCCCGTCAAGGTTACCCAGAGGTAAAAGCTTCCTGGGAGTGGGGCCAGGTGTGTTTGGCA
CTCCAGATAGAAGGCAAAATGCTCAGATTCGGGCCTGTGCACTTGTATGCAACCTGTCGGTCGATACCTAGCATTTATTTTTCCCTGACA
ATGAACGACCTTTCCCTCACCCACCCTAAGCTCAAAGAGTTTAGCAAAATTCTCTTTTAAATAAACAGAATGCCAGTAAGAGGTTGACCC
CTACCATGGAACTTCTGGGATGCTAAATACTTCCTCATGAACAAAATAAGTTCCTTATTATAAGTTCCTTATACTAGCAGCTTCACCTAA
AGAATTTTCTCTCCAGCAATATTGACTTCACTGGGGAAAAGCCAAGAGTGTGTGGTGAGTGATTTGTTCTCACTCGACCTGGCTAGGACT
GGCTAGGAGCTGTTTTTTGTACATGAGGGAATTTGGGCTTTCCTCAGTTATCTGAATGTTTTACCCAAGTGCCTTCCTGCTATTGTAGCA
AAGTAGCTCAGCTTCCTTGTCCACAGGGTGAAAAAGGACTAATGCATTTTCCATCAGTTTTCTAACTATGTTAGCAAAAACGGCCTCCTG
GTAGCTCAACCTCCTGTACGCGTGTGTGTGTGTAATACACACACAAATAAACCCCTCTGTTTTTCTAAGACATCTTAGCTGGATATTATA
GGAAGCACTTTCATAAACAACTGTAACAAATCGCAAAGGAAAGAGAAACAAAAGCATTAGATTTGAGACATAAACAGGCAAGAGAAAGTG
TATTAGGAACTGACAGCTATCAAGGAAGTTTTGTCAGTTACAAATGCTAGGAGGAAATTTTGCCAAGAAGGATGGCTCATGAAATATTTC
CAGTACGGGAAGAGGCAATAAGATCCTCTAAGAGAATGAGAAAGTAGGGGTGTCTAAATGGTAAAGATGGGTGTGTTGCACGTGTGTTAG
AAGGATCTCAGTTGAGTGAAGGTTTGCACTGCTACATCTAAGTTAATGTAAATATGTAGCACTCTGACAGGTCTACCGTGTTGCTGAATG
TAGTATATTTCCAAAGTTTGCAAGTCTTCCTGTATTGTACAAAGATGCTGCTGCTTGATAATATGTATAGCAATCCAGATTAGTATGTTA
TTAAATTTTATTTTCTTACCTGTATTTTTATGCTTTTTACCTGTCCTCAAAATATTACACCCCTGTTGGAATTAGATTTATATTTATAAA
TGGTCAGAAATCTTTTTAAGTGTCTCTTTTTACACATAGGTTGATTTTTTTTTCTTAAGAGAAATGATGTATTCTTGAAACATTTGTTAC
TCATTCCAGGAAACAAAAACCCATATAATAAAACCCCCACTCAGAGCCTGTTAGTCACCTCTCTAGAAGATGGCATCTCAGGAGAAGGAA
TGGCTTTGTGGAAGAAGGAATCACCTTTTTCTTGCTCAAGAATTATGCTGACTTCAGCCCTGAGCCTGGATCTGGTCACTGAGAATCATC
AAGTGTCTAGATCCTCCCCCCAAAATAACTAATTTAGTAGGTGATTTTGATTTTAAAAAATTGACACCAAAACCCTGCCTGCATTGTAAT
GGAATTCGAAAAGAATTCATGTTCACAGAACTCAACGTTCAGGCTAATATTTACAGAAGGGACCAAATCTAAATCCTGGTAGATAACTCC
TGTATGCTTTATCCAAAGGACACCCACAGTTTTCCAGCATAGATATAACCAAGGATGAATTGATTCCTTCAAAGAACTGGGAGGCACGGA
TATTGCATTTTTTGTTTACATCCAGTAGCCAAGACGCCTCAGTGAGCCAGTCTTGGGCAGAGGCTGTCACATTTAGGCAGATTGGAAGTT
GGTATGTTCTAATTCTCACTCTGGACTACAGTGAGGCTGAATTTATCATGTCAAAAAAAAAAAAAAAAAAAGACCTTTCCAAGTGCTTTC
TATTGCTCAGAATTGAAAGAATGTTTTCATTTCAAGTTTACAAGAGGCATGGATGGAGTTGTGACGTTCTTGACAAGCTGGGCTAACCTT
TCCCGAACTTGTTTCCCGGAGGCAAGGTGCTCGGTGACCCAGCGCATCTTAACCTTGGGTCTCCTAGGCTCGAGGCTAGGGCATTACGTT
TCGTGGAACCAAAGCAGCCAATTGCATAGCAAGTATTTTCCTGCATTCCAATTAAATGCTTAAGAAAAAGCAGCATCCTATAAAATTGTG
ATCATAAACATCCATTTCCCTCAGCTTTTGTGAGTGCCTTGACTTACAGCCAACATCACTGTTTAACTCAGTCTGTTTAAAAACAAACTT
TTCTGGTGGTTGATAACAGAGAGTTGCTCCCTGAGCCATCAGGGTCCTGGGAGCTGGAAGTGAAAGGGTTATTAACATTCTACCTTTATG
CAGCTGTTGGCTGACCAGAATAAACTCCCTGCTGAGTTCAAGCTTTGAATGGAATGGATGCAAATGATGTTGTTTCCATTAGAGCAGGTG
CTCACAGCATTCTGATTGGCCTGAGCAGACCGAGGCTATGGCTGTTGGGACAAGCTTAGCATCCTGGACATCTTGTCAAAGAACCTCACT
CACCCCTCTGGCCTCTACAGCCCTCAGAGGAGAGAAAACCAATTCTCCAACAAACAGGTCTCTCCAACATGGTGGTGCTGGCAGGCTTAG
GTTTAGAAAATCCTGACTGTTAAAGGCGTTTGAATACATCACATTCCTATGCAAATGTTTTTAATCTCCAGTTTAATGTAGTTTATTTTT

>In-frame_EWSR1_ENST00000406548_chr22_29684775_+_NFATC2_ENST00000396009_chr20_50133495_-_7095nt
GCGGCGCCTAGAGGGAAAGCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTA
TAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACA
AAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTC
TTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGA
TACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCA
GCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAA
CCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATC
CTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAG
CTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCA
AGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGG
GCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCG
TGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGTGGAATGGGCATCCCAGTGACTGCATCCCTCCCTCCACTTGAGTGGCCGCT
GTCCAGTCAGTCAGGCTCTTACGAGCTGCGGATCGAGGTGCAGCCCAAGCCACATCACCGGGCCCACTATGAGACAGAAGGCAGCCGAGG
GGCTGTCAAAGCTCCAACTGGAGGCCACCCTGTGGTTCAGCTCCATGGCTACATGGAAAACAAGCCTCTGGGACTTCAGATCTTCATTGG
GACAGCTGATGAGCGGATCCTTAAGCCGCACGCCTTCTACCAGGTGCACCGAATCACGGGGAAAACTGTCACCACCACCAGCTATGAGAA
GATAGTGGGCAACACCAAAGTCCTGGAGATACCCTTGGAGCCCAAAAACAACATGAGGGCAACCATCGACTGTGCGGGGATCTTGAAGCT
TAGAAACGCCGACATTGAGCTGCGGAAAGGCGAGACGGACATTGGAAGAAAGAACACGCGGGTGAGACTGGTTTTCCGAGTTCACATCCC
AGAGTCCAGTGGCAGAATCGTCTCTTTACAGACTGCATCTAACCCCATCGAGTGCTCCCAGCGATCTGCTCACGAGCTGCCCATGGTTGA
AAGACAAGACACAGACAGCTGCCTGGTCTATGGCGGCCAGCAAATGATCCTCACGGGGCAGAACTTTACATCCGAGTCCAAAGTTGTGTT
TACTGAGAAGACCACAGATGGACAGCAAATTTGGGAGATGGAAGCCACGGTGGATAAGGACAAGAGCCAGCCCAACATGCTTTTTGTTGA
GATCCCTGAATATCGGAACAAGCATATCCGCACACCTGTAAAAGTGAACTTCTACGTCATCAATGGGAAGAGAAAACGAAGTCAGCCTCA
GCACTTTACCTACCACCCAGTCCCAGCCATCAAGACGGAGCCCACGGATGAATATGACCCCACTCTGATCTGCAGCCCCACCCATGGAGG
CCTGGGGAGCCAGCCTTACTACCCCCAGCACCCGATGGTGGCCGAGTCCCCCTCCTGCCTCGTGGCCACCATGGCTCCCTGCCAGCAGTT
CCGCACGGGGCTCTCATCCCCTGACGCCCGCTACCAGCAACAGAACCCAGCGGCCGTACTCTACCAGCGGAGCAAGAGCCTGAGCCCCAG
CCTGCTGGGCTATCAGCAGCCGGCCCTCATGGCCGCCCCGCTGTCCCTTGCGGACGCTCACCGCTCTGTGCTGGTGCACGCCGGCTCCCA
GGGCCAGAGCTCAGCCCTGCTCCACCCCTCTCCGACCAACCAGCAGGCCTCGCCTGTGATCCACTACTCACCCACCAACCAGCAGCTGCG
CTGCGGAAGCCACCAGGAGTTCCAGCACATCATGTACTGCGAGAATTTCGCACCAGGCACCACCAGACCTGGCCCGCCCCCGGTCAGTCA
AGGTCAGAGGCTGAGCCCGGGTTCCTACCCCACAGTCATTCAGCAGCAGAATGCCACGAGCCAAAGAGCCGCCAAAAACGGACCCCCGGT
CAGTGACCAAAAGGAAGTATTACCTGCGGGGGTGACCATTAAACAGGAGCAGAACTTGGACCAGACCTACTTGGATGATGTTAATGAAAT
TATCAGGAAGGAGTTTTCAGGACCTCCTGCCAGAAATCAGACGTAAAAGAAGCCATTATAGCAAGACACCTTCTGTATCTGACCCCTCGG
AGCCCTCCACAGCCCCTCACCTTCTGTCTCCTTTCATGTTCATCTCCCAGCCCGGAGTCCACACGCGGATCAATGTATGGGCACTAAGCG
GACTCTCACTTAAGGAGCTCGCCACCTCCCTCTAAACACCAGAGAGAACTCTTCTTTTCGGTTTATGTTTTAAATCCCAGAGAGCATCCT
GGTTGATCTTAATGGTGTTCCGTCCAAATAGTAAGCACCTGCTGACCAAAAGCACATTCTACATGAGACAGGACACTGGAACTCTCCTGA
GAACAGAGTGACTGGAGCTTGGGGGGATGGACGGGGGACAGAAGATGTGGGCACTGTGATTAAACCCCAGCCCTTGCGTTCGTTTTTCCA
GGTCACAGATACAGCTCCTGTACCTTTTGAAGGCAAGGAGTTCTCAGAGCAACCAAAGGAACGTGACCCAAGAGCCCAGCTTACAGGCTG
AAGAAACCCAAAACCCTCGATAGAGACAGAAACTGAACTGTCAGTCCTTAGAGCTCGCCCAGTCCATGCCACAACTGGGCCACAGCTAAA
GCTTTATTTTTGAATTCTCATTCCAAAACCAAACTGTCTTGCCCAGACAAGATCACCTGTTAAGACTTCTTGGCGTTAAGTTATGACATG
TATACGCGTTTGTTATTATTATTTTTTCTGCTTTAAAAGGCTGACCAGGGCACCTAGCCCTGGAGCTGTCTTGGCGAGCTGTTCTTTAAC
CCCTGCAGCACGCAGTCCTGCTAACACAATTTCCATAGACTTGGGGGGCTGACCCAGGCTGCAGAGAGCAAGCACCTGTCTGCTGCAGCT
GTACAACCTGGATGCTTTGCAAGGTTCCGGCTTGCTTTCTTCCTAGCAGCCAGAGTGCTTTTCCGTAAAGCGGTGGAGAATCTCAAGCAT
GTGCATTTAATTGAGGAATAGCAGAAGGGCTAAAGCAACCAAGAAAAGAAGTGTGGGTATTTTTGTTAAGTAAAACAGCCCAAGTGCTTC
TGGAGGTGGGTTTCTACCAAGATAGAGGAAAAGGGCTGAATTCCCTCTAAGTGGGACAGCCGAGCTCAGGATGTGCTTCCCAGCTTCACT
GGTTAATTTGACCTGAACCTATTTAAAGATCCCTTCTGCCCCTGAAGACCTATCCGCACTCAAATTCTAACATGAAGAAATCTACTCGAA
TGCATCCTTTACTTTGAATGAGCTCTATTCGGTTGCATGTTATATGTGATTTCCTTCCTCCCAACTGTTTCCACTGAGCGCACCCAGTCT
CCCCTAGTCTTCCTCTGTGGGTGTGATTTTTGTGATTTTTACAAACAAAACCCTTGAAGTTCTTGGCAGATGTGTTTGTTTCTGTTTGCA
TGTACTGCAGATACCCCAGGACAAGCGGGGGATTCATTTTTCAGCCATTCAGTTGTTTCCTCAATAATCCGCAGCAAAGTGAAAATATTC
TTAGCACTCAGACTGTACTTAGAGTGTTTTCTCAGTCCAGTCTGTACAGTCTGTAGGCAGAAGGCCTCAGAAGAAAGTCATGGCCACTCA
GTGCCCACTGTGGGCTTTGTAAGTCCTGGCTCTCCCGTCAAGGTTACCCAGAGGTAAAAGCTTCCTGGGAGTGGGGCCAGGTGTGTTTGG
CACTCCAGATAGAAGGCAAAATGCTCAGATTCGGGCCTGTGCACTTGTATGCAACCTGTCGGTCGATACCTAGCATTTATTTTTCCCTGA
CAATGAACGACCTTTCCCTCACCCACCCTAAGCTCAAAGAGTTTAGCAAAATTCTCTTTTAAATAAACAGAATGCCAGTAAGAGGTTGAC
CCCTACCATGGAACTTCTGGGATGCTAAATACTTCCTCATGAACAAAATAAGTTCCTTATTATAAGTTCCTTATACTAGCAGCTTCACCT
AAAGAATTTTCTCTCCAGCAATATTGACTTCACTGGGGAAAAGCCAAGAGTGTGTGGTGAGTGATTTGTTCTCACTCGACCTGGCTAGGA
CTGGCTAGGAGCTGTTTTTTGTACATGAGGGAATTTGGGCTTTCCTCAGTTATCTGAATGTTTTACCCAAGTGCCTTCCTGCTATTGTAG
CAAAGTAGCTCAGCTTCCTTGTCCACAGGGTGAAAAAGGACTAATGCATTTTCCATCAGTTTTCTAACTATGTTAGCAAAAACGGCCTCC
TGGTAGCTCAACCTCCTGTACGCGTGTGTGTGTGTAATACACACACAAATAAACCCCTCTGTTTTTCTAAGACATCTTAGCTGGATATTA
TAGGAAGCACTTTCATAAACAACTGTAACAAATCGCAAAGGAAAGAGAAACAAAAGCATTAGATTTGAGACATAAACAGGCAAGAGAAAG
TGTATTAGGAACTGACAGCTATCAAGGAAGTTTTGTCAGTTACAAATGCTAGGAGGAAATTTTGCCAAGAAGGATGGCTCATGAAATATT
TCCAGTACGGGAAGAGGCAATAAGATCCTCTAAGAGAATGAGAAAGTAGGGGTGTCTAAATGGTAAAGATGGGTGTGTTGCACGTGTGTT
AGAAGGATCTCAGTTGAGTGAAGGTTTGCACTGCTACATCTAAGTTAATGTAAATATGTAGCACTCTGACAGGTCTACCGTGTTGCTGAA
TGTAGTATATTTCCAAAGTTTGCAAGTCTTCCTGTATTGTACAAAGATGCTGCTGCTTGATAATATGTATAGCAATCCAGATTAGTATGT
TATTAAATTTTATTTTCTTACCTGTATTTTTATGCTTTTTACCTGTCCTCAAAATATTACACCCCTGTTGGAATTAGATTTATATTTATA
AATGGTCAGAAATCTTTTTAAGTGTCTCTTTTTACACATAGGTTGATTTTTTTTTCTTAAGAGAAATGATGTATTCTTGAAACATTTGTT
ACTCATTCCAGGAAACAAAAACCCATATAATAAAACCCCCACTCAGAGCCTGTTAGTCACCTCTCTAGAAGATGGCATCTCAGGAGAAGG
AATGGCTTTGTGGAAGAAGGAATCACCTTTTTCTTGCTCAAGAATTATGCTGACTTCAGCCCTGAGCCTGGATCTGGTCACTGAGAATCA
TCAAGTGTCTAGATCCTCCCCCCAAAATAACTAATTTAGTAGGTGATTTTGATTTTAAAAAATTGACACCAAAACCCTGCCTGCATTGTA
ATGGAATTCGAAAAGAATTCATGTTCACAGAACTCAACGTTCAGGCTAATATTTACAGAAGGGACCAAATCTAAATCCTGGTAGATAACT
CCTGTATGCTTTATCCAAAGGACACCCACAGTTTTCCAGCATAGATATAACCAAGGATGAATTGATTCCTTCAAAGAACTGGGAGGCACG
GATATTGCATTTTTTGTTTACATCCAGTAGCCAAGACGCCTCAGTGAGCCAGTCTTGGGCAGAGGCTGTCACATTTAGGCAGATTGGAAG
TTGGTATGTTCTAATTCTCACTCTGGACTACAGTGAGGCTGAATTTATCATGTCAAAAAAAAAAAAAAAAAAAGACCTTTCCAAGTGCTT
TCTATTGCTCAGAATTGAAAGAATGTTTTCATTTCAAGTTTACAAGAGGCATGGATGGAGTTGTGACGTTCTTGACAAGCTGGGCTAACC
TTTCCCGAACTTGTTTCCCGGAGGCAAGGTGCTCGGTGACCCAGCGCATCTTAACCTTGGGTCTCCTAGGCTCGAGGCTAGGGCATTACG
TTTCGTGGAACCAAAGCAGCCAATTGCATAGCAAGTATTTTCCTGCATTCCAATTAAATGCTTAAGAAAAAGCAGCATCCTATAAAATTG
TGATCATAAACATCCATTTCCCTCAGCTTTTGTGAGTGCCTTGACTTACAGCCAACATCACTGTTTAACTCAGTCTGTTTAAAAACAAAC
TTTTCTGGTGGTTGATAACAGAGAGTTGCTCCCTGAGCCATCAGGGTCCTGGGAGCTGGAAGTGAAAGGGTTATTAACATTCTACCTTTA
TGCAGCTGTTGGCTGACCAGAATAAACTCCCTGCTGAGTTCAAGCTTTGAATGGAATGGATGCAAATGATGTTGTTTCCATTAGAGCAGG
TGCTCACAGCATTCTGATTGGCCTGAGCAGACCGAGGCTATGGCTGTTGGGACAAGCTTAGCATCCTGGACATCTTGTCAAAGAACCTCA
CTCACCCCTCTGGCCTCTACAGCCCTCAGAGGAGAGAAAACCAATTCTCCAACAAACAGGTCTCTCCAACATGGTGGTGCTGGCAGGCTT
AGGTTTAGAAAATCCTGACTGTTAAAGGCGTTTGAATACATCACATTCCTATGCAAATGTTTTTAATCTCCAGTTTAATGTAGTTTATTT

>In-frame_EWSR1_ENST00000406548_chr22_29684775_+_NFATC2_ENST00000609943_chr20_50133495_-_5426nt
GCGGCGCCTAGAGGGAAAGCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTA
TAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACA
AAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTC
TTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGA
TACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCA
GCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAA
CCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATC
CTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAG
CTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCA
AGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGG
GCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCG
TGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGTGGAATGGGCATCCCAGTGACTGCATCCCTCCCTCCACTTGAGTGGCCGCT
GTCCAGTCAGTCAGGCTCTTACGAGCTGCGGATCGAGGTGCAGCCCAAGCCACATCACCGGGCCCACTATGAGACAGAAGGCAGCCGAGG
GGCTGTCAAAGCTCCAACTGGAGGCCACCCTGTGGTTCAGCTCCATGGCTACATGGAAAACAAGCCTCTGGGACTTCAGATCTTCATTGG
GACAGCTGATGAGCGGATCCTTAAGCCGCACGCCTTCTACCAGGTGCACCGAATCACGGGGAAAACTGTCACCACCACCAGCTATGAGAA
GATAGTGGGCAACACCAAAGTCCTGGAGATACCCTTGGAGCCCAAAAACAACATGAGGGCAACCATCGACTGTGCGGGGATCTTGAAGCT
TAGAAACGCCGACATTGAGCTGCGGAAAGGCGAGACGGACATTGGAAGAAAGAACACGCGGGTGAGACTGGTTTTCCGAGTTCACATCCC
AGAGTCCAGTGGCAGAATCGTCTCTTTACAGACTGCATCTAACCCCATCGAGTGCTCCCAGCGATCTGCTCACGAGCTGCCCATGGTTGA
AAGACAAGACACAGACAGCTGCCTGGTCTATGGCGGCCAGCAAATGATCCTCACGGGGCAGAACTTTACATCCGAGTCCAAAGTTGTGTT
TACTGAGAAGACCACAGATGGACAGCAAATTTGGGAGATGGAAGCCACGGTGGATAAGGACAAGAGCCAGCCCAACATGCTTTTTGTTGA
GATCCCTGAATATCGGAACAAGCATATCCGCACACCTGTAAAAGTGAACTTCTACGTCATCAATGGGAAGAGAAAACGAAGTCAGCCTCA
GCACTTTACCTACCACCCAGTCCCAGCCATCAAGACGGAGCCCACGGATGAATATGACCCCACTCTGATCTGCAGCCCCACCCATGGAGG
CCTGGGGAGCCAGCCTTACTACCCCCAGCACCCGATGGTGGCCGAGTCCCCCTCCTGCCTCGTGGCCACCATGGCTCCCTGCCAGCAGTT
CCGCACGGGGCTCTCATCCCCTGACGCCCGCTACCAGCAACAGAACCCAGCGGCCGTACTCTACCAGCGGAGCAAGAGCCTGAGCCCCAG
CCTGCTGGGCTATCAGCAGCCGGCCCTCATGGCCGCCCCGCTGTCCCTTGCGGACGCTCACCGCTCTGTGCTGGTGCACGCCGGCTCCCA
GGGCCAGAGCTCAGCCCTGCTCCACCCCTCTCCGACCAACCAGCAGGCCTCGCCTGTGATCCACTACTCACCCACCAACCAGCAGCTGCG
CTGCGGAAGCCACCAGGAGTTCCAGCACATCATGTACTGCGAGAATTTCGCACCAGGCACCACCAGACCTGGCCCGCCCCCGGTCAGTCA
AGGTCAGAGGCTGAGCCCGGGTTCCTACCCCACAGTCATTCAGCAGCAGAATGCCACGAGCCAAAGAGCCGCCAAAAACGGACCCCCGGT
CAGTGACCAAAAGGAAGTATTACCTGCGGGGGTGACCATTAAACAGGAGCAGAACTTGGACCAGACCTACTTGGATGATGTTAATGAAAT
TATCAGGAAGGAGTTTTCAGGACCTCCTGCCAGAAATCAGACGTAAAAGAAGCCATTATAGCAAGACACCTTCTGTATCTGACCCCTCGG
AGCCCTCCACAGCCCCTCACCTTCTGTCTCCTTTCATGTTCATCTCCCAGCCCGGAGTCCACACGCGGATCAATGTATGGGCACTAAGCG
GACTCTCACTTAAGGAGCTCGCCACCTCCCTCTAAACACCAGAGAGAACTCTTCTTTTCGGTTTATGTTTTAAATCCCAGAGAGCATCCT
GGTTGATCTTAATGGTGTTCCGTCCAAATAGTAAGCACCTGCTGACCAAAAGCACATTCTACATGAGACAGGACACTGGAACTCTCCTGA
GAACAGAGTGACTGGAGCTTGGGGGGATGGACGGGGGACAGAAGATGTGGGCACTGTGATTAAACCCCAGCCCTTGCGTTCGTTTTTCCA
GGTCACAGATACAGCTCCTGTACCTTTTGAAGGCAAGGAGTTCTCAGAGCAACCAAAGGAACGTGACCCAAGAGCCCAGCTTACAGGCTG
AAGAAACCCAAAACCCTCGATAGAGACAGAAACTGAACTGTCAGTCCTTAGAGCTCGCCCAGTCCATGCCACAACTGGGCCACAGCTAAA
GCTTTATTTTTGAATTCTCATTCCAAAACCAAACTGTCTTGCCCAGACAAGATCACCTGTTAAGACTTCTTGGCGTTAAGTTATGACATG
TATACGCGTTTGTTATTATTATTTTTTCTGCTTTAAAAGGCTGACCAGGGCACCTAGCCCTGGAGCTGTCTTGGCGAGCTGTTCTTTAAC
CCCTGCAGCACGCAGTCCTGCTAACACAATTTCCATAGACTTGGGGGGCTGACCCAGGCTGCAGAGAGCAAGCACCTGTCTGCTGCAGCT
GTACAACCTGGATGCTTTGCAAGGTTCCGGCTTGCTTTCTTCCTAGCAGCCAGAGTGCTTTTCCGTAAAGCGGTGGAGAATCTCAAGCAT
GTGCATTTAATTGAGGAATAGCAGAAGGGCTAAAGCAACCAAGAAAAGAAGTGTGGGTATTTTTGTTAAGTAAAACAGCCCAAGTGCTTC
TGGAGGTGGGTTTCTACCAAGATAGAGGAAAAGGGCTGAATTCCCTCTAAGTGGGACAGCCGAGCTCAGGATGTGCTTCCCAGCTTCACT
GGTTAATTTGACCTGAACCTATTTAAAGATCCCTTCTGCCCCTGAAGACCTATCCGCACTCAAATTCTAACATGAAGAAATCTACTCGAA
TGCATCCTTTACTTTGAATGAGCTCTATTCGGTTGCATGTTATATGTGATTTCCTTCCTCCCAACTGTTTCCACTGAGCGCACCCAGTCT
CCCCTAGTCTTCCTCTGTGGGTGTGATTTTTGTGATTTTTACAAACAAAACCCTTGAAGTTCTTGGCAGATGTGTTTGTTTCTGTTTGCA
TGTACTGCAGATACCCCAGGACAAGCGGGGGATTCATTTTTCAGCCATTCAGTTGTTTCCTCAATAATCCGCAGCAAAGTGAAAATATTC
TTAGCACTCAGACTGTACTTAGAGTGTTTTCTCAGTCCAGTCTGTACAGTCTGTAGGCAGAAGGCCTCAGAAGAAAGTCATGGCCACTCA
GTGCCCACTGTGGGCTTTGTAAGTCCTGGCTCTCCCGTCAAGGTTACCCAGAGGTAAAAGCTTCCTGGGAGTGGGGCCAGGTGTGTTTGG
CACTCCAGATAGAAGGCAAAATGCTCAGATTCGGGCCTGTGCACTTGTATGCAACCTGTCGGTCGATACCTAGCATTTATTTTTCCCTGA
CAATGAACGACCTTTCCCTCACCCACCCTAAGCTCAAAGAGTTTAGCAAAATTCTCTTTTAAATAAACAGAATGCCAGTAAGAGGTTGAC
CCCTACCATGGAACTTCTGGGATGCTAAATACTTCCTCATGAACAAAATAAGTTCCTTATTATAAGTTCCTTATACTAGCAGCTTCACCT
AAAGAATTTTCTCTCCAGCAATATTGACTTCACTGGGGAAAAGCCAAGAGTGTGTGGTGAGTGATTTGTTCTCACTCGACCTGGCTAGGA
CTGGCTAGGAGCTGTTTTTTGTACATGAGGGAATTTGGGCTTTCCTCAGTTATCTGAATGTTTTACCCAAGTGCCTTCCTGCTATTGTAG
CAAAGTAGCTCAGCTTCCTTGTCCACAGGGTGAAAAAGGACTAATGCATTTTCCATCAGTTTTCTAACTATGTTAGCAAAAACGGCCTCC
TGGTAGCTCAACCTCCTGTACGCGTGTGTGTGTGTAATACACACACAAATAAACCCCTCTGTTTTTCTAAGACATCTTAGCTGGATATTA
TAGGAAGCACTTTCATAAACAACTGTAACAAATCGCAAAGGAAAGAGAAACAAAAGCATTAGATTTGAGACATAAACAGGCAAGAGAAAG
TGTATTAGGAACTGACAGCTATCAAGGAAGTTTTGTCAGTTACAAATGCTAGGAGGAAATTTTGCCAAGAAGGATGGCTCATGAAATATT
TCCAGTACGGGAAGAGGCAATAAGATCCTCTAAGAGAATGAGAAAGTAGGGGTGTCTAAATGGTAAAGATGGGTGTGTTGCACGTGTGTT
AGAAGGATCTCAGTTGAGTGAAGGTTTGCACTGCTACATCTAAGTTAATGTAAATATGTAGCACTCTGACAGGTCTACCGTGTTGCTGAA
TGTAGTATATTTCCAAAGTTTGCAAGTCTTCCTGTATTGTACAAAGATGCTGCTGCTTGATAATATGTATAGCAATCCAGATTAGTATGT

>In-frame_EWSR1_ENST00000406548_chr22_29684775_+_NFATC2_ENST00000610033_chr20_50133495_-_2912nt
GCGGCGCCTAGAGGGAAAGCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTA
TAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACA
AAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTC
TTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGA
TACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCA
GCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAA
CCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATC
CTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAG
CTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCA
AGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGG
GCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCG
TGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGTGGAATGGGCATCCCAGTGACTGCATCCCTCCCTCCACTTGAGTGGCCGCT
GTCCAGTCAGTCAGGCTCTTACGAGCTGCGGATCGAGGTGCAGCCCAAGCCACATCACCGGGCCCACTATGAGACAGAAGGCAGCCGAGG
GGCTGTCAAAGCTCCAACTGGAGGCCACCCTGTGGTTCAGCTCCATGGCTACATGGAAAACAAGCCTCTGGGACTTCAGATCTTCATTGG
GACAGCTGATGAGCGGATCCTTAAGCCGCACGCCTTCTACCAGGTGCACCGAATCACGGGGAAAACTGTCACCACCACCAGCTATGAGAA
GATAGTGGGCAACACCAAAGTCCTGGAGATACCCTTGGAGCCCAAAAACAACATGAGGGCAACCATCGACTGTGCGGGGATCTTGAAGCT
TAGAAACGCCGACATTGAGCTGCGGAAAGGCGAGACGGACATTGGAAGAAAGAACACGCGGGTGAGACTGGTTTTCCGAGTTCACATCCC
AGAGTCCAGTGGCAGAATCGTCTCTTTACAGACTGCATCTAACCCCATCGAGTGCTCCCAGCGATCTGCTCACGAGCTGCCCATGGTTGA
AAGACAAGACACAGACAGCTGCCTGGTCTATGGCGGCCAGCAAATGATCCTCACGGGGCAGAACTTTACATCCGAGTCCAAAGTTGTGTT
TACTGAGAAGACCACAGATGGACAGCAAATTTGGGAGATGGAAGCCACGGTGGATAAGGACAAGAGCCAGCCCAACATGCTTTTTGTTGA
GATCCCTGAATATCGGAACAAGCATATCCGCACACCTGTAAAAGTGAACTTCTACGTCATCAATGGGAAGAGAAAACGAAGTCAGCCTCA
GCACTTTACCTACCACCCAGTCCCAGCCATCAAGACGGAGCCCACGGATGAATATGACCCCACTCTGATCTGCAGCCCCACCCATGGAGG
CCTGGGGAGCCAGCCTTACTACCCCCAGCACCCGATGGTGGCCGAGTCCCCCTCCTGCCTCGTGGCCACCATGGCTCCCTGCCAGCAGTT
CCGCACGGGGCTCTCATCCCCTGACGCCCGCTACCAGCAACAGAACCCAGCGGCCGTACTCTACCAGCGGAGCAAGAGCCTGAGCCCCAG
CCTGCTGGGCTATCAGCAGCCGGCCCTCATGGCCGCCCCGCTGTCCCTTGCGGACGCTCACCGCTCTGTGCTGGTGCACGCCGGCTCCCA
GGGCCAGAGCTCAGCCCTGCTCCACCCCTCTCCGACCAACCAGCAGGCCTCGCCTGTGATCCACTACTCACCCACCAACCAGCAGCTGCG
CTGCGGAAGCCACCAGGAGTTCCAGCACATCATGTACTGCGAGAATTTCGCACCAGGCACCACCAGACCTGGCCCGCCCCCGGTCAGTCA
AGGTCAGAGGCTGAGCCCGGGTTCCTACCCCACAGTCATTCAGCAGCAGAATGCCACGAGCCAAAGAGCCGCCAAAAACGGACCCCCGGT
CAGTGACCAAAAGGAAGTATTACCTGCGGGGGTGACCATTAAACAGGAGCAGAACTTGGACCAGACCTACTTGGATGATGAGCTGATAGA
CACACACCTTAGCTGGATACAAAACATATTATGAAACAGAATGACTGTGATCTTTGATCCGAGAAATCAAAGTTAAAGTTAATGAAATTA
TCAGGAAGGAGTTTTCAGGACCTCCTGCCAGAAATCAGACGTAAAAGAAGCCATTATAGCAAGACACCTTCTGTATCTGACCCCTCGGAG
CCCTCCACAGCCCCTCACCTTCTGTCTCCTTTCATGTTCATCTCCCAGCCCGGAGTCCACACGCGGATCAATGTATGGGCACTAAGCGGA

>In-frame_EWSR1_ENST00000406548_chr22_29684775_+_NFATC2_ENST00000414705_chr20_50133495_-_2912nt
GCGGCGCCTAGAGGGAAAGCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTA
TAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACA
AAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTC
TTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGA
TACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCA
GCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAA
CCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATC
CTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAG
CTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCA
AGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGG
GCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCG
TGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGTGGAATGGGCATCCCAGTGACTGCATCCCTCCCTCCACTTGAGTGGCCGCT
GTCCAGTCAGTCAGGCTCTTACGAGCTGCGGATCGAGGTGCAGCCCAAGCCACATCACCGGGCCCACTATGAGACAGAAGGCAGCCGAGG
GGCTGTCAAAGCTCCAACTGGAGGCCACCCTGTGGTTCAGCTCCATGGCTACATGGAAAACAAGCCTCTGGGACTTCAGATCTTCATTGG
GACAGCTGATGAGCGGATCCTTAAGCCGCACGCCTTCTACCAGGTGCACCGAATCACGGGGAAAACTGTCACCACCACCAGCTATGAGAA
GATAGTGGGCAACACCAAAGTCCTGGAGATACCCTTGGAGCCCAAAAACAACATGAGGGCAACCATCGACTGTGCGGGGATCTTGAAGCT
TAGAAACGCCGACATTGAGCTGCGGAAAGGCGAGACGGACATTGGAAGAAAGAACACGCGGGTGAGACTGGTTTTCCGAGTTCACATCCC
AGAGTCCAGTGGCAGAATCGTCTCTTTACAGACTGCATCTAACCCCATCGAGTGCTCCCAGCGATCTGCTCACGAGCTGCCCATGGTTGA
AAGACAAGACACAGACAGCTGCCTGGTCTATGGCGGCCAGCAAATGATCCTCACGGGGCAGAACTTTACATCCGAGTCCAAAGTTGTGTT
TACTGAGAAGACCACAGATGGACAGCAAATTTGGGAGATGGAAGCCACGGTGGATAAGGACAAGAGCCAGCCCAACATGCTTTTTGTTGA
GATCCCTGAATATCGGAACAAGCATATCCGCACACCTGTAAAAGTGAACTTCTACGTCATCAATGGGAAGAGAAAACGAAGTCAGCCTCA
GCACTTTACCTACCACCCAGTCCCAGCCATCAAGACGGAGCCCACGGATGAATATGACCCCACTCTGATCTGCAGCCCCACCCATGGAGG
CCTGGGGAGCCAGCCTTACTACCCCCAGCACCCGATGGTGGCCGAGTCCCCCTCCTGCCTCGTGGCCACCATGGCTCCCTGCCAGCAGTT
CCGCACGGGGCTCTCATCCCCTGACGCCCGCTACCAGCAACAGAACCCAGCGGCCGTACTCTACCAGCGGAGCAAGAGCCTGAGCCCCAG
CCTGCTGGGCTATCAGCAGCCGGCCCTCATGGCCGCCCCGCTGTCCCTTGCGGACGCTCACCGCTCTGTGCTGGTGCACGCCGGCTCCCA
GGGCCAGAGCTCAGCCCTGCTCCACCCCTCTCCGACCAACCAGCAGGCCTCGCCTGTGATCCACTACTCACCCACCAACCAGCAGCTGCG
CTGCGGAAGCCACCAGGAGTTCCAGCACATCATGTACTGCGAGAATTTCGCACCAGGCACCACCAGACCTGGCCCGCCCCCGGTCAGTCA
AGGTCAGAGGCTGAGCCCGGGTTCCTACCCCACAGTCATTCAGCAGCAGAATGCCACGAGCCAAAGAGCCGCCAAAAACGGACCCCCGGT
CAGTGACCAAAAGGAAGTATTACCTGCGGGGGTGACCATTAAACAGGAGCAGAACTTGGACCAGACCTACTTGGATGATGAGCTGATAGA
CACACACCTTAGCTGGATACAAAACATATTATGAAACAGAATGACTGTGATCTTTGATCCGAGAAATCAAAGTTAAAGTTAATGAAATTA
TCAGGAAGGAGTTTTCAGGACCTCCTGCCAGAAATCAGACGTAAAAGAAGCCATTATAGCAAGACACCTTCTGTATCTGACCCCTCGGAG
CCCTCCACAGCCCCTCACCTTCTGTCTCCTTTCATGTTCATCTCCCAGCCCGGAGTCCACACGCGGATCAATGTATGGGCACTAAGCGGA

>In-frame_EWSR1_ENST00000406548_chr22_29684775_+_NFATC2_ENST00000609507_chr20_50133495_-_2912nt
GCGGCGCCTAGAGGGAAAGCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTA
TAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACA
AAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTC
TTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGA
TACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCA
GCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAA
CCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATC
CTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAG
CTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCA
AGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGG
GCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCG
TGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGTGGAATGGGCATCCCAGTGACTGCATCCCTCCCTCCACTTGAGTGGCCGCT
GTCCAGTCAGTCAGGCTCTTACGAGCTGCGGATCGAGGTGCAGCCCAAGCCACATCACCGGGCCCACTATGAGACAGAAGGCAGCCGAGG
GGCTGTCAAAGCTCCAACTGGAGGCCACCCTGTGGTTCAGCTCCATGGCTACATGGAAAACAAGCCTCTGGGACTTCAGATCTTCATTGG
GACAGCTGATGAGCGGATCCTTAAGCCGCACGCCTTCTACCAGGTGCACCGAATCACGGGGAAAACTGTCACCACCACCAGCTATGAGAA
GATAGTGGGCAACACCAAAGTCCTGGAGATACCCTTGGAGCCCAAAAACAACATGAGGGCAACCATCGACTGTGCGGGGATCTTGAAGCT
TAGAAACGCCGACATTGAGCTGCGGAAAGGCGAGACGGACATTGGAAGAAAGAACACGCGGGTGAGACTGGTTTTCCGAGTTCACATCCC
AGAGTCCAGTGGCAGAATCGTCTCTTTACAGACTGCATCTAACCCCATCGAGTGCTCCCAGCGATCTGCTCACGAGCTGCCCATGGTTGA
AAGACAAGACACAGACAGCTGCCTGGTCTATGGCGGCCAGCAAATGATCCTCACGGGGCAGAACTTTACATCCGAGTCCAAAGTTGTGTT
TACTGAGAAGACCACAGATGGACAGCAAATTTGGGAGATGGAAGCCACGGTGGATAAGGACAAGAGCCAGCCCAACATGCTTTTTGTTGA
GATCCCTGAATATCGGAACAAGCATATCCGCACACCTGTAAAAGTGAACTTCTACGTCATCAATGGGAAGAGAAAACGAAGTCAGCCTCA
GCACTTTACCTACCACCCAGTCCCAGCCATCAAGACGGAGCCCACGGATGAATATGACCCCACTCTGATCTGCAGCCCCACCCATGGAGG
CCTGGGGAGCCAGCCTTACTACCCCCAGCACCCGATGGTGGCCGAGTCCCCCTCCTGCCTCGTGGCCACCATGGCTCCCTGCCAGCAGTT
CCGCACGGGGCTCTCATCCCCTGACGCCCGCTACCAGCAACAGAACCCAGCGGCCGTACTCTACCAGCGGAGCAAGAGCCTGAGCCCCAG
CCTGCTGGGCTATCAGCAGCCGGCCCTCATGGCCGCCCCGCTGTCCCTTGCGGACGCTCACCGCTCTGTGCTGGTGCACGCCGGCTCCCA
GGGCCAGAGCTCAGCCCTGCTCCACCCCTCTCCGACCAACCAGCAGGCCTCGCCTGTGATCCACTACTCACCCACCAACCAGCAGCTGCG
CTGCGGAAGCCACCAGGAGTTCCAGCACATCATGTACTGCGAGAATTTCGCACCAGGCACCACCAGACCTGGCCCGCCCCCGGTCAGTCA
AGGTCAGAGGCTGAGCCCGGGTTCCTACCCCACAGTCATTCAGCAGCAGAATGCCACGAGCCAAAGAGCCGCCAAAAACGGACCCCCGGT
CAGTGACCAAAAGGAAGTATTACCTGCGGGGGTGACCATTAAACAGGAGCAGAACTTGGACCAGACCTACTTGGATGATGAGCTGATAGA
CACACACCTTAGCTGGATACAAAACATATTATGAAACAGAATGACTGTGATCTTTGATCCGAGAAATCAAAGTTAAAGTTAATGAAATTA
TCAGGAAGGAGTTTTCAGGACCTCCTGCCAGAAATCAGACGTAAAAGAAGCCATTATAGCAAGACACCTTCTGTATCTGACCCCTCGGAG
CCCTCCACAGCCCCTCACCTTCTGTCTCCTTTCATGTTCATCTCCCAGCCCGGAGTCCACACGCGGATCAATGTATGGGCACTAAGCGGA

>In-frame_EWSR1_ENST00000414183_chr22_29684775_+_NFATC2_ENST00000371564_chr20_50133495_-_7158nt
AACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCC
CAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACC
CAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGTAGAAGGGACCAGTACAGGTTAT
ACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACC
ACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACA
AGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAG
AGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCT
ACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGT
CAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAG
AGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGA
CCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGG
GGAGGAGGACGCGGTGGAATGGGCATCCCAGTGACTGCATCCCTCCCTCCACTTGAGTGGCCGCTGTCCAGTCAGTCAGGCTCTTACGAG
CTGCGGATCGAGGTGCAGCCCAAGCCACATCACCGGGCCCACTATGAGACAGAAGGCAGCCGAGGGGCTGTCAAAGCTCCAACTGGAGGC
CACCCTGTGGTTCAGCTCCATGGCTACATGGAAAACAAGCCTCTGGGACTTCAGATCTTCATTGGGACAGCTGATGAGCGGATCCTTAAG
CCGCACGCCTTCTACCAGGTGCACCGAATCACGGGGAAAACTGTCACCACCACCAGCTATGAGAAGATAGTGGGCAACACCAAAGTCCTG
GAGATACCCTTGGAGCCCAAAAACAACATGAGGGCAACCATCGACTGTGCGGGGATCTTGAAGCTTAGAAACGCCGACATTGAGCTGCGG
AAAGGCGAGACGGACATTGGAAGAAAGAACACGCGGGTGAGACTGGTTTTCCGAGTTCACATCCCAGAGTCCAGTGGCAGAATCGTCTCT
TTACAGACTGCATCTAACCCCATCGAGTGCTCCCAGCGATCTGCTCACGAGCTGCCCATGGTTGAAAGACAAGACACAGACAGCTGCCTG
GTCTATGGCGGCCAGCAAATGATCCTCACGGGGCAGAACTTTACATCCGAGTCCAAAGTTGTGTTTACTGAGAAGACCACAGATGGACAG
CAAATTTGGGAGATGGAAGCCACGGTGGATAAGGACAAGAGCCAGCCCAACATGCTTTTTGTTGAGATCCCTGAATATCGGAACAAGCAT
ATCCGCACACCTGTAAAAGTGAACTTCTACGTCATCAATGGGAAGAGAAAACGAAGTCAGCCTCAGCACTTTACCTACCACCCAGTCCCA
GCCATCAAGACGGAGCCCACGGATGAATATGACCCCACTCTGATCTGCAGCCCCACCCATGGAGGCCTGGGGAGCCAGCCTTACTACCCC
CAGCACCCGATGGTGGCCGAGTCCCCCTCCTGCCTCGTGGCCACCATGGCTCCCTGCCAGCAGTTCCGCACGGGGCTCTCATCCCCTGAC
GCCCGCTACCAGCAACAGAACCCAGCGGCCGTACTCTACCAGCGGAGCAAGAGCCTGAGCCCCAGCCTGCTGGGCTATCAGCAGCCGGCC
CTCATGGCCGCCCCGCTGTCCCTTGCGGACGCTCACCGCTCTGTGCTGGTGCACGCCGGCTCCCAGGGCCAGAGCTCAGCCCTGCTCCAC
CCCTCTCCGACCAACCAGCAGGCCTCGCCTGTGATCCACTACTCACCCACCAACCAGCAGCTGCGCTGCGGAAGCCACCAGGAGTTCCAG
CACATCATGTACTGCGAGAATTTCGCACCAGGCACCACCAGACCTGGCCCGCCCCCGGTCAGTCAAGGTCAGAGGCTGAGCCCGGGTTCC
TACCCCACAGTCATTCAGCAGCAGAATGCCACGAGCCAAAGAGCCGCCAAAAACGGACCCCCGGTCAGTGACCAAAAGGAAGTATTACCT
GCGGGGGTGACCATTAAACAGGAGCAGAACTTGGACCAGACCTACTTGGATGATGAGCTGATAGACACACACCTTAGCTGGATACAAAAC
ATATTATGAAACAGAATGACTGTGATCTTTGATCCGAGAAATCAAAGTTAAAGTTAATGAAATTATCAGGAAGGAGTTTTCAGGACCTCC
TGCCAGAAATCAGACGTAAAAGAAGCCATTATAGCAAGACACCTTCTGTATCTGACCCCTCGGAGCCCTCCACAGCCCCTCACCTTCTGT
CTCCTTTCATGTTCATCTCCCAGCCCGGAGTCCACACGCGGATCAATGTATGGGCACTAAGCGGACTCTCACTTAAGGAGCTCGCCACCT
CCCTCTAAACACCAGAGAGAACTCTTCTTTTCGGTTTATGTTTTAAATCCCAGAGAGCATCCTGGTTGATCTTAATGGTGTTCCGTCCAA
ATAGTAAGCACCTGCTGACCAAAAGCACATTCTACATGAGACAGGACACTGGAACTCTCCTGAGAACAGAGTGACTGGAGCTTGGGGGGA
TGGACGGGGGACAGAAGATGTGGGCACTGTGATTAAACCCCAGCCCTTGCGTTCGTTTTTCCAGGTCACAGATACAGCTCCTGTACCTTT
TGAAGGCAAGGAGTTCTCAGAGCAACCAAAGGAACGTGACCCAAGAGCCCAGCTTACAGGCTGAAGAAACCCAAAACCCTCGATAGAGAC
AGAAACTGAACTGTCAGTCCTTAGAGCTCGCCCAGTCCATGCCACAACTGGGCCACAGCTAAAGCTTTATTTTTGAATTCTCATTCCAAA
ACCAAACTGTCTTGCCCAGACAAGATCACCTGTTAAGACTTCTTGGCGTTAAGTTATGACATGTATACGCGTTTGTTATTATTATTTTTT
CTGCTTTAAAAGGCTGACCAGGGCACCTAGCCCTGGAGCTGTCTTGGCGAGCTGTTCTTTAACCCCTGCAGCACGCAGTCCTGCTAACAC
AATTTCCATAGACTTGGGGGGCTGACCCAGGCTGCAGAGAGCAAGCACCTGTCTGCTGCAGCTGTACAACCTGGATGCTTTGCAAGGTTC
CGGCTTGCTTTCTTCCTAGCAGCCAGAGTGCTTTTCCGTAAAGCGGTGGAGAATCTCAAGCATGTGCATTTAATTGAGGAATAGCAGAAG
GGCTAAAGCAACCAAGAAAAGAAGTGTGGGTATTTTTGTTAAGTAAAACAGCCCAAGTGCTTCTGGAGGTGGGTTTCTACCAAGATAGAG
GAAAAGGGCTGAATTCCCTCTAAGTGGGACAGCCGAGCTCAGGATGTGCTTCCCAGCTTCACTGGTTAATTTGACCTGAACCTATTTAAA
GATCCCTTCTGCCCCTGAAGACCTATCCGCACTCAAATTCTAACATGAAGAAATCTACTCGAATGCATCCTTTACTTTGAATGAGCTCTA
TTCGGTTGCATGTTATATGTGATTTCCTTCCTCCCAACTGTTTCCACTGAGCGCACCCAGTCTCCCCTAGTCTTCCTCTGTGGGTGTGAT
TTTTGTGATTTTTACAAACAAAACCCTTGAAGTTCTTGGCAGATGTGTTTGTTTCTGTTTGCATGTACTGCAGATACCCCAGGACAAGCG
GGGGATTCATTTTTCAGCCATTCAGTTGTTTCCTCAATAATCCGCAGCAAAGTGAAAATATTCTTAGCACTCAGACTGTACTTAGAGTGT
TTTCTCAGTCCAGTCTGTACAGTCTGTAGGCAGAAGGCCTCAGAAGAAAGTCATGGCCACTCAGTGCCCACTGTGGGCTTTGTAAGTCCT
GGCTCTCCCGTCAAGGTTACCCAGAGGTAAAAGCTTCCTGGGAGTGGGGCCAGGTGTGTTTGGCACTCCAGATAGAAGGCAAAATGCTCA
GATTCGGGCCTGTGCACTTGTATGCAACCTGTCGGTCGATACCTAGCATTTATTTTTCCCTGACAATGAACGACCTTTCCCTCACCCACC
CTAAGCTCAAAGAGTTTAGCAAAATTCTCTTTTAAATAAACAGAATGCCAGTAAGAGGTTGACCCCTACCATGGAACTTCTGGGATGCTA
AATACTTCCTCATGAACAAAATAAGTTCCTTATTATAAGTTCCTTATACTAGCAGCTTCACCTAAAGAATTTTCTCTCCAGCAATATTGA
CTTCACTGGGGAAAAGCCAAGAGTGTGTGGTGAGTGATTTGTTCTCACTCGACCTGGCTAGGACTGGCTAGGAGCTGTTTTTTGTACATG
AGGGAATTTGGGCTTTCCTCAGTTATCTGAATGTTTTACCCAAGTGCCTTCCTGCTATTGTAGCAAAGTAGCTCAGCTTCCTTGTCCACA
GGGTGAAAAAGGACTAATGCATTTTCCATCAGTTTTCTAACTATGTTAGCAAAAACGGCCTCCTGGTAGCTCAACCTCCTGTACGCGTGT
GTGTGTGTAATACACACACAAATAAACCCCTCTGTTTTTCTAAGACATCTTAGCTGGATATTATAGGAAGCACTTTCATAAACAACTGTA
ACAAATCGCAAAGGAAAGAGAAACAAAAGCATTAGATTTGAGACATAAACAGGCAAGAGAAAGTGTATTAGGAACTGACAGCTATCAAGG
AAGTTTTGTCAGTTACAAATGCTAGGAGGAAATTTTGCCAAGAAGGATGGCTCATGAAATATTTCCAGTACGGGAAGAGGCAATAAGATC
CTCTAAGAGAATGAGAAAGTAGGGGTGTCTAAATGGTAAAGATGGGTGTGTTGCACGTGTGTTAGAAGGATCTCAGTTGAGTGAAGGTTT
GCACTGCTACATCTAAGTTAATGTAAATATGTAGCACTCTGACAGGTCTACCGTGTTGCTGAATGTAGTATATTTCCAAAGTTTGCAAGT
CTTCCTGTATTGTACAAAGATGCTGCTGCTTGATAATATGTATAGCAATCCAGATTAGTATGTTATTAAATTTTATTTTCTTACCTGTAT
TTTTATGCTTTTTACCTGTCCTCAAAATATTACACCCCTGTTGGAATTAGATTTATATTTATAAATGGTCAGAAATCTTTTTAAGTGTCT
CTTTTTACACATAGGTTGATTTTTTTTTCTTAAGAGAAATGATGTATTCTTGAAACATTTGTTACTCATTCCAGGAAACAAAAACCCATA
TAATAAAACCCCCACTCAGAGCCTGTTAGTCACCTCTCTAGAAGATGGCATCTCAGGAGAAGGAATGGCTTTGTGGAAGAAGGAATCACC
TTTTTCTTGCTCAAGAATTATGCTGACTTCAGCCCTGAGCCTGGATCTGGTCACTGAGAATCATCAAGTGTCTAGATCCTCCCCCCAAAA
TAACTAATTTAGTAGGTGATTTTGATTTTAAAAAATTGACACCAAAACCCTGCCTGCATTGTAATGGAATTCGAAAAGAATTCATGTTCA
CAGAACTCAACGTTCAGGCTAATATTTACAGAAGGGACCAAATCTAAATCCTGGTAGATAACTCCTGTATGCTTTATCCAAAGGACACCC
ACAGTTTTCCAGCATAGATATAACCAAGGATGAATTGATTCCTTCAAAGAACTGGGAGGCACGGATATTGCATTTTTTGTTTACATCCAG
TAGCCAAGACGCCTCAGTGAGCCAGTCTTGGGCAGAGGCTGTCACATTTAGGCAGATTGGAAGTTGGTATGTTCTAATTCTCACTCTGGA
CTACAGTGAGGCTGAATTTATCATGTCAAAAAAAAAAAAAAAAAAAGACCTTTCCAAGTGCTTTCTATTGCTCAGAATTGAAAGAATGTT
TTCATTTCAAGTTTACAAGAGGCATGGATGGAGTTGTGACGTTCTTGACAAGCTGGGCTAACCTTTCCCGAACTTGTTTCCCGGAGGCAA
GGTGCTCGGTGACCCAGCGCATCTTAACCTTGGGTCTCCTAGGCTCGAGGCTAGGGCATTACGTTTCGTGGAACCAAAGCAGCCAATTGC
ATAGCAAGTATTTTCCTGCATTCCAATTAAATGCTTAAGAAAAAGCAGCATCCTATAAAATTGTGATCATAAACATCCATTTCCCTCAGC
TTTTGTGAGTGCCTTGACTTACAGCCAACATCACTGTTTAACTCAGTCTGTTTAAAAACAAACTTTTCTGGTGGTTGATAACAGAGAGTT
GCTCCCTGAGCCATCAGGGTCCTGGGAGCTGGAAGTGAAAGGGTTATTAACATTCTACCTTTATGCAGCTGTTGGCTGACCAGAATAAAC
TCCCTGCTGAGTTCAAGCTTTGAATGGAATGGATGCAAATGATGTTGTTTCCATTAGAGCAGGTGCTCACAGCATTCTGATTGGCCTGAG
CAGACCGAGGCTATGGCTGTTGGGACAAGCTTAGCATCCTGGACATCTTGTCAAAGAACCTCACTCACCCCTCTGGCCTCTACAGCCCTC
AGAGGAGAGAAAACCAATTCTCCAACAAACAGGTCTCTCCAACATGGTGGTGCTGGCAGGCTTAGGTTTAGAAAATCCTGACTGTTAAAG
GCGTTTGAATACATCACATTCCTATGCAAATGTTTTTAATCTCCAGTTTAATGTAGTTTATTTTTCCTATATGTAAAGTATTTTTATACG

>In-frame_EWSR1_ENST00000414183_chr22_29684775_+_NFATC2_ENST00000396009_chr20_50133495_-_7070nt
AACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCC
CAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACC
CAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGTAGAAGGGACCAGTACAGGTTAT
ACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACC
ACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACA
AGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAG
AGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCT
ACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGT
CAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAG
AGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGA
CCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGG
GGAGGAGGACGCGGTGGAATGGGCATCCCAGTGACTGCATCCCTCCCTCCACTTGAGTGGCCGCTGTCCAGTCAGTCAGGCTCTTACGAG
CTGCGGATCGAGGTGCAGCCCAAGCCACATCACCGGGCCCACTATGAGACAGAAGGCAGCCGAGGGGCTGTCAAAGCTCCAACTGGAGGC
CACCCTGTGGTTCAGCTCCATGGCTACATGGAAAACAAGCCTCTGGGACTTCAGATCTTCATTGGGACAGCTGATGAGCGGATCCTTAAG
CCGCACGCCTTCTACCAGGTGCACCGAATCACGGGGAAAACTGTCACCACCACCAGCTATGAGAAGATAGTGGGCAACACCAAAGTCCTG
GAGATACCCTTGGAGCCCAAAAACAACATGAGGGCAACCATCGACTGTGCGGGGATCTTGAAGCTTAGAAACGCCGACATTGAGCTGCGG
AAAGGCGAGACGGACATTGGAAGAAAGAACACGCGGGTGAGACTGGTTTTCCGAGTTCACATCCCAGAGTCCAGTGGCAGAATCGTCTCT
TTACAGACTGCATCTAACCCCATCGAGTGCTCCCAGCGATCTGCTCACGAGCTGCCCATGGTTGAAAGACAAGACACAGACAGCTGCCTG
GTCTATGGCGGCCAGCAAATGATCCTCACGGGGCAGAACTTTACATCCGAGTCCAAAGTTGTGTTTACTGAGAAGACCACAGATGGACAG
CAAATTTGGGAGATGGAAGCCACGGTGGATAAGGACAAGAGCCAGCCCAACATGCTTTTTGTTGAGATCCCTGAATATCGGAACAAGCAT
ATCCGCACACCTGTAAAAGTGAACTTCTACGTCATCAATGGGAAGAGAAAACGAAGTCAGCCTCAGCACTTTACCTACCACCCAGTCCCA
GCCATCAAGACGGAGCCCACGGATGAATATGACCCCACTCTGATCTGCAGCCCCACCCATGGAGGCCTGGGGAGCCAGCCTTACTACCCC
CAGCACCCGATGGTGGCCGAGTCCCCCTCCTGCCTCGTGGCCACCATGGCTCCCTGCCAGCAGTTCCGCACGGGGCTCTCATCCCCTGAC
GCCCGCTACCAGCAACAGAACCCAGCGGCCGTACTCTACCAGCGGAGCAAGAGCCTGAGCCCCAGCCTGCTGGGCTATCAGCAGCCGGCC
CTCATGGCCGCCCCGCTGTCCCTTGCGGACGCTCACCGCTCTGTGCTGGTGCACGCCGGCTCCCAGGGCCAGAGCTCAGCCCTGCTCCAC
CCCTCTCCGACCAACCAGCAGGCCTCGCCTGTGATCCACTACTCACCCACCAACCAGCAGCTGCGCTGCGGAAGCCACCAGGAGTTCCAG
CACATCATGTACTGCGAGAATTTCGCACCAGGCACCACCAGACCTGGCCCGCCCCCGGTCAGTCAAGGTCAGAGGCTGAGCCCGGGTTCC
TACCCCACAGTCATTCAGCAGCAGAATGCCACGAGCCAAAGAGCCGCCAAAAACGGACCCCCGGTCAGTGACCAAAAGGAAGTATTACCT
GCGGGGGTGACCATTAAACAGGAGCAGAACTTGGACCAGACCTACTTGGATGATGTTAATGAAATTATCAGGAAGGAGTTTTCAGGACCT
CCTGCCAGAAATCAGACGTAAAAGAAGCCATTATAGCAAGACACCTTCTGTATCTGACCCCTCGGAGCCCTCCACAGCCCCTCACCTTCT
GTCTCCTTTCATGTTCATCTCCCAGCCCGGAGTCCACACGCGGATCAATGTATGGGCACTAAGCGGACTCTCACTTAAGGAGCTCGCCAC
CTCCCTCTAAACACCAGAGAGAACTCTTCTTTTCGGTTTATGTTTTAAATCCCAGAGAGCATCCTGGTTGATCTTAATGGTGTTCCGTCC
AAATAGTAAGCACCTGCTGACCAAAAGCACATTCTACATGAGACAGGACACTGGAACTCTCCTGAGAACAGAGTGACTGGAGCTTGGGGG
GATGGACGGGGGACAGAAGATGTGGGCACTGTGATTAAACCCCAGCCCTTGCGTTCGTTTTTCCAGGTCACAGATACAGCTCCTGTACCT
TTTGAAGGCAAGGAGTTCTCAGAGCAACCAAAGGAACGTGACCCAAGAGCCCAGCTTACAGGCTGAAGAAACCCAAAACCCTCGATAGAG
ACAGAAACTGAACTGTCAGTCCTTAGAGCTCGCCCAGTCCATGCCACAACTGGGCCACAGCTAAAGCTTTATTTTTGAATTCTCATTCCA
AAACCAAACTGTCTTGCCCAGACAAGATCACCTGTTAAGACTTCTTGGCGTTAAGTTATGACATGTATACGCGTTTGTTATTATTATTTT
TTCTGCTTTAAAAGGCTGACCAGGGCACCTAGCCCTGGAGCTGTCTTGGCGAGCTGTTCTTTAACCCCTGCAGCACGCAGTCCTGCTAAC
ACAATTTCCATAGACTTGGGGGGCTGACCCAGGCTGCAGAGAGCAAGCACCTGTCTGCTGCAGCTGTACAACCTGGATGCTTTGCAAGGT
TCCGGCTTGCTTTCTTCCTAGCAGCCAGAGTGCTTTTCCGTAAAGCGGTGGAGAATCTCAAGCATGTGCATTTAATTGAGGAATAGCAGA
AGGGCTAAAGCAACCAAGAAAAGAAGTGTGGGTATTTTTGTTAAGTAAAACAGCCCAAGTGCTTCTGGAGGTGGGTTTCTACCAAGATAG
AGGAAAAGGGCTGAATTCCCTCTAAGTGGGACAGCCGAGCTCAGGATGTGCTTCCCAGCTTCACTGGTTAATTTGACCTGAACCTATTTA
AAGATCCCTTCTGCCCCTGAAGACCTATCCGCACTCAAATTCTAACATGAAGAAATCTACTCGAATGCATCCTTTACTTTGAATGAGCTC
TATTCGGTTGCATGTTATATGTGATTTCCTTCCTCCCAACTGTTTCCACTGAGCGCACCCAGTCTCCCCTAGTCTTCCTCTGTGGGTGTG
ATTTTTGTGATTTTTACAAACAAAACCCTTGAAGTTCTTGGCAGATGTGTTTGTTTCTGTTTGCATGTACTGCAGATACCCCAGGACAAG
CGGGGGATTCATTTTTCAGCCATTCAGTTGTTTCCTCAATAATCCGCAGCAAAGTGAAAATATTCTTAGCACTCAGACTGTACTTAGAGT
GTTTTCTCAGTCCAGTCTGTACAGTCTGTAGGCAGAAGGCCTCAGAAGAAAGTCATGGCCACTCAGTGCCCACTGTGGGCTTTGTAAGTC
CTGGCTCTCCCGTCAAGGTTACCCAGAGGTAAAAGCTTCCTGGGAGTGGGGCCAGGTGTGTTTGGCACTCCAGATAGAAGGCAAAATGCT
CAGATTCGGGCCTGTGCACTTGTATGCAACCTGTCGGTCGATACCTAGCATTTATTTTTCCCTGACAATGAACGACCTTTCCCTCACCCA
CCCTAAGCTCAAAGAGTTTAGCAAAATTCTCTTTTAAATAAACAGAATGCCAGTAAGAGGTTGACCCCTACCATGGAACTTCTGGGATGC
TAAATACTTCCTCATGAACAAAATAAGTTCCTTATTATAAGTTCCTTATACTAGCAGCTTCACCTAAAGAATTTTCTCTCCAGCAATATT
GACTTCACTGGGGAAAAGCCAAGAGTGTGTGGTGAGTGATTTGTTCTCACTCGACCTGGCTAGGACTGGCTAGGAGCTGTTTTTTGTACA
TGAGGGAATTTGGGCTTTCCTCAGTTATCTGAATGTTTTACCCAAGTGCCTTCCTGCTATTGTAGCAAAGTAGCTCAGCTTCCTTGTCCA
CAGGGTGAAAAAGGACTAATGCATTTTCCATCAGTTTTCTAACTATGTTAGCAAAAACGGCCTCCTGGTAGCTCAACCTCCTGTACGCGT
GTGTGTGTGTAATACACACACAAATAAACCCCTCTGTTTTTCTAAGACATCTTAGCTGGATATTATAGGAAGCACTTTCATAAACAACTG
TAACAAATCGCAAAGGAAAGAGAAACAAAAGCATTAGATTTGAGACATAAACAGGCAAGAGAAAGTGTATTAGGAACTGACAGCTATCAA
GGAAGTTTTGTCAGTTACAAATGCTAGGAGGAAATTTTGCCAAGAAGGATGGCTCATGAAATATTTCCAGTACGGGAAGAGGCAATAAGA
TCCTCTAAGAGAATGAGAAAGTAGGGGTGTCTAAATGGTAAAGATGGGTGTGTTGCACGTGTGTTAGAAGGATCTCAGTTGAGTGAAGGT
TTGCACTGCTACATCTAAGTTAATGTAAATATGTAGCACTCTGACAGGTCTACCGTGTTGCTGAATGTAGTATATTTCCAAAGTTTGCAA
GTCTTCCTGTATTGTACAAAGATGCTGCTGCTTGATAATATGTATAGCAATCCAGATTAGTATGTTATTAAATTTTATTTTCTTACCTGT
ATTTTTATGCTTTTTACCTGTCCTCAAAATATTACACCCCTGTTGGAATTAGATTTATATTTATAAATGGTCAGAAATCTTTTTAAGTGT
CTCTTTTTACACATAGGTTGATTTTTTTTTCTTAAGAGAAATGATGTATTCTTGAAACATTTGTTACTCATTCCAGGAAACAAAAACCCA
TATAATAAAACCCCCACTCAGAGCCTGTTAGTCACCTCTCTAGAAGATGGCATCTCAGGAGAAGGAATGGCTTTGTGGAAGAAGGAATCA
CCTTTTTCTTGCTCAAGAATTATGCTGACTTCAGCCCTGAGCCTGGATCTGGTCACTGAGAATCATCAAGTGTCTAGATCCTCCCCCCAA
AATAACTAATTTAGTAGGTGATTTTGATTTTAAAAAATTGACACCAAAACCCTGCCTGCATTGTAATGGAATTCGAAAAGAATTCATGTT
CACAGAACTCAACGTTCAGGCTAATATTTACAGAAGGGACCAAATCTAAATCCTGGTAGATAACTCCTGTATGCTTTATCCAAAGGACAC
CCACAGTTTTCCAGCATAGATATAACCAAGGATGAATTGATTCCTTCAAAGAACTGGGAGGCACGGATATTGCATTTTTTGTTTACATCC
AGTAGCCAAGACGCCTCAGTGAGCCAGTCTTGGGCAGAGGCTGTCACATTTAGGCAGATTGGAAGTTGGTATGTTCTAATTCTCACTCTG
GACTACAGTGAGGCTGAATTTATCATGTCAAAAAAAAAAAAAAAAAAAGACCTTTCCAAGTGCTTTCTATTGCTCAGAATTGAAAGAATG
TTTTCATTTCAAGTTTACAAGAGGCATGGATGGAGTTGTGACGTTCTTGACAAGCTGGGCTAACCTTTCCCGAACTTGTTTCCCGGAGGC
AAGGTGCTCGGTGACCCAGCGCATCTTAACCTTGGGTCTCCTAGGCTCGAGGCTAGGGCATTACGTTTCGTGGAACCAAAGCAGCCAATT
GCATAGCAAGTATTTTCCTGCATTCCAATTAAATGCTTAAGAAAAAGCAGCATCCTATAAAATTGTGATCATAAACATCCATTTCCCTCA
GCTTTTGTGAGTGCCTTGACTTACAGCCAACATCACTGTTTAACTCAGTCTGTTTAAAAACAAACTTTTCTGGTGGTTGATAACAGAGAG
TTGCTCCCTGAGCCATCAGGGTCCTGGGAGCTGGAAGTGAAAGGGTTATTAACATTCTACCTTTATGCAGCTGTTGGCTGACCAGAATAA
ACTCCCTGCTGAGTTCAAGCTTTGAATGGAATGGATGCAAATGATGTTGTTTCCATTAGAGCAGGTGCTCACAGCATTCTGATTGGCCTG
AGCAGACCGAGGCTATGGCTGTTGGGACAAGCTTAGCATCCTGGACATCTTGTCAAAGAACCTCACTCACCCCTCTGGCCTCTACAGCCC
TCAGAGGAGAGAAAACCAATTCTCCAACAAACAGGTCTCTCCAACATGGTGGTGCTGGCAGGCTTAGGTTTAGAAAATCCTGACTGTTAA
AGGCGTTTGAATACATCACATTCCTATGCAAATGTTTTTAATCTCCAGTTTAATGTAGTTTATTTTTCCTATATGTAAAGTATTTTTATA

>In-frame_EWSR1_ENST00000414183_chr22_29684775_+_NFATC2_ENST00000609943_chr20_50133495_-_5401nt
AACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCC
CAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACC
CAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGTAGAAGGGACCAGTACAGGTTAT
ACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACC
ACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACA
AGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAG
AGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCT
ACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGT
CAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAG
AGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGA
CCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGG
GGAGGAGGACGCGGTGGAATGGGCATCCCAGTGACTGCATCCCTCCCTCCACTTGAGTGGCCGCTGTCCAGTCAGTCAGGCTCTTACGAG
CTGCGGATCGAGGTGCAGCCCAAGCCACATCACCGGGCCCACTATGAGACAGAAGGCAGCCGAGGGGCTGTCAAAGCTCCAACTGGAGGC
CACCCTGTGGTTCAGCTCCATGGCTACATGGAAAACAAGCCTCTGGGACTTCAGATCTTCATTGGGACAGCTGATGAGCGGATCCTTAAG
CCGCACGCCTTCTACCAGGTGCACCGAATCACGGGGAAAACTGTCACCACCACCAGCTATGAGAAGATAGTGGGCAACACCAAAGTCCTG
GAGATACCCTTGGAGCCCAAAAACAACATGAGGGCAACCATCGACTGTGCGGGGATCTTGAAGCTTAGAAACGCCGACATTGAGCTGCGG
AAAGGCGAGACGGACATTGGAAGAAAGAACACGCGGGTGAGACTGGTTTTCCGAGTTCACATCCCAGAGTCCAGTGGCAGAATCGTCTCT
TTACAGACTGCATCTAACCCCATCGAGTGCTCCCAGCGATCTGCTCACGAGCTGCCCATGGTTGAAAGACAAGACACAGACAGCTGCCTG
GTCTATGGCGGCCAGCAAATGATCCTCACGGGGCAGAACTTTACATCCGAGTCCAAAGTTGTGTTTACTGAGAAGACCACAGATGGACAG
CAAATTTGGGAGATGGAAGCCACGGTGGATAAGGACAAGAGCCAGCCCAACATGCTTTTTGTTGAGATCCCTGAATATCGGAACAAGCAT
ATCCGCACACCTGTAAAAGTGAACTTCTACGTCATCAATGGGAAGAGAAAACGAAGTCAGCCTCAGCACTTTACCTACCACCCAGTCCCA
GCCATCAAGACGGAGCCCACGGATGAATATGACCCCACTCTGATCTGCAGCCCCACCCATGGAGGCCTGGGGAGCCAGCCTTACTACCCC
CAGCACCCGATGGTGGCCGAGTCCCCCTCCTGCCTCGTGGCCACCATGGCTCCCTGCCAGCAGTTCCGCACGGGGCTCTCATCCCCTGAC
GCCCGCTACCAGCAACAGAACCCAGCGGCCGTACTCTACCAGCGGAGCAAGAGCCTGAGCCCCAGCCTGCTGGGCTATCAGCAGCCGGCC
CTCATGGCCGCCCCGCTGTCCCTTGCGGACGCTCACCGCTCTGTGCTGGTGCACGCCGGCTCCCAGGGCCAGAGCTCAGCCCTGCTCCAC
CCCTCTCCGACCAACCAGCAGGCCTCGCCTGTGATCCACTACTCACCCACCAACCAGCAGCTGCGCTGCGGAAGCCACCAGGAGTTCCAG
CACATCATGTACTGCGAGAATTTCGCACCAGGCACCACCAGACCTGGCCCGCCCCCGGTCAGTCAAGGTCAGAGGCTGAGCCCGGGTTCC
TACCCCACAGTCATTCAGCAGCAGAATGCCACGAGCCAAAGAGCCGCCAAAAACGGACCCCCGGTCAGTGACCAAAAGGAAGTATTACCT
GCGGGGGTGACCATTAAACAGGAGCAGAACTTGGACCAGACCTACTTGGATGATGTTAATGAAATTATCAGGAAGGAGTTTTCAGGACCT
CCTGCCAGAAATCAGACGTAAAAGAAGCCATTATAGCAAGACACCTTCTGTATCTGACCCCTCGGAGCCCTCCACAGCCCCTCACCTTCT
GTCTCCTTTCATGTTCATCTCCCAGCCCGGAGTCCACACGCGGATCAATGTATGGGCACTAAGCGGACTCTCACTTAAGGAGCTCGCCAC
CTCCCTCTAAACACCAGAGAGAACTCTTCTTTTCGGTTTATGTTTTAAATCCCAGAGAGCATCCTGGTTGATCTTAATGGTGTTCCGTCC
AAATAGTAAGCACCTGCTGACCAAAAGCACATTCTACATGAGACAGGACACTGGAACTCTCCTGAGAACAGAGTGACTGGAGCTTGGGGG
GATGGACGGGGGACAGAAGATGTGGGCACTGTGATTAAACCCCAGCCCTTGCGTTCGTTTTTCCAGGTCACAGATACAGCTCCTGTACCT
TTTGAAGGCAAGGAGTTCTCAGAGCAACCAAAGGAACGTGACCCAAGAGCCCAGCTTACAGGCTGAAGAAACCCAAAACCCTCGATAGAG
ACAGAAACTGAACTGTCAGTCCTTAGAGCTCGCCCAGTCCATGCCACAACTGGGCCACAGCTAAAGCTTTATTTTTGAATTCTCATTCCA
AAACCAAACTGTCTTGCCCAGACAAGATCACCTGTTAAGACTTCTTGGCGTTAAGTTATGACATGTATACGCGTTTGTTATTATTATTTT
TTCTGCTTTAAAAGGCTGACCAGGGCACCTAGCCCTGGAGCTGTCTTGGCGAGCTGTTCTTTAACCCCTGCAGCACGCAGTCCTGCTAAC
ACAATTTCCATAGACTTGGGGGGCTGACCCAGGCTGCAGAGAGCAAGCACCTGTCTGCTGCAGCTGTACAACCTGGATGCTTTGCAAGGT
TCCGGCTTGCTTTCTTCCTAGCAGCCAGAGTGCTTTTCCGTAAAGCGGTGGAGAATCTCAAGCATGTGCATTTAATTGAGGAATAGCAGA
AGGGCTAAAGCAACCAAGAAAAGAAGTGTGGGTATTTTTGTTAAGTAAAACAGCCCAAGTGCTTCTGGAGGTGGGTTTCTACCAAGATAG
AGGAAAAGGGCTGAATTCCCTCTAAGTGGGACAGCCGAGCTCAGGATGTGCTTCCCAGCTTCACTGGTTAATTTGACCTGAACCTATTTA
AAGATCCCTTCTGCCCCTGAAGACCTATCCGCACTCAAATTCTAACATGAAGAAATCTACTCGAATGCATCCTTTACTTTGAATGAGCTC
TATTCGGTTGCATGTTATATGTGATTTCCTTCCTCCCAACTGTTTCCACTGAGCGCACCCAGTCTCCCCTAGTCTTCCTCTGTGGGTGTG
ATTTTTGTGATTTTTACAAACAAAACCCTTGAAGTTCTTGGCAGATGTGTTTGTTTCTGTTTGCATGTACTGCAGATACCCCAGGACAAG
CGGGGGATTCATTTTTCAGCCATTCAGTTGTTTCCTCAATAATCCGCAGCAAAGTGAAAATATTCTTAGCACTCAGACTGTACTTAGAGT
GTTTTCTCAGTCCAGTCTGTACAGTCTGTAGGCAGAAGGCCTCAGAAGAAAGTCATGGCCACTCAGTGCCCACTGTGGGCTTTGTAAGTC
CTGGCTCTCCCGTCAAGGTTACCCAGAGGTAAAAGCTTCCTGGGAGTGGGGCCAGGTGTGTTTGGCACTCCAGATAGAAGGCAAAATGCT
CAGATTCGGGCCTGTGCACTTGTATGCAACCTGTCGGTCGATACCTAGCATTTATTTTTCCCTGACAATGAACGACCTTTCCCTCACCCA
CCCTAAGCTCAAAGAGTTTAGCAAAATTCTCTTTTAAATAAACAGAATGCCAGTAAGAGGTTGACCCCTACCATGGAACTTCTGGGATGC
TAAATACTTCCTCATGAACAAAATAAGTTCCTTATTATAAGTTCCTTATACTAGCAGCTTCACCTAAAGAATTTTCTCTCCAGCAATATT
GACTTCACTGGGGAAAAGCCAAGAGTGTGTGGTGAGTGATTTGTTCTCACTCGACCTGGCTAGGACTGGCTAGGAGCTGTTTTTTGTACA
TGAGGGAATTTGGGCTTTCCTCAGTTATCTGAATGTTTTACCCAAGTGCCTTCCTGCTATTGTAGCAAAGTAGCTCAGCTTCCTTGTCCA
CAGGGTGAAAAAGGACTAATGCATTTTCCATCAGTTTTCTAACTATGTTAGCAAAAACGGCCTCCTGGTAGCTCAACCTCCTGTACGCGT
GTGTGTGTGTAATACACACACAAATAAACCCCTCTGTTTTTCTAAGACATCTTAGCTGGATATTATAGGAAGCACTTTCATAAACAACTG
TAACAAATCGCAAAGGAAAGAGAAACAAAAGCATTAGATTTGAGACATAAACAGGCAAGAGAAAGTGTATTAGGAACTGACAGCTATCAA
GGAAGTTTTGTCAGTTACAAATGCTAGGAGGAAATTTTGCCAAGAAGGATGGCTCATGAAATATTTCCAGTACGGGAAGAGGCAATAAGA
TCCTCTAAGAGAATGAGAAAGTAGGGGTGTCTAAATGGTAAAGATGGGTGTGTTGCACGTGTGTTAGAAGGATCTCAGTTGAGTGAAGGT
TTGCACTGCTACATCTAAGTTAATGTAAATATGTAGCACTCTGACAGGTCTACCGTGTTGCTGAATGTAGTATATTTCCAAAGTTTGCAA
GTCTTCCTGTATTGTACAAAGATGCTGCTGCTTGATAATATGTATAGCAATCCAGATTAGTATGTTATTAAATTTTATTTTCTTACCTGT

>In-frame_EWSR1_ENST00000414183_chr22_29684775_+_NFATC2_ENST00000610033_chr20_50133495_-_2887nt
AACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCC
CAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACC
CAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGTAGAAGGGACCAGTACAGGTTAT
ACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACC
ACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACA
AGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAG
AGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCT
ACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGT
CAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAG
AGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGA
CCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGG
GGAGGAGGACGCGGTGGAATGGGCATCCCAGTGACTGCATCCCTCCCTCCACTTGAGTGGCCGCTGTCCAGTCAGTCAGGCTCTTACGAG
CTGCGGATCGAGGTGCAGCCCAAGCCACATCACCGGGCCCACTATGAGACAGAAGGCAGCCGAGGGGCTGTCAAAGCTCCAACTGGAGGC
CACCCTGTGGTTCAGCTCCATGGCTACATGGAAAACAAGCCTCTGGGACTTCAGATCTTCATTGGGACAGCTGATGAGCGGATCCTTAAG
CCGCACGCCTTCTACCAGGTGCACCGAATCACGGGGAAAACTGTCACCACCACCAGCTATGAGAAGATAGTGGGCAACACCAAAGTCCTG
GAGATACCCTTGGAGCCCAAAAACAACATGAGGGCAACCATCGACTGTGCGGGGATCTTGAAGCTTAGAAACGCCGACATTGAGCTGCGG
AAAGGCGAGACGGACATTGGAAGAAAGAACACGCGGGTGAGACTGGTTTTCCGAGTTCACATCCCAGAGTCCAGTGGCAGAATCGTCTCT
TTACAGACTGCATCTAACCCCATCGAGTGCTCCCAGCGATCTGCTCACGAGCTGCCCATGGTTGAAAGACAAGACACAGACAGCTGCCTG
GTCTATGGCGGCCAGCAAATGATCCTCACGGGGCAGAACTTTACATCCGAGTCCAAAGTTGTGTTTACTGAGAAGACCACAGATGGACAG
CAAATTTGGGAGATGGAAGCCACGGTGGATAAGGACAAGAGCCAGCCCAACATGCTTTTTGTTGAGATCCCTGAATATCGGAACAAGCAT
ATCCGCACACCTGTAAAAGTGAACTTCTACGTCATCAATGGGAAGAGAAAACGAAGTCAGCCTCAGCACTTTACCTACCACCCAGTCCCA
GCCATCAAGACGGAGCCCACGGATGAATATGACCCCACTCTGATCTGCAGCCCCACCCATGGAGGCCTGGGGAGCCAGCCTTACTACCCC
CAGCACCCGATGGTGGCCGAGTCCCCCTCCTGCCTCGTGGCCACCATGGCTCCCTGCCAGCAGTTCCGCACGGGGCTCTCATCCCCTGAC
GCCCGCTACCAGCAACAGAACCCAGCGGCCGTACTCTACCAGCGGAGCAAGAGCCTGAGCCCCAGCCTGCTGGGCTATCAGCAGCCGGCC
CTCATGGCCGCCCCGCTGTCCCTTGCGGACGCTCACCGCTCTGTGCTGGTGCACGCCGGCTCCCAGGGCCAGAGCTCAGCCCTGCTCCAC
CCCTCTCCGACCAACCAGCAGGCCTCGCCTGTGATCCACTACTCACCCACCAACCAGCAGCTGCGCTGCGGAAGCCACCAGGAGTTCCAG
CACATCATGTACTGCGAGAATTTCGCACCAGGCACCACCAGACCTGGCCCGCCCCCGGTCAGTCAAGGTCAGAGGCTGAGCCCGGGTTCC
TACCCCACAGTCATTCAGCAGCAGAATGCCACGAGCCAAAGAGCCGCCAAAAACGGACCCCCGGTCAGTGACCAAAAGGAAGTATTACCT
GCGGGGGTGACCATTAAACAGGAGCAGAACTTGGACCAGACCTACTTGGATGATGAGCTGATAGACACACACCTTAGCTGGATACAAAAC
ATATTATGAAACAGAATGACTGTGATCTTTGATCCGAGAAATCAAAGTTAAAGTTAATGAAATTATCAGGAAGGAGTTTTCAGGACCTCC
TGCCAGAAATCAGACGTAAAAGAAGCCATTATAGCAAGACACCTTCTGTATCTGACCCCTCGGAGCCCTCCACAGCCCCTCACCTTCTGT
CTCCTTTCATGTTCATCTCCCAGCCCGGAGTCCACACGCGGATCAATGTATGGGCACTAAGCGGACTCTCACTTAAGGAGCTCGCCACCT

>In-frame_EWSR1_ENST00000414183_chr22_29684775_+_NFATC2_ENST00000414705_chr20_50133495_-_2887nt
AACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCC
CAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACC
CAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGTAGAAGGGACCAGTACAGGTTAT
ACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACC
ACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACA
AGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAG
AGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCT
ACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGT
CAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAG
AGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGA
CCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGG
GGAGGAGGACGCGGTGGAATGGGCATCCCAGTGACTGCATCCCTCCCTCCACTTGAGTGGCCGCTGTCCAGTCAGTCAGGCTCTTACGAG
CTGCGGATCGAGGTGCAGCCCAAGCCACATCACCGGGCCCACTATGAGACAGAAGGCAGCCGAGGGGCTGTCAAAGCTCCAACTGGAGGC
CACCCTGTGGTTCAGCTCCATGGCTACATGGAAAACAAGCCTCTGGGACTTCAGATCTTCATTGGGACAGCTGATGAGCGGATCCTTAAG
CCGCACGCCTTCTACCAGGTGCACCGAATCACGGGGAAAACTGTCACCACCACCAGCTATGAGAAGATAGTGGGCAACACCAAAGTCCTG
GAGATACCCTTGGAGCCCAAAAACAACATGAGGGCAACCATCGACTGTGCGGGGATCTTGAAGCTTAGAAACGCCGACATTGAGCTGCGG
AAAGGCGAGACGGACATTGGAAGAAAGAACACGCGGGTGAGACTGGTTTTCCGAGTTCACATCCCAGAGTCCAGTGGCAGAATCGTCTCT
TTACAGACTGCATCTAACCCCATCGAGTGCTCCCAGCGATCTGCTCACGAGCTGCCCATGGTTGAAAGACAAGACACAGACAGCTGCCTG
GTCTATGGCGGCCAGCAAATGATCCTCACGGGGCAGAACTTTACATCCGAGTCCAAAGTTGTGTTTACTGAGAAGACCACAGATGGACAG
CAAATTTGGGAGATGGAAGCCACGGTGGATAAGGACAAGAGCCAGCCCAACATGCTTTTTGTTGAGATCCCTGAATATCGGAACAAGCAT
ATCCGCACACCTGTAAAAGTGAACTTCTACGTCATCAATGGGAAGAGAAAACGAAGTCAGCCTCAGCACTTTACCTACCACCCAGTCCCA
GCCATCAAGACGGAGCCCACGGATGAATATGACCCCACTCTGATCTGCAGCCCCACCCATGGAGGCCTGGGGAGCCAGCCTTACTACCCC
CAGCACCCGATGGTGGCCGAGTCCCCCTCCTGCCTCGTGGCCACCATGGCTCCCTGCCAGCAGTTCCGCACGGGGCTCTCATCCCCTGAC
GCCCGCTACCAGCAACAGAACCCAGCGGCCGTACTCTACCAGCGGAGCAAGAGCCTGAGCCCCAGCCTGCTGGGCTATCAGCAGCCGGCC
CTCATGGCCGCCCCGCTGTCCCTTGCGGACGCTCACCGCTCTGTGCTGGTGCACGCCGGCTCCCAGGGCCAGAGCTCAGCCCTGCTCCAC
CCCTCTCCGACCAACCAGCAGGCCTCGCCTGTGATCCACTACTCACCCACCAACCAGCAGCTGCGCTGCGGAAGCCACCAGGAGTTCCAG
CACATCATGTACTGCGAGAATTTCGCACCAGGCACCACCAGACCTGGCCCGCCCCCGGTCAGTCAAGGTCAGAGGCTGAGCCCGGGTTCC
TACCCCACAGTCATTCAGCAGCAGAATGCCACGAGCCAAAGAGCCGCCAAAAACGGACCCCCGGTCAGTGACCAAAAGGAAGTATTACCT
GCGGGGGTGACCATTAAACAGGAGCAGAACTTGGACCAGACCTACTTGGATGATGAGCTGATAGACACACACCTTAGCTGGATACAAAAC
ATATTATGAAACAGAATGACTGTGATCTTTGATCCGAGAAATCAAAGTTAAAGTTAATGAAATTATCAGGAAGGAGTTTTCAGGACCTCC
TGCCAGAAATCAGACGTAAAAGAAGCCATTATAGCAAGACACCTTCTGTATCTGACCCCTCGGAGCCCTCCACAGCCCCTCACCTTCTGT
CTCCTTTCATGTTCATCTCCCAGCCCGGAGTCCACACGCGGATCAATGTATGGGCACTAAGCGGACTCTCACTTAAGGAGCTCGCCACCT

>In-frame_EWSR1_ENST00000414183_chr22_29684775_+_NFATC2_ENST00000609507_chr20_50133495_-_2887nt
AACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCC
CAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACC
CAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGTAGAAGGGACCAGTACAGGTTAT
ACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACC
ACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACA
AGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAG
AGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCT
ACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGT
CAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAG
AGCAGCAGCTACGGGCAGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGA
CCAGGAGAGAACCGGAGCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGG
GGAGGAGGACGCGGTGGAATGGGCATCCCAGTGACTGCATCCCTCCCTCCACTTGAGTGGCCGCTGTCCAGTCAGTCAGGCTCTTACGAG
CTGCGGATCGAGGTGCAGCCCAAGCCACATCACCGGGCCCACTATGAGACAGAAGGCAGCCGAGGGGCTGTCAAAGCTCCAACTGGAGGC
CACCCTGTGGTTCAGCTCCATGGCTACATGGAAAACAAGCCTCTGGGACTTCAGATCTTCATTGGGACAGCTGATGAGCGGATCCTTAAG
CCGCACGCCTTCTACCAGGTGCACCGAATCACGGGGAAAACTGTCACCACCACCAGCTATGAGAAGATAGTGGGCAACACCAAAGTCCTG
GAGATACCCTTGGAGCCCAAAAACAACATGAGGGCAACCATCGACTGTGCGGGGATCTTGAAGCTTAGAAACGCCGACATTGAGCTGCGG
AAAGGCGAGACGGACATTGGAAGAAAGAACACGCGGGTGAGACTGGTTTTCCGAGTTCACATCCCAGAGTCCAGTGGCAGAATCGTCTCT
TTACAGACTGCATCTAACCCCATCGAGTGCTCCCAGCGATCTGCTCACGAGCTGCCCATGGTTGAAAGACAAGACACAGACAGCTGCCTG
GTCTATGGCGGCCAGCAAATGATCCTCACGGGGCAGAACTTTACATCCGAGTCCAAAGTTGTGTTTACTGAGAAGACCACAGATGGACAG
CAAATTTGGGAGATGGAAGCCACGGTGGATAAGGACAAGAGCCAGCCCAACATGCTTTTTGTTGAGATCCCTGAATATCGGAACAAGCAT
ATCCGCACACCTGTAAAAGTGAACTTCTACGTCATCAATGGGAAGAGAAAACGAAGTCAGCCTCAGCACTTTACCTACCACCCAGTCCCA
GCCATCAAGACGGAGCCCACGGATGAATATGACCCCACTCTGATCTGCAGCCCCACCCATGGAGGCCTGGGGAGCCAGCCTTACTACCCC
CAGCACCCGATGGTGGCCGAGTCCCCCTCCTGCCTCGTGGCCACCATGGCTCCCTGCCAGCAGTTCCGCACGGGGCTCTCATCCCCTGAC
GCCCGCTACCAGCAACAGAACCCAGCGGCCGTACTCTACCAGCGGAGCAAGAGCCTGAGCCCCAGCCTGCTGGGCTATCAGCAGCCGGCC
CTCATGGCCGCCCCGCTGTCCCTTGCGGACGCTCACCGCTCTGTGCTGGTGCACGCCGGCTCCCAGGGCCAGAGCTCAGCCCTGCTCCAC
CCCTCTCCGACCAACCAGCAGGCCTCGCCTGTGATCCACTACTCACCCACCAACCAGCAGCTGCGCTGCGGAAGCCACCAGGAGTTCCAG
CACATCATGTACTGCGAGAATTTCGCACCAGGCACCACCAGACCTGGCCCGCCCCCGGTCAGTCAAGGTCAGAGGCTGAGCCCGGGTTCC
TACCCCACAGTCATTCAGCAGCAGAATGCCACGAGCCAAAGAGCCGCCAAAAACGGACCCCCGGTCAGTGACCAAAAGGAAGTATTACCT
GCGGGGGTGACCATTAAACAGGAGCAGAACTTGGACCAGACCTACTTGGATGATGAGCTGATAGACACACACCTTAGCTGGATACAAAAC
ATATTATGAAACAGAATGACTGTGATCTTTGATCCGAGAAATCAAAGTTAAAGTTAATGAAATTATCAGGAAGGAGTTTTCAGGACCTCC
TGCCAGAAATCAGACGTAAAAGAAGCCATTATAGCAAGACACCTTCTGTATCTGACCCCTCGGAGCCCTCCACAGCCCCTCACCTTCTGT
CTCCTTTCATGTTCATCTCCCAGCCCGGAGTCCACACGCGGATCAATGTATGGGCACTAAGCGGACTCTCACTTAAGGAGCTCGCCACCT

>In-frame_EWSR1_ENST00000333395_chr22_29684775_+_NFATC2_ENST00000371564_chr20_50133495_-_7138nt
CGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCA
GCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCA
GGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCA
GGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGC
TCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAA
GCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCA
GGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGA
TCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCA
GCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCA
GAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGGAGCAT
GAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGTGGAAT
GGGCATCCCAGTGACTGCATCCCTCCCTCCACTTGAGTGGCCGCTGTCCAGTCAGTCAGGCTCTTACGAGCTGCGGATCGAGGTGCAGCC
CAAGCCACATCACCGGGCCCACTATGAGACAGAAGGCAGCCGAGGGGCTGTCAAAGCTCCAACTGGAGGCCACCCTGTGGTTCAGCTCCA
TGGCTACATGGAAAACAAGCCTCTGGGACTTCAGATCTTCATTGGGACAGCTGATGAGCGGATCCTTAAGCCGCACGCCTTCTACCAGGT
GCACCGAATCACGGGGAAAACTGTCACCACCACCAGCTATGAGAAGATAGTGGGCAACACCAAAGTCCTGGAGATACCCTTGGAGCCCAA
AAACAACATGAGGGCAACCATCGACTGTGCGGGGATCTTGAAGCTTAGAAACGCCGACATTGAGCTGCGGAAAGGCGAGACGGACATTGG
AAGAAAGAACACGCGGGTGAGACTGGTTTTCCGAGTTCACATCCCAGAGTCCAGTGGCAGAATCGTCTCTTTACAGACTGCATCTAACCC
CATCGAGTGCTCCCAGCGATCTGCTCACGAGCTGCCCATGGTTGAAAGACAAGACACAGACAGCTGCCTGGTCTATGGCGGCCAGCAAAT
GATCCTCACGGGGCAGAACTTTACATCCGAGTCCAAAGTTGTGTTTACTGAGAAGACCACAGATGGACAGCAAATTTGGGAGATGGAAGC
CACGGTGGATAAGGACAAGAGCCAGCCCAACATGCTTTTTGTTGAGATCCCTGAATATCGGAACAAGCATATCCGCACACCTGTAAAAGT
GAACTTCTACGTCATCAATGGGAAGAGAAAACGAAGTCAGCCTCAGCACTTTACCTACCACCCAGTCCCAGCCATCAAGACGGAGCCCAC
GGATGAATATGACCCCACTCTGATCTGCAGCCCCACCCATGGAGGCCTGGGGAGCCAGCCTTACTACCCCCAGCACCCGATGGTGGCCGA
GTCCCCCTCCTGCCTCGTGGCCACCATGGCTCCCTGCCAGCAGTTCCGCACGGGGCTCTCATCCCCTGACGCCCGCTACCAGCAACAGAA
CCCAGCGGCCGTACTCTACCAGCGGAGCAAGAGCCTGAGCCCCAGCCTGCTGGGCTATCAGCAGCCGGCCCTCATGGCCGCCCCGCTGTC
CCTTGCGGACGCTCACCGCTCTGTGCTGGTGCACGCCGGCTCCCAGGGCCAGAGCTCAGCCCTGCTCCACCCCTCTCCGACCAACCAGCA
GGCCTCGCCTGTGATCCACTACTCACCCACCAACCAGCAGCTGCGCTGCGGAAGCCACCAGGAGTTCCAGCACATCATGTACTGCGAGAA
TTTCGCACCAGGCACCACCAGACCTGGCCCGCCCCCGGTCAGTCAAGGTCAGAGGCTGAGCCCGGGTTCCTACCCCACAGTCATTCAGCA
GCAGAATGCCACGAGCCAAAGAGCCGCCAAAAACGGACCCCCGGTCAGTGACCAAAAGGAAGTATTACCTGCGGGGGTGACCATTAAACA
GGAGCAGAACTTGGACCAGACCTACTTGGATGATGAGCTGATAGACACACACCTTAGCTGGATACAAAACATATTATGAAACAGAATGAC
TGTGATCTTTGATCCGAGAAATCAAAGTTAAAGTTAATGAAATTATCAGGAAGGAGTTTTCAGGACCTCCTGCCAGAAATCAGACGTAAA
AGAAGCCATTATAGCAAGACACCTTCTGTATCTGACCCCTCGGAGCCCTCCACAGCCCCTCACCTTCTGTCTCCTTTCATGTTCATCTCC
CAGCCCGGAGTCCACACGCGGATCAATGTATGGGCACTAAGCGGACTCTCACTTAAGGAGCTCGCCACCTCCCTCTAAACACCAGAGAGA
ACTCTTCTTTTCGGTTTATGTTTTAAATCCCAGAGAGCATCCTGGTTGATCTTAATGGTGTTCCGTCCAAATAGTAAGCACCTGCTGACC
AAAAGCACATTCTACATGAGACAGGACACTGGAACTCTCCTGAGAACAGAGTGACTGGAGCTTGGGGGGATGGACGGGGGACAGAAGATG
TGGGCACTGTGATTAAACCCCAGCCCTTGCGTTCGTTTTTCCAGGTCACAGATACAGCTCCTGTACCTTTTGAAGGCAAGGAGTTCTCAG
AGCAACCAAAGGAACGTGACCCAAGAGCCCAGCTTACAGGCTGAAGAAACCCAAAACCCTCGATAGAGACAGAAACTGAACTGTCAGTCC
TTAGAGCTCGCCCAGTCCATGCCACAACTGGGCCACAGCTAAAGCTTTATTTTTGAATTCTCATTCCAAAACCAAACTGTCTTGCCCAGA
CAAGATCACCTGTTAAGACTTCTTGGCGTTAAGTTATGACATGTATACGCGTTTGTTATTATTATTTTTTCTGCTTTAAAAGGCTGACCA
GGGCACCTAGCCCTGGAGCTGTCTTGGCGAGCTGTTCTTTAACCCCTGCAGCACGCAGTCCTGCTAACACAATTTCCATAGACTTGGGGG
GCTGACCCAGGCTGCAGAGAGCAAGCACCTGTCTGCTGCAGCTGTACAACCTGGATGCTTTGCAAGGTTCCGGCTTGCTTTCTTCCTAGC
AGCCAGAGTGCTTTTCCGTAAAGCGGTGGAGAATCTCAAGCATGTGCATTTAATTGAGGAATAGCAGAAGGGCTAAAGCAACCAAGAAAA
GAAGTGTGGGTATTTTTGTTAAGTAAAACAGCCCAAGTGCTTCTGGAGGTGGGTTTCTACCAAGATAGAGGAAAAGGGCTGAATTCCCTC
TAAGTGGGACAGCCGAGCTCAGGATGTGCTTCCCAGCTTCACTGGTTAATTTGACCTGAACCTATTTAAAGATCCCTTCTGCCCCTGAAG
ACCTATCCGCACTCAAATTCTAACATGAAGAAATCTACTCGAATGCATCCTTTACTTTGAATGAGCTCTATTCGGTTGCATGTTATATGT
GATTTCCTTCCTCCCAACTGTTTCCACTGAGCGCACCCAGTCTCCCCTAGTCTTCCTCTGTGGGTGTGATTTTTGTGATTTTTACAAACA
AAACCCTTGAAGTTCTTGGCAGATGTGTTTGTTTCTGTTTGCATGTACTGCAGATACCCCAGGACAAGCGGGGGATTCATTTTTCAGCCA
TTCAGTTGTTTCCTCAATAATCCGCAGCAAAGTGAAAATATTCTTAGCACTCAGACTGTACTTAGAGTGTTTTCTCAGTCCAGTCTGTAC
AGTCTGTAGGCAGAAGGCCTCAGAAGAAAGTCATGGCCACTCAGTGCCCACTGTGGGCTTTGTAAGTCCTGGCTCTCCCGTCAAGGTTAC
CCAGAGGTAAAAGCTTCCTGGGAGTGGGGCCAGGTGTGTTTGGCACTCCAGATAGAAGGCAAAATGCTCAGATTCGGGCCTGTGCACTTG
TATGCAACCTGTCGGTCGATACCTAGCATTTATTTTTCCCTGACAATGAACGACCTTTCCCTCACCCACCCTAAGCTCAAAGAGTTTAGC
AAAATTCTCTTTTAAATAAACAGAATGCCAGTAAGAGGTTGACCCCTACCATGGAACTTCTGGGATGCTAAATACTTCCTCATGAACAAA
ATAAGTTCCTTATTATAAGTTCCTTATACTAGCAGCTTCACCTAAAGAATTTTCTCTCCAGCAATATTGACTTCACTGGGGAAAAGCCAA
GAGTGTGTGGTGAGTGATTTGTTCTCACTCGACCTGGCTAGGACTGGCTAGGAGCTGTTTTTTGTACATGAGGGAATTTGGGCTTTCCTC
AGTTATCTGAATGTTTTACCCAAGTGCCTTCCTGCTATTGTAGCAAAGTAGCTCAGCTTCCTTGTCCACAGGGTGAAAAAGGACTAATGC
ATTTTCCATCAGTTTTCTAACTATGTTAGCAAAAACGGCCTCCTGGTAGCTCAACCTCCTGTACGCGTGTGTGTGTGTAATACACACACA
AATAAACCCCTCTGTTTTTCTAAGACATCTTAGCTGGATATTATAGGAAGCACTTTCATAAACAACTGTAACAAATCGCAAAGGAAAGAG
AAACAAAAGCATTAGATTTGAGACATAAACAGGCAAGAGAAAGTGTATTAGGAACTGACAGCTATCAAGGAAGTTTTGTCAGTTACAAAT
GCTAGGAGGAAATTTTGCCAAGAAGGATGGCTCATGAAATATTTCCAGTACGGGAAGAGGCAATAAGATCCTCTAAGAGAATGAGAAAGT
AGGGGTGTCTAAATGGTAAAGATGGGTGTGTTGCACGTGTGTTAGAAGGATCTCAGTTGAGTGAAGGTTTGCACTGCTACATCTAAGTTA
ATGTAAATATGTAGCACTCTGACAGGTCTACCGTGTTGCTGAATGTAGTATATTTCCAAAGTTTGCAAGTCTTCCTGTATTGTACAAAGA
TGCTGCTGCTTGATAATATGTATAGCAATCCAGATTAGTATGTTATTAAATTTTATTTTCTTACCTGTATTTTTATGCTTTTTACCTGTC
CTCAAAATATTACACCCCTGTTGGAATTAGATTTATATTTATAAATGGTCAGAAATCTTTTTAAGTGTCTCTTTTTACACATAGGTTGAT
TTTTTTTTCTTAAGAGAAATGATGTATTCTTGAAACATTTGTTACTCATTCCAGGAAACAAAAACCCATATAATAAAACCCCCACTCAGA
GCCTGTTAGTCACCTCTCTAGAAGATGGCATCTCAGGAGAAGGAATGGCTTTGTGGAAGAAGGAATCACCTTTTTCTTGCTCAAGAATTA
TGCTGACTTCAGCCCTGAGCCTGGATCTGGTCACTGAGAATCATCAAGTGTCTAGATCCTCCCCCCAAAATAACTAATTTAGTAGGTGAT
TTTGATTTTAAAAAATTGACACCAAAACCCTGCCTGCATTGTAATGGAATTCGAAAAGAATTCATGTTCACAGAACTCAACGTTCAGGCT
AATATTTACAGAAGGGACCAAATCTAAATCCTGGTAGATAACTCCTGTATGCTTTATCCAAAGGACACCCACAGTTTTCCAGCATAGATA
TAACCAAGGATGAATTGATTCCTTCAAAGAACTGGGAGGCACGGATATTGCATTTTTTGTTTACATCCAGTAGCCAAGACGCCTCAGTGA
GCCAGTCTTGGGCAGAGGCTGTCACATTTAGGCAGATTGGAAGTTGGTATGTTCTAATTCTCACTCTGGACTACAGTGAGGCTGAATTTA
TCATGTCAAAAAAAAAAAAAAAAAAAGACCTTTCCAAGTGCTTTCTATTGCTCAGAATTGAAAGAATGTTTTCATTTCAAGTTTACAAGA
GGCATGGATGGAGTTGTGACGTTCTTGACAAGCTGGGCTAACCTTTCCCGAACTTGTTTCCCGGAGGCAAGGTGCTCGGTGACCCAGCGC
ATCTTAACCTTGGGTCTCCTAGGCTCGAGGCTAGGGCATTACGTTTCGTGGAACCAAAGCAGCCAATTGCATAGCAAGTATTTTCCTGCA
TTCCAATTAAATGCTTAAGAAAAAGCAGCATCCTATAAAATTGTGATCATAAACATCCATTTCCCTCAGCTTTTGTGAGTGCCTTGACTT
ACAGCCAACATCACTGTTTAACTCAGTCTGTTTAAAAACAAACTTTTCTGGTGGTTGATAACAGAGAGTTGCTCCCTGAGCCATCAGGGT
CCTGGGAGCTGGAAGTGAAAGGGTTATTAACATTCTACCTTTATGCAGCTGTTGGCTGACCAGAATAAACTCCCTGCTGAGTTCAAGCTT
TGAATGGAATGGATGCAAATGATGTTGTTTCCATTAGAGCAGGTGCTCACAGCATTCTGATTGGCCTGAGCAGACCGAGGCTATGGCTGT
TGGGACAAGCTTAGCATCCTGGACATCTTGTCAAAGAACCTCACTCACCCCTCTGGCCTCTACAGCCCTCAGAGGAGAGAAAACCAATTC
TCCAACAAACAGGTCTCTCCAACATGGTGGTGCTGGCAGGCTTAGGTTTAGAAAATCCTGACTGTTAAAGGCGTTTGAATACATCACATT
CCTATGCAAATGTTTTTAATCTCCAGTTTAATGTAGTTTATTTTTCCTATATGTAAAGTATTTTTATACGGCTTGTATCATGATAGTTTA

>In-frame_EWSR1_ENST00000333395_chr22_29684775_+_NFATC2_ENST00000396009_chr20_50133495_-_7050nt
CGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCA
GCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCA
GGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCA
GGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGC
TCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAA
GCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCA
GGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGA
TCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCA
GCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCA
GAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGGAGCAT
GAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGTGGAAT
GGGCATCCCAGTGACTGCATCCCTCCCTCCACTTGAGTGGCCGCTGTCCAGTCAGTCAGGCTCTTACGAGCTGCGGATCGAGGTGCAGCC
CAAGCCACATCACCGGGCCCACTATGAGACAGAAGGCAGCCGAGGGGCTGTCAAAGCTCCAACTGGAGGCCACCCTGTGGTTCAGCTCCA
TGGCTACATGGAAAACAAGCCTCTGGGACTTCAGATCTTCATTGGGACAGCTGATGAGCGGATCCTTAAGCCGCACGCCTTCTACCAGGT
GCACCGAATCACGGGGAAAACTGTCACCACCACCAGCTATGAGAAGATAGTGGGCAACACCAAAGTCCTGGAGATACCCTTGGAGCCCAA
AAACAACATGAGGGCAACCATCGACTGTGCGGGGATCTTGAAGCTTAGAAACGCCGACATTGAGCTGCGGAAAGGCGAGACGGACATTGG
AAGAAAGAACACGCGGGTGAGACTGGTTTTCCGAGTTCACATCCCAGAGTCCAGTGGCAGAATCGTCTCTTTACAGACTGCATCTAACCC
CATCGAGTGCTCCCAGCGATCTGCTCACGAGCTGCCCATGGTTGAAAGACAAGACACAGACAGCTGCCTGGTCTATGGCGGCCAGCAAAT
GATCCTCACGGGGCAGAACTTTACATCCGAGTCCAAAGTTGTGTTTACTGAGAAGACCACAGATGGACAGCAAATTTGGGAGATGGAAGC
CACGGTGGATAAGGACAAGAGCCAGCCCAACATGCTTTTTGTTGAGATCCCTGAATATCGGAACAAGCATATCCGCACACCTGTAAAAGT
GAACTTCTACGTCATCAATGGGAAGAGAAAACGAAGTCAGCCTCAGCACTTTACCTACCACCCAGTCCCAGCCATCAAGACGGAGCCCAC
GGATGAATATGACCCCACTCTGATCTGCAGCCCCACCCATGGAGGCCTGGGGAGCCAGCCTTACTACCCCCAGCACCCGATGGTGGCCGA
GTCCCCCTCCTGCCTCGTGGCCACCATGGCTCCCTGCCAGCAGTTCCGCACGGGGCTCTCATCCCCTGACGCCCGCTACCAGCAACAGAA
CCCAGCGGCCGTACTCTACCAGCGGAGCAAGAGCCTGAGCCCCAGCCTGCTGGGCTATCAGCAGCCGGCCCTCATGGCCGCCCCGCTGTC
CCTTGCGGACGCTCACCGCTCTGTGCTGGTGCACGCCGGCTCCCAGGGCCAGAGCTCAGCCCTGCTCCACCCCTCTCCGACCAACCAGCA
GGCCTCGCCTGTGATCCACTACTCACCCACCAACCAGCAGCTGCGCTGCGGAAGCCACCAGGAGTTCCAGCACATCATGTACTGCGAGAA
TTTCGCACCAGGCACCACCAGACCTGGCCCGCCCCCGGTCAGTCAAGGTCAGAGGCTGAGCCCGGGTTCCTACCCCACAGTCATTCAGCA
GCAGAATGCCACGAGCCAAAGAGCCGCCAAAAACGGACCCCCGGTCAGTGACCAAAAGGAAGTATTACCTGCGGGGGTGACCATTAAACA
GGAGCAGAACTTGGACCAGACCTACTTGGATGATGTTAATGAAATTATCAGGAAGGAGTTTTCAGGACCTCCTGCCAGAAATCAGACGTA
AAAGAAGCCATTATAGCAAGACACCTTCTGTATCTGACCCCTCGGAGCCCTCCACAGCCCCTCACCTTCTGTCTCCTTTCATGTTCATCT
CCCAGCCCGGAGTCCACACGCGGATCAATGTATGGGCACTAAGCGGACTCTCACTTAAGGAGCTCGCCACCTCCCTCTAAACACCAGAGA
GAACTCTTCTTTTCGGTTTATGTTTTAAATCCCAGAGAGCATCCTGGTTGATCTTAATGGTGTTCCGTCCAAATAGTAAGCACCTGCTGA
CCAAAAGCACATTCTACATGAGACAGGACACTGGAACTCTCCTGAGAACAGAGTGACTGGAGCTTGGGGGGATGGACGGGGGACAGAAGA
TGTGGGCACTGTGATTAAACCCCAGCCCTTGCGTTCGTTTTTCCAGGTCACAGATACAGCTCCTGTACCTTTTGAAGGCAAGGAGTTCTC
AGAGCAACCAAAGGAACGTGACCCAAGAGCCCAGCTTACAGGCTGAAGAAACCCAAAACCCTCGATAGAGACAGAAACTGAACTGTCAGT
CCTTAGAGCTCGCCCAGTCCATGCCACAACTGGGCCACAGCTAAAGCTTTATTTTTGAATTCTCATTCCAAAACCAAACTGTCTTGCCCA
GACAAGATCACCTGTTAAGACTTCTTGGCGTTAAGTTATGACATGTATACGCGTTTGTTATTATTATTTTTTCTGCTTTAAAAGGCTGAC
CAGGGCACCTAGCCCTGGAGCTGTCTTGGCGAGCTGTTCTTTAACCCCTGCAGCACGCAGTCCTGCTAACACAATTTCCATAGACTTGGG
GGGCTGACCCAGGCTGCAGAGAGCAAGCACCTGTCTGCTGCAGCTGTACAACCTGGATGCTTTGCAAGGTTCCGGCTTGCTTTCTTCCTA
GCAGCCAGAGTGCTTTTCCGTAAAGCGGTGGAGAATCTCAAGCATGTGCATTTAATTGAGGAATAGCAGAAGGGCTAAAGCAACCAAGAA
AAGAAGTGTGGGTATTTTTGTTAAGTAAAACAGCCCAAGTGCTTCTGGAGGTGGGTTTCTACCAAGATAGAGGAAAAGGGCTGAATTCCC
TCTAAGTGGGACAGCCGAGCTCAGGATGTGCTTCCCAGCTTCACTGGTTAATTTGACCTGAACCTATTTAAAGATCCCTTCTGCCCCTGA
AGACCTATCCGCACTCAAATTCTAACATGAAGAAATCTACTCGAATGCATCCTTTACTTTGAATGAGCTCTATTCGGTTGCATGTTATAT
GTGATTTCCTTCCTCCCAACTGTTTCCACTGAGCGCACCCAGTCTCCCCTAGTCTTCCTCTGTGGGTGTGATTTTTGTGATTTTTACAAA
CAAAACCCTTGAAGTTCTTGGCAGATGTGTTTGTTTCTGTTTGCATGTACTGCAGATACCCCAGGACAAGCGGGGGATTCATTTTTCAGC
CATTCAGTTGTTTCCTCAATAATCCGCAGCAAAGTGAAAATATTCTTAGCACTCAGACTGTACTTAGAGTGTTTTCTCAGTCCAGTCTGT
ACAGTCTGTAGGCAGAAGGCCTCAGAAGAAAGTCATGGCCACTCAGTGCCCACTGTGGGCTTTGTAAGTCCTGGCTCTCCCGTCAAGGTT
ACCCAGAGGTAAAAGCTTCCTGGGAGTGGGGCCAGGTGTGTTTGGCACTCCAGATAGAAGGCAAAATGCTCAGATTCGGGCCTGTGCACT
TGTATGCAACCTGTCGGTCGATACCTAGCATTTATTTTTCCCTGACAATGAACGACCTTTCCCTCACCCACCCTAAGCTCAAAGAGTTTA
GCAAAATTCTCTTTTAAATAAACAGAATGCCAGTAAGAGGTTGACCCCTACCATGGAACTTCTGGGATGCTAAATACTTCCTCATGAACA
AAATAAGTTCCTTATTATAAGTTCCTTATACTAGCAGCTTCACCTAAAGAATTTTCTCTCCAGCAATATTGACTTCACTGGGGAAAAGCC
AAGAGTGTGTGGTGAGTGATTTGTTCTCACTCGACCTGGCTAGGACTGGCTAGGAGCTGTTTTTTGTACATGAGGGAATTTGGGCTTTCC
TCAGTTATCTGAATGTTTTACCCAAGTGCCTTCCTGCTATTGTAGCAAAGTAGCTCAGCTTCCTTGTCCACAGGGTGAAAAAGGACTAAT
GCATTTTCCATCAGTTTTCTAACTATGTTAGCAAAAACGGCCTCCTGGTAGCTCAACCTCCTGTACGCGTGTGTGTGTGTAATACACACA
CAAATAAACCCCTCTGTTTTTCTAAGACATCTTAGCTGGATATTATAGGAAGCACTTTCATAAACAACTGTAACAAATCGCAAAGGAAAG
AGAAACAAAAGCATTAGATTTGAGACATAAACAGGCAAGAGAAAGTGTATTAGGAACTGACAGCTATCAAGGAAGTTTTGTCAGTTACAA
ATGCTAGGAGGAAATTTTGCCAAGAAGGATGGCTCATGAAATATTTCCAGTACGGGAAGAGGCAATAAGATCCTCTAAGAGAATGAGAAA
GTAGGGGTGTCTAAATGGTAAAGATGGGTGTGTTGCACGTGTGTTAGAAGGATCTCAGTTGAGTGAAGGTTTGCACTGCTACATCTAAGT
TAATGTAAATATGTAGCACTCTGACAGGTCTACCGTGTTGCTGAATGTAGTATATTTCCAAAGTTTGCAAGTCTTCCTGTATTGTACAAA
GATGCTGCTGCTTGATAATATGTATAGCAATCCAGATTAGTATGTTATTAAATTTTATTTTCTTACCTGTATTTTTATGCTTTTTACCTG
TCCTCAAAATATTACACCCCTGTTGGAATTAGATTTATATTTATAAATGGTCAGAAATCTTTTTAAGTGTCTCTTTTTACACATAGGTTG
ATTTTTTTTTCTTAAGAGAAATGATGTATTCTTGAAACATTTGTTACTCATTCCAGGAAACAAAAACCCATATAATAAAACCCCCACTCA
GAGCCTGTTAGTCACCTCTCTAGAAGATGGCATCTCAGGAGAAGGAATGGCTTTGTGGAAGAAGGAATCACCTTTTTCTTGCTCAAGAAT
TATGCTGACTTCAGCCCTGAGCCTGGATCTGGTCACTGAGAATCATCAAGTGTCTAGATCCTCCCCCCAAAATAACTAATTTAGTAGGTG
ATTTTGATTTTAAAAAATTGACACCAAAACCCTGCCTGCATTGTAATGGAATTCGAAAAGAATTCATGTTCACAGAACTCAACGTTCAGG
CTAATATTTACAGAAGGGACCAAATCTAAATCCTGGTAGATAACTCCTGTATGCTTTATCCAAAGGACACCCACAGTTTTCCAGCATAGA
TATAACCAAGGATGAATTGATTCCTTCAAAGAACTGGGAGGCACGGATATTGCATTTTTTGTTTACATCCAGTAGCCAAGACGCCTCAGT
GAGCCAGTCTTGGGCAGAGGCTGTCACATTTAGGCAGATTGGAAGTTGGTATGTTCTAATTCTCACTCTGGACTACAGTGAGGCTGAATT
TATCATGTCAAAAAAAAAAAAAAAAAAAGACCTTTCCAAGTGCTTTCTATTGCTCAGAATTGAAAGAATGTTTTCATTTCAAGTTTACAA
GAGGCATGGATGGAGTTGTGACGTTCTTGACAAGCTGGGCTAACCTTTCCCGAACTTGTTTCCCGGAGGCAAGGTGCTCGGTGACCCAGC
GCATCTTAACCTTGGGTCTCCTAGGCTCGAGGCTAGGGCATTACGTTTCGTGGAACCAAAGCAGCCAATTGCATAGCAAGTATTTTCCTG
CATTCCAATTAAATGCTTAAGAAAAAGCAGCATCCTATAAAATTGTGATCATAAACATCCATTTCCCTCAGCTTTTGTGAGTGCCTTGAC
TTACAGCCAACATCACTGTTTAACTCAGTCTGTTTAAAAACAAACTTTTCTGGTGGTTGATAACAGAGAGTTGCTCCCTGAGCCATCAGG
GTCCTGGGAGCTGGAAGTGAAAGGGTTATTAACATTCTACCTTTATGCAGCTGTTGGCTGACCAGAATAAACTCCCTGCTGAGTTCAAGC
TTTGAATGGAATGGATGCAAATGATGTTGTTTCCATTAGAGCAGGTGCTCACAGCATTCTGATTGGCCTGAGCAGACCGAGGCTATGGCT
GTTGGGACAAGCTTAGCATCCTGGACATCTTGTCAAAGAACCTCACTCACCCCTCTGGCCTCTACAGCCCTCAGAGGAGAGAAAACCAAT
TCTCCAACAAACAGGTCTCTCCAACATGGTGGTGCTGGCAGGCTTAGGTTTAGAAAATCCTGACTGTTAAAGGCGTTTGAATACATCACA
TTCCTATGCAAATGTTTTTAATCTCCAGTTTAATGTAGTTTATTTTTCCTATATGTAAAGTATTTTTATACGGCTTGTATCATGATAGTT

>In-frame_EWSR1_ENST00000333395_chr22_29684775_+_NFATC2_ENST00000609943_chr20_50133495_-_5381nt
CGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCA
GCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCA
GGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCA
GGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGC
TCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAA
GCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCA
GGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGA
TCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCA
GCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCA
GAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGGAGCAT
GAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGTGGAAT
GGGCATCCCAGTGACTGCATCCCTCCCTCCACTTGAGTGGCCGCTGTCCAGTCAGTCAGGCTCTTACGAGCTGCGGATCGAGGTGCAGCC
CAAGCCACATCACCGGGCCCACTATGAGACAGAAGGCAGCCGAGGGGCTGTCAAAGCTCCAACTGGAGGCCACCCTGTGGTTCAGCTCCA
TGGCTACATGGAAAACAAGCCTCTGGGACTTCAGATCTTCATTGGGACAGCTGATGAGCGGATCCTTAAGCCGCACGCCTTCTACCAGGT
GCACCGAATCACGGGGAAAACTGTCACCACCACCAGCTATGAGAAGATAGTGGGCAACACCAAAGTCCTGGAGATACCCTTGGAGCCCAA
AAACAACATGAGGGCAACCATCGACTGTGCGGGGATCTTGAAGCTTAGAAACGCCGACATTGAGCTGCGGAAAGGCGAGACGGACATTGG
AAGAAAGAACACGCGGGTGAGACTGGTTTTCCGAGTTCACATCCCAGAGTCCAGTGGCAGAATCGTCTCTTTACAGACTGCATCTAACCC
CATCGAGTGCTCCCAGCGATCTGCTCACGAGCTGCCCATGGTTGAAAGACAAGACACAGACAGCTGCCTGGTCTATGGCGGCCAGCAAAT
GATCCTCACGGGGCAGAACTTTACATCCGAGTCCAAAGTTGTGTTTACTGAGAAGACCACAGATGGACAGCAAATTTGGGAGATGGAAGC
CACGGTGGATAAGGACAAGAGCCAGCCCAACATGCTTTTTGTTGAGATCCCTGAATATCGGAACAAGCATATCCGCACACCTGTAAAAGT
GAACTTCTACGTCATCAATGGGAAGAGAAAACGAAGTCAGCCTCAGCACTTTACCTACCACCCAGTCCCAGCCATCAAGACGGAGCCCAC
GGATGAATATGACCCCACTCTGATCTGCAGCCCCACCCATGGAGGCCTGGGGAGCCAGCCTTACTACCCCCAGCACCCGATGGTGGCCGA
GTCCCCCTCCTGCCTCGTGGCCACCATGGCTCCCTGCCAGCAGTTCCGCACGGGGCTCTCATCCCCTGACGCCCGCTACCAGCAACAGAA
CCCAGCGGCCGTACTCTACCAGCGGAGCAAGAGCCTGAGCCCCAGCCTGCTGGGCTATCAGCAGCCGGCCCTCATGGCCGCCCCGCTGTC
CCTTGCGGACGCTCACCGCTCTGTGCTGGTGCACGCCGGCTCCCAGGGCCAGAGCTCAGCCCTGCTCCACCCCTCTCCGACCAACCAGCA
GGCCTCGCCTGTGATCCACTACTCACCCACCAACCAGCAGCTGCGCTGCGGAAGCCACCAGGAGTTCCAGCACATCATGTACTGCGAGAA
TTTCGCACCAGGCACCACCAGACCTGGCCCGCCCCCGGTCAGTCAAGGTCAGAGGCTGAGCCCGGGTTCCTACCCCACAGTCATTCAGCA
GCAGAATGCCACGAGCCAAAGAGCCGCCAAAAACGGACCCCCGGTCAGTGACCAAAAGGAAGTATTACCTGCGGGGGTGACCATTAAACA
GGAGCAGAACTTGGACCAGACCTACTTGGATGATGTTAATGAAATTATCAGGAAGGAGTTTTCAGGACCTCCTGCCAGAAATCAGACGTA
AAAGAAGCCATTATAGCAAGACACCTTCTGTATCTGACCCCTCGGAGCCCTCCACAGCCCCTCACCTTCTGTCTCCTTTCATGTTCATCT
CCCAGCCCGGAGTCCACACGCGGATCAATGTATGGGCACTAAGCGGACTCTCACTTAAGGAGCTCGCCACCTCCCTCTAAACACCAGAGA
GAACTCTTCTTTTCGGTTTATGTTTTAAATCCCAGAGAGCATCCTGGTTGATCTTAATGGTGTTCCGTCCAAATAGTAAGCACCTGCTGA
CCAAAAGCACATTCTACATGAGACAGGACACTGGAACTCTCCTGAGAACAGAGTGACTGGAGCTTGGGGGGATGGACGGGGGACAGAAGA
TGTGGGCACTGTGATTAAACCCCAGCCCTTGCGTTCGTTTTTCCAGGTCACAGATACAGCTCCTGTACCTTTTGAAGGCAAGGAGTTCTC
AGAGCAACCAAAGGAACGTGACCCAAGAGCCCAGCTTACAGGCTGAAGAAACCCAAAACCCTCGATAGAGACAGAAACTGAACTGTCAGT
CCTTAGAGCTCGCCCAGTCCATGCCACAACTGGGCCACAGCTAAAGCTTTATTTTTGAATTCTCATTCCAAAACCAAACTGTCTTGCCCA
GACAAGATCACCTGTTAAGACTTCTTGGCGTTAAGTTATGACATGTATACGCGTTTGTTATTATTATTTTTTCTGCTTTAAAAGGCTGAC
CAGGGCACCTAGCCCTGGAGCTGTCTTGGCGAGCTGTTCTTTAACCCCTGCAGCACGCAGTCCTGCTAACACAATTTCCATAGACTTGGG
GGGCTGACCCAGGCTGCAGAGAGCAAGCACCTGTCTGCTGCAGCTGTACAACCTGGATGCTTTGCAAGGTTCCGGCTTGCTTTCTTCCTA
GCAGCCAGAGTGCTTTTCCGTAAAGCGGTGGAGAATCTCAAGCATGTGCATTTAATTGAGGAATAGCAGAAGGGCTAAAGCAACCAAGAA
AAGAAGTGTGGGTATTTTTGTTAAGTAAAACAGCCCAAGTGCTTCTGGAGGTGGGTTTCTACCAAGATAGAGGAAAAGGGCTGAATTCCC
TCTAAGTGGGACAGCCGAGCTCAGGATGTGCTTCCCAGCTTCACTGGTTAATTTGACCTGAACCTATTTAAAGATCCCTTCTGCCCCTGA
AGACCTATCCGCACTCAAATTCTAACATGAAGAAATCTACTCGAATGCATCCTTTACTTTGAATGAGCTCTATTCGGTTGCATGTTATAT
GTGATTTCCTTCCTCCCAACTGTTTCCACTGAGCGCACCCAGTCTCCCCTAGTCTTCCTCTGTGGGTGTGATTTTTGTGATTTTTACAAA
CAAAACCCTTGAAGTTCTTGGCAGATGTGTTTGTTTCTGTTTGCATGTACTGCAGATACCCCAGGACAAGCGGGGGATTCATTTTTCAGC
CATTCAGTTGTTTCCTCAATAATCCGCAGCAAAGTGAAAATATTCTTAGCACTCAGACTGTACTTAGAGTGTTTTCTCAGTCCAGTCTGT
ACAGTCTGTAGGCAGAAGGCCTCAGAAGAAAGTCATGGCCACTCAGTGCCCACTGTGGGCTTTGTAAGTCCTGGCTCTCCCGTCAAGGTT
ACCCAGAGGTAAAAGCTTCCTGGGAGTGGGGCCAGGTGTGTTTGGCACTCCAGATAGAAGGCAAAATGCTCAGATTCGGGCCTGTGCACT
TGTATGCAACCTGTCGGTCGATACCTAGCATTTATTTTTCCCTGACAATGAACGACCTTTCCCTCACCCACCCTAAGCTCAAAGAGTTTA
GCAAAATTCTCTTTTAAATAAACAGAATGCCAGTAAGAGGTTGACCCCTACCATGGAACTTCTGGGATGCTAAATACTTCCTCATGAACA
AAATAAGTTCCTTATTATAAGTTCCTTATACTAGCAGCTTCACCTAAAGAATTTTCTCTCCAGCAATATTGACTTCACTGGGGAAAAGCC
AAGAGTGTGTGGTGAGTGATTTGTTCTCACTCGACCTGGCTAGGACTGGCTAGGAGCTGTTTTTTGTACATGAGGGAATTTGGGCTTTCC
TCAGTTATCTGAATGTTTTACCCAAGTGCCTTCCTGCTATTGTAGCAAAGTAGCTCAGCTTCCTTGTCCACAGGGTGAAAAAGGACTAAT
GCATTTTCCATCAGTTTTCTAACTATGTTAGCAAAAACGGCCTCCTGGTAGCTCAACCTCCTGTACGCGTGTGTGTGTGTAATACACACA
CAAATAAACCCCTCTGTTTTTCTAAGACATCTTAGCTGGATATTATAGGAAGCACTTTCATAAACAACTGTAACAAATCGCAAAGGAAAG
AGAAACAAAAGCATTAGATTTGAGACATAAACAGGCAAGAGAAAGTGTATTAGGAACTGACAGCTATCAAGGAAGTTTTGTCAGTTACAA
ATGCTAGGAGGAAATTTTGCCAAGAAGGATGGCTCATGAAATATTTCCAGTACGGGAAGAGGCAATAAGATCCTCTAAGAGAATGAGAAA
GTAGGGGTGTCTAAATGGTAAAGATGGGTGTGTTGCACGTGTGTTAGAAGGATCTCAGTTGAGTGAAGGTTTGCACTGCTACATCTAAGT
TAATGTAAATATGTAGCACTCTGACAGGTCTACCGTGTTGCTGAATGTAGTATATTTCCAAAGTTTGCAAGTCTTCCTGTATTGTACAAA

>In-frame_EWSR1_ENST00000333395_chr22_29684775_+_NFATC2_ENST00000610033_chr20_50133495_-_2867nt
CGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCA
GCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCA
GGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCA
GGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGC
TCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAA
GCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCA
GGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGA
TCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCA
GCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCA
GAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGGAGCAT
GAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGTGGAAT
GGGCATCCCAGTGACTGCATCCCTCCCTCCACTTGAGTGGCCGCTGTCCAGTCAGTCAGGCTCTTACGAGCTGCGGATCGAGGTGCAGCC
CAAGCCACATCACCGGGCCCACTATGAGACAGAAGGCAGCCGAGGGGCTGTCAAAGCTCCAACTGGAGGCCACCCTGTGGTTCAGCTCCA
TGGCTACATGGAAAACAAGCCTCTGGGACTTCAGATCTTCATTGGGACAGCTGATGAGCGGATCCTTAAGCCGCACGCCTTCTACCAGGT
GCACCGAATCACGGGGAAAACTGTCACCACCACCAGCTATGAGAAGATAGTGGGCAACACCAAAGTCCTGGAGATACCCTTGGAGCCCAA
AAACAACATGAGGGCAACCATCGACTGTGCGGGGATCTTGAAGCTTAGAAACGCCGACATTGAGCTGCGGAAAGGCGAGACGGACATTGG
AAGAAAGAACACGCGGGTGAGACTGGTTTTCCGAGTTCACATCCCAGAGTCCAGTGGCAGAATCGTCTCTTTACAGACTGCATCTAACCC
CATCGAGTGCTCCCAGCGATCTGCTCACGAGCTGCCCATGGTTGAAAGACAAGACACAGACAGCTGCCTGGTCTATGGCGGCCAGCAAAT
GATCCTCACGGGGCAGAACTTTACATCCGAGTCCAAAGTTGTGTTTACTGAGAAGACCACAGATGGACAGCAAATTTGGGAGATGGAAGC
CACGGTGGATAAGGACAAGAGCCAGCCCAACATGCTTTTTGTTGAGATCCCTGAATATCGGAACAAGCATATCCGCACACCTGTAAAAGT
GAACTTCTACGTCATCAATGGGAAGAGAAAACGAAGTCAGCCTCAGCACTTTACCTACCACCCAGTCCCAGCCATCAAGACGGAGCCCAC
GGATGAATATGACCCCACTCTGATCTGCAGCCCCACCCATGGAGGCCTGGGGAGCCAGCCTTACTACCCCCAGCACCCGATGGTGGCCGA
GTCCCCCTCCTGCCTCGTGGCCACCATGGCTCCCTGCCAGCAGTTCCGCACGGGGCTCTCATCCCCTGACGCCCGCTACCAGCAACAGAA
CCCAGCGGCCGTACTCTACCAGCGGAGCAAGAGCCTGAGCCCCAGCCTGCTGGGCTATCAGCAGCCGGCCCTCATGGCCGCCCCGCTGTC
CCTTGCGGACGCTCACCGCTCTGTGCTGGTGCACGCCGGCTCCCAGGGCCAGAGCTCAGCCCTGCTCCACCCCTCTCCGACCAACCAGCA
GGCCTCGCCTGTGATCCACTACTCACCCACCAACCAGCAGCTGCGCTGCGGAAGCCACCAGGAGTTCCAGCACATCATGTACTGCGAGAA
TTTCGCACCAGGCACCACCAGACCTGGCCCGCCCCCGGTCAGTCAAGGTCAGAGGCTGAGCCCGGGTTCCTACCCCACAGTCATTCAGCA
GCAGAATGCCACGAGCCAAAGAGCCGCCAAAAACGGACCCCCGGTCAGTGACCAAAAGGAAGTATTACCTGCGGGGGTGACCATTAAACA
GGAGCAGAACTTGGACCAGACCTACTTGGATGATGAGCTGATAGACACACACCTTAGCTGGATACAAAACATATTATGAAACAGAATGAC
TGTGATCTTTGATCCGAGAAATCAAAGTTAAAGTTAATGAAATTATCAGGAAGGAGTTTTCAGGACCTCCTGCCAGAAATCAGACGTAAA
AGAAGCCATTATAGCAAGACACCTTCTGTATCTGACCCCTCGGAGCCCTCCACAGCCCCTCACCTTCTGTCTCCTTTCATGTTCATCTCC

>In-frame_EWSR1_ENST00000333395_chr22_29684775_+_NFATC2_ENST00000414705_chr20_50133495_-_2867nt
CGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCA
GCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCA
GGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCA
GGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGC
TCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAA
GCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCA
GGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGA
TCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCA
GCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCA
GAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGGAGCAT
GAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGTGGAAT
GGGCATCCCAGTGACTGCATCCCTCCCTCCACTTGAGTGGCCGCTGTCCAGTCAGTCAGGCTCTTACGAGCTGCGGATCGAGGTGCAGCC
CAAGCCACATCACCGGGCCCACTATGAGACAGAAGGCAGCCGAGGGGCTGTCAAAGCTCCAACTGGAGGCCACCCTGTGGTTCAGCTCCA
TGGCTACATGGAAAACAAGCCTCTGGGACTTCAGATCTTCATTGGGACAGCTGATGAGCGGATCCTTAAGCCGCACGCCTTCTACCAGGT
GCACCGAATCACGGGGAAAACTGTCACCACCACCAGCTATGAGAAGATAGTGGGCAACACCAAAGTCCTGGAGATACCCTTGGAGCCCAA
AAACAACATGAGGGCAACCATCGACTGTGCGGGGATCTTGAAGCTTAGAAACGCCGACATTGAGCTGCGGAAAGGCGAGACGGACATTGG
AAGAAAGAACACGCGGGTGAGACTGGTTTTCCGAGTTCACATCCCAGAGTCCAGTGGCAGAATCGTCTCTTTACAGACTGCATCTAACCC
CATCGAGTGCTCCCAGCGATCTGCTCACGAGCTGCCCATGGTTGAAAGACAAGACACAGACAGCTGCCTGGTCTATGGCGGCCAGCAAAT
GATCCTCACGGGGCAGAACTTTACATCCGAGTCCAAAGTTGTGTTTACTGAGAAGACCACAGATGGACAGCAAATTTGGGAGATGGAAGC
CACGGTGGATAAGGACAAGAGCCAGCCCAACATGCTTTTTGTTGAGATCCCTGAATATCGGAACAAGCATATCCGCACACCTGTAAAAGT
GAACTTCTACGTCATCAATGGGAAGAGAAAACGAAGTCAGCCTCAGCACTTTACCTACCACCCAGTCCCAGCCATCAAGACGGAGCCCAC
GGATGAATATGACCCCACTCTGATCTGCAGCCCCACCCATGGAGGCCTGGGGAGCCAGCCTTACTACCCCCAGCACCCGATGGTGGCCGA
GTCCCCCTCCTGCCTCGTGGCCACCATGGCTCCCTGCCAGCAGTTCCGCACGGGGCTCTCATCCCCTGACGCCCGCTACCAGCAACAGAA
CCCAGCGGCCGTACTCTACCAGCGGAGCAAGAGCCTGAGCCCCAGCCTGCTGGGCTATCAGCAGCCGGCCCTCATGGCCGCCCCGCTGTC
CCTTGCGGACGCTCACCGCTCTGTGCTGGTGCACGCCGGCTCCCAGGGCCAGAGCTCAGCCCTGCTCCACCCCTCTCCGACCAACCAGCA
GGCCTCGCCTGTGATCCACTACTCACCCACCAACCAGCAGCTGCGCTGCGGAAGCCACCAGGAGTTCCAGCACATCATGTACTGCGAGAA
TTTCGCACCAGGCACCACCAGACCTGGCCCGCCCCCGGTCAGTCAAGGTCAGAGGCTGAGCCCGGGTTCCTACCCCACAGTCATTCAGCA
GCAGAATGCCACGAGCCAAAGAGCCGCCAAAAACGGACCCCCGGTCAGTGACCAAAAGGAAGTATTACCTGCGGGGGTGACCATTAAACA
GGAGCAGAACTTGGACCAGACCTACTTGGATGATGAGCTGATAGACACACACCTTAGCTGGATACAAAACATATTATGAAACAGAATGAC
TGTGATCTTTGATCCGAGAAATCAAAGTTAAAGTTAATGAAATTATCAGGAAGGAGTTTTCAGGACCTCCTGCCAGAAATCAGACGTAAA
AGAAGCCATTATAGCAAGACACCTTCTGTATCTGACCCCTCGGAGCCCTCCACAGCCCCTCACCTTCTGTCTCCTTTCATGTTCATCTCC

>In-frame_EWSR1_ENST00000333395_chr22_29684775_+_NFATC2_ENST00000609507_chr20_50133495_-_2867nt
CGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCA
GCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCA
GGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCA
GGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGC
TCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAA
GCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCA
GGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGA
TCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCA
GCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCA
GAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGGAGCAT
GAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGTGGAAT
GGGCATCCCAGTGACTGCATCCCTCCCTCCACTTGAGTGGCCGCTGTCCAGTCAGTCAGGCTCTTACGAGCTGCGGATCGAGGTGCAGCC
CAAGCCACATCACCGGGCCCACTATGAGACAGAAGGCAGCCGAGGGGCTGTCAAAGCTCCAACTGGAGGCCACCCTGTGGTTCAGCTCCA
TGGCTACATGGAAAACAAGCCTCTGGGACTTCAGATCTTCATTGGGACAGCTGATGAGCGGATCCTTAAGCCGCACGCCTTCTACCAGGT
GCACCGAATCACGGGGAAAACTGTCACCACCACCAGCTATGAGAAGATAGTGGGCAACACCAAAGTCCTGGAGATACCCTTGGAGCCCAA
AAACAACATGAGGGCAACCATCGACTGTGCGGGGATCTTGAAGCTTAGAAACGCCGACATTGAGCTGCGGAAAGGCGAGACGGACATTGG
AAGAAAGAACACGCGGGTGAGACTGGTTTTCCGAGTTCACATCCCAGAGTCCAGTGGCAGAATCGTCTCTTTACAGACTGCATCTAACCC
CATCGAGTGCTCCCAGCGATCTGCTCACGAGCTGCCCATGGTTGAAAGACAAGACACAGACAGCTGCCTGGTCTATGGCGGCCAGCAAAT
GATCCTCACGGGGCAGAACTTTACATCCGAGTCCAAAGTTGTGTTTACTGAGAAGACCACAGATGGACAGCAAATTTGGGAGATGGAAGC
CACGGTGGATAAGGACAAGAGCCAGCCCAACATGCTTTTTGTTGAGATCCCTGAATATCGGAACAAGCATATCCGCACACCTGTAAAAGT
GAACTTCTACGTCATCAATGGGAAGAGAAAACGAAGTCAGCCTCAGCACTTTACCTACCACCCAGTCCCAGCCATCAAGACGGAGCCCAC
GGATGAATATGACCCCACTCTGATCTGCAGCCCCACCCATGGAGGCCTGGGGAGCCAGCCTTACTACCCCCAGCACCCGATGGTGGCCGA
GTCCCCCTCCTGCCTCGTGGCCACCATGGCTCCCTGCCAGCAGTTCCGCACGGGGCTCTCATCCCCTGACGCCCGCTACCAGCAACAGAA
CCCAGCGGCCGTACTCTACCAGCGGAGCAAGAGCCTGAGCCCCAGCCTGCTGGGCTATCAGCAGCCGGCCCTCATGGCCGCCCCGCTGTC
CCTTGCGGACGCTCACCGCTCTGTGCTGGTGCACGCCGGCTCCCAGGGCCAGAGCTCAGCCCTGCTCCACCCCTCTCCGACCAACCAGCA
GGCCTCGCCTGTGATCCACTACTCACCCACCAACCAGCAGCTGCGCTGCGGAAGCCACCAGGAGTTCCAGCACATCATGTACTGCGAGAA
TTTCGCACCAGGCACCACCAGACCTGGCCCGCCCCCGGTCAGTCAAGGTCAGAGGCTGAGCCCGGGTTCCTACCCCACAGTCATTCAGCA
GCAGAATGCCACGAGCCAAAGAGCCGCCAAAAACGGACCCCCGGTCAGTGACCAAAAGGAAGTATTACCTGCGGGGGTGACCATTAAACA
GGAGCAGAACTTGGACCAGACCTACTTGGATGATGAGCTGATAGACACACACCTTAGCTGGATACAAAACATATTATGAAACAGAATGAC
TGTGATCTTTGATCCGAGAAATCAAAGTTAAAGTTAATGAAATTATCAGGAAGGAGTTTTCAGGACCTCCTGCCAGAAATCAGACGTAAA
AGAAGCCATTATAGCAAGACACCTTCTGTATCTGACCCCTCGGAGCCCTCCACAGCCCCTCACCTTCTGTCTCCTTTCATGTTCATCTCC

>In-frame_EWSR1_ENST00000332035_chr22_29684775_+_NFATC2_ENST00000371564_chr20_50133495_-_6962nt
AAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTC
AAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGA
CCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACA
GCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTG
CATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGCTATTCCTCTACACAGCCGACTAGTT
ATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATG
GGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGC
AGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGGA
GCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGTG
GAATGGGCATCCCAGTGACTGCATCCCTCCCTCCACTTGAGTGGCCGCTGTCCAGTCAGTCAGGCTCTTACGAGCTGCGGATCGAGGTGC
AGCCCAAGCCACATCACCGGGCCCACTATGAGACAGAAGGCAGCCGAGGGGCTGTCAAAGCTCCAACTGGAGGCCACCCTGTGGTTCAGC
TCCATGGCTACATGGAAAACAAGCCTCTGGGACTTCAGATCTTCATTGGGACAGCTGATGAGCGGATCCTTAAGCCGCACGCCTTCTACC
AGGTGCACCGAATCACGGGGAAAACTGTCACCACCACCAGCTATGAGAAGATAGTGGGCAACACCAAAGTCCTGGAGATACCCTTGGAGC
CCAAAAACAACATGAGGGCAACCATCGACTGTGCGGGGATCTTGAAGCTTAGAAACGCCGACATTGAGCTGCGGAAAGGCGAGACGGACA
TTGGAAGAAAGAACACGCGGGTGAGACTGGTTTTCCGAGTTCACATCCCAGAGTCCAGTGGCAGAATCGTCTCTTTACAGACTGCATCTA
ACCCCATCGAGTGCTCCCAGCGATCTGCTCACGAGCTGCCCATGGTTGAAAGACAAGACACAGACAGCTGCCTGGTCTATGGCGGCCAGC
AAATGATCCTCACGGGGCAGAACTTTACATCCGAGTCCAAAGTTGTGTTTACTGAGAAGACCACAGATGGACAGCAAATTTGGGAGATGG
AAGCCACGGTGGATAAGGACAAGAGCCAGCCCAACATGCTTTTTGTTGAGATCCCTGAATATCGGAACAAGCATATCCGCACACCTGTAA
AAGTGAACTTCTACGTCATCAATGGGAAGAGAAAACGAAGTCAGCCTCAGCACTTTACCTACCACCCAGTCCCAGCCATCAAGACGGAGC
CCACGGATGAATATGACCCCACTCTGATCTGCAGCCCCACCCATGGAGGCCTGGGGAGCCAGCCTTACTACCCCCAGCACCCGATGGTGG
CCGAGTCCCCCTCCTGCCTCGTGGCCACCATGGCTCCCTGCCAGCAGTTCCGCACGGGGCTCTCATCCCCTGACGCCCGCTACCAGCAAC
AGAACCCAGCGGCCGTACTCTACCAGCGGAGCAAGAGCCTGAGCCCCAGCCTGCTGGGCTATCAGCAGCCGGCCCTCATGGCCGCCCCGC
TGTCCCTTGCGGACGCTCACCGCTCTGTGCTGGTGCACGCCGGCTCCCAGGGCCAGAGCTCAGCCCTGCTCCACCCCTCTCCGACCAACC
AGCAGGCCTCGCCTGTGATCCACTACTCACCCACCAACCAGCAGCTGCGCTGCGGAAGCCACCAGGAGTTCCAGCACATCATGTACTGCG
AGAATTTCGCACCAGGCACCACCAGACCTGGCCCGCCCCCGGTCAGTCAAGGTCAGAGGCTGAGCCCGGGTTCCTACCCCACAGTCATTC
AGCAGCAGAATGCCACGAGCCAAAGAGCCGCCAAAAACGGACCCCCGGTCAGTGACCAAAAGGAAGTATTACCTGCGGGGGTGACCATTA
AACAGGAGCAGAACTTGGACCAGACCTACTTGGATGATGAGCTGATAGACACACACCTTAGCTGGATACAAAACATATTATGAAACAGAA
TGACTGTGATCTTTGATCCGAGAAATCAAAGTTAAAGTTAATGAAATTATCAGGAAGGAGTTTTCAGGACCTCCTGCCAGAAATCAGACG
TAAAAGAAGCCATTATAGCAAGACACCTTCTGTATCTGACCCCTCGGAGCCCTCCACAGCCCCTCACCTTCTGTCTCCTTTCATGTTCAT
CTCCCAGCCCGGAGTCCACACGCGGATCAATGTATGGGCACTAAGCGGACTCTCACTTAAGGAGCTCGCCACCTCCCTCTAAACACCAGA
GAGAACTCTTCTTTTCGGTTTATGTTTTAAATCCCAGAGAGCATCCTGGTTGATCTTAATGGTGTTCCGTCCAAATAGTAAGCACCTGCT
GACCAAAAGCACATTCTACATGAGACAGGACACTGGAACTCTCCTGAGAACAGAGTGACTGGAGCTTGGGGGGATGGACGGGGGACAGAA
GATGTGGGCACTGTGATTAAACCCCAGCCCTTGCGTTCGTTTTTCCAGGTCACAGATACAGCTCCTGTACCTTTTGAAGGCAAGGAGTTC
TCAGAGCAACCAAAGGAACGTGACCCAAGAGCCCAGCTTACAGGCTGAAGAAACCCAAAACCCTCGATAGAGACAGAAACTGAACTGTCA
GTCCTTAGAGCTCGCCCAGTCCATGCCACAACTGGGCCACAGCTAAAGCTTTATTTTTGAATTCTCATTCCAAAACCAAACTGTCTTGCC
CAGACAAGATCACCTGTTAAGACTTCTTGGCGTTAAGTTATGACATGTATACGCGTTTGTTATTATTATTTTTTCTGCTTTAAAAGGCTG
ACCAGGGCACCTAGCCCTGGAGCTGTCTTGGCGAGCTGTTCTTTAACCCCTGCAGCACGCAGTCCTGCTAACACAATTTCCATAGACTTG
GGGGGCTGACCCAGGCTGCAGAGAGCAAGCACCTGTCTGCTGCAGCTGTACAACCTGGATGCTTTGCAAGGTTCCGGCTTGCTTTCTTCC
TAGCAGCCAGAGTGCTTTTCCGTAAAGCGGTGGAGAATCTCAAGCATGTGCATTTAATTGAGGAATAGCAGAAGGGCTAAAGCAACCAAG
AAAAGAAGTGTGGGTATTTTTGTTAAGTAAAACAGCCCAAGTGCTTCTGGAGGTGGGTTTCTACCAAGATAGAGGAAAAGGGCTGAATTC
CCTCTAAGTGGGACAGCCGAGCTCAGGATGTGCTTCCCAGCTTCACTGGTTAATTTGACCTGAACCTATTTAAAGATCCCTTCTGCCCCT
GAAGACCTATCCGCACTCAAATTCTAACATGAAGAAATCTACTCGAATGCATCCTTTACTTTGAATGAGCTCTATTCGGTTGCATGTTAT
ATGTGATTTCCTTCCTCCCAACTGTTTCCACTGAGCGCACCCAGTCTCCCCTAGTCTTCCTCTGTGGGTGTGATTTTTGTGATTTTTACA
AACAAAACCCTTGAAGTTCTTGGCAGATGTGTTTGTTTCTGTTTGCATGTACTGCAGATACCCCAGGACAAGCGGGGGATTCATTTTTCA
GCCATTCAGTTGTTTCCTCAATAATCCGCAGCAAAGTGAAAATATTCTTAGCACTCAGACTGTACTTAGAGTGTTTTCTCAGTCCAGTCT
GTACAGTCTGTAGGCAGAAGGCCTCAGAAGAAAGTCATGGCCACTCAGTGCCCACTGTGGGCTTTGTAAGTCCTGGCTCTCCCGTCAAGG
TTACCCAGAGGTAAAAGCTTCCTGGGAGTGGGGCCAGGTGTGTTTGGCACTCCAGATAGAAGGCAAAATGCTCAGATTCGGGCCTGTGCA
CTTGTATGCAACCTGTCGGTCGATACCTAGCATTTATTTTTCCCTGACAATGAACGACCTTTCCCTCACCCACCCTAAGCTCAAAGAGTT
TAGCAAAATTCTCTTTTAAATAAACAGAATGCCAGTAAGAGGTTGACCCCTACCATGGAACTTCTGGGATGCTAAATACTTCCTCATGAA
CAAAATAAGTTCCTTATTATAAGTTCCTTATACTAGCAGCTTCACCTAAAGAATTTTCTCTCCAGCAATATTGACTTCACTGGGGAAAAG
CCAAGAGTGTGTGGTGAGTGATTTGTTCTCACTCGACCTGGCTAGGACTGGCTAGGAGCTGTTTTTTGTACATGAGGGAATTTGGGCTTT
CCTCAGTTATCTGAATGTTTTACCCAAGTGCCTTCCTGCTATTGTAGCAAAGTAGCTCAGCTTCCTTGTCCACAGGGTGAAAAAGGACTA
ATGCATTTTCCATCAGTTTTCTAACTATGTTAGCAAAAACGGCCTCCTGGTAGCTCAACCTCCTGTACGCGTGTGTGTGTGTAATACACA
CACAAATAAACCCCTCTGTTTTTCTAAGACATCTTAGCTGGATATTATAGGAAGCACTTTCATAAACAACTGTAACAAATCGCAAAGGAA
AGAGAAACAAAAGCATTAGATTTGAGACATAAACAGGCAAGAGAAAGTGTATTAGGAACTGACAGCTATCAAGGAAGTTTTGTCAGTTAC
AAATGCTAGGAGGAAATTTTGCCAAGAAGGATGGCTCATGAAATATTTCCAGTACGGGAAGAGGCAATAAGATCCTCTAAGAGAATGAGA
AAGTAGGGGTGTCTAAATGGTAAAGATGGGTGTGTTGCACGTGTGTTAGAAGGATCTCAGTTGAGTGAAGGTTTGCACTGCTACATCTAA
GTTAATGTAAATATGTAGCACTCTGACAGGTCTACCGTGTTGCTGAATGTAGTATATTTCCAAAGTTTGCAAGTCTTCCTGTATTGTACA
AAGATGCTGCTGCTTGATAATATGTATAGCAATCCAGATTAGTATGTTATTAAATTTTATTTTCTTACCTGTATTTTTATGCTTTTTACC
TGTCCTCAAAATATTACACCCCTGTTGGAATTAGATTTATATTTATAAATGGTCAGAAATCTTTTTAAGTGTCTCTTTTTACACATAGGT
TGATTTTTTTTTCTTAAGAGAAATGATGTATTCTTGAAACATTTGTTACTCATTCCAGGAAACAAAAACCCATATAATAAAACCCCCACT
CAGAGCCTGTTAGTCACCTCTCTAGAAGATGGCATCTCAGGAGAAGGAATGGCTTTGTGGAAGAAGGAATCACCTTTTTCTTGCTCAAGA
ATTATGCTGACTTCAGCCCTGAGCCTGGATCTGGTCACTGAGAATCATCAAGTGTCTAGATCCTCCCCCCAAAATAACTAATTTAGTAGG
TGATTTTGATTTTAAAAAATTGACACCAAAACCCTGCCTGCATTGTAATGGAATTCGAAAAGAATTCATGTTCACAGAACTCAACGTTCA
GGCTAATATTTACAGAAGGGACCAAATCTAAATCCTGGTAGATAACTCCTGTATGCTTTATCCAAAGGACACCCACAGTTTTCCAGCATA
GATATAACCAAGGATGAATTGATTCCTTCAAAGAACTGGGAGGCACGGATATTGCATTTTTTGTTTACATCCAGTAGCCAAGACGCCTCA
GTGAGCCAGTCTTGGGCAGAGGCTGTCACATTTAGGCAGATTGGAAGTTGGTATGTTCTAATTCTCACTCTGGACTACAGTGAGGCTGAA
TTTATCATGTCAAAAAAAAAAAAAAAAAAAGACCTTTCCAAGTGCTTTCTATTGCTCAGAATTGAAAGAATGTTTTCATTTCAAGTTTAC
AAGAGGCATGGATGGAGTTGTGACGTTCTTGACAAGCTGGGCTAACCTTTCCCGAACTTGTTTCCCGGAGGCAAGGTGCTCGGTGACCCA
GCGCATCTTAACCTTGGGTCTCCTAGGCTCGAGGCTAGGGCATTACGTTTCGTGGAACCAAAGCAGCCAATTGCATAGCAAGTATTTTCC
TGCATTCCAATTAAATGCTTAAGAAAAAGCAGCATCCTATAAAATTGTGATCATAAACATCCATTTCCCTCAGCTTTTGTGAGTGCCTTG
ACTTACAGCCAACATCACTGTTTAACTCAGTCTGTTTAAAAACAAACTTTTCTGGTGGTTGATAACAGAGAGTTGCTCCCTGAGCCATCA
GGGTCCTGGGAGCTGGAAGTGAAAGGGTTATTAACATTCTACCTTTATGCAGCTGTTGGCTGACCAGAATAAACTCCCTGCTGAGTTCAA
GCTTTGAATGGAATGGATGCAAATGATGTTGTTTCCATTAGAGCAGGTGCTCACAGCATTCTGATTGGCCTGAGCAGACCGAGGCTATGG
CTGTTGGGACAAGCTTAGCATCCTGGACATCTTGTCAAAGAACCTCACTCACCCCTCTGGCCTCTACAGCCCTCAGAGGAGAGAAAACCA
ATTCTCCAACAAACAGGTCTCTCCAACATGGTGGTGCTGGCAGGCTTAGGTTTAGAAAATCCTGACTGTTAAAGGCGTTTGAATACATCA
CATTCCTATGCAAATGTTTTTAATCTCCAGTTTAATGTAGTTTATTTTTCCTATATGTAAAGTATTTTTATACGGCTTGTATCATGATAG

>In-frame_EWSR1_ENST00000332035_chr22_29684775_+_NFATC2_ENST00000396009_chr20_50133495_-_6874nt
AAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTC
AAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGA
CCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACA
GCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTG
CATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGCTATTCCTCTACACAGCCGACTAGTT
ATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATG
GGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGC
AGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGGA
GCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGTG
GAATGGGCATCCCAGTGACTGCATCCCTCCCTCCACTTGAGTGGCCGCTGTCCAGTCAGTCAGGCTCTTACGAGCTGCGGATCGAGGTGC
AGCCCAAGCCACATCACCGGGCCCACTATGAGACAGAAGGCAGCCGAGGGGCTGTCAAAGCTCCAACTGGAGGCCACCCTGTGGTTCAGC
TCCATGGCTACATGGAAAACAAGCCTCTGGGACTTCAGATCTTCATTGGGACAGCTGATGAGCGGATCCTTAAGCCGCACGCCTTCTACC
AGGTGCACCGAATCACGGGGAAAACTGTCACCACCACCAGCTATGAGAAGATAGTGGGCAACACCAAAGTCCTGGAGATACCCTTGGAGC
CCAAAAACAACATGAGGGCAACCATCGACTGTGCGGGGATCTTGAAGCTTAGAAACGCCGACATTGAGCTGCGGAAAGGCGAGACGGACA
TTGGAAGAAAGAACACGCGGGTGAGACTGGTTTTCCGAGTTCACATCCCAGAGTCCAGTGGCAGAATCGTCTCTTTACAGACTGCATCTA
ACCCCATCGAGTGCTCCCAGCGATCTGCTCACGAGCTGCCCATGGTTGAAAGACAAGACACAGACAGCTGCCTGGTCTATGGCGGCCAGC
AAATGATCCTCACGGGGCAGAACTTTACATCCGAGTCCAAAGTTGTGTTTACTGAGAAGACCACAGATGGACAGCAAATTTGGGAGATGG
AAGCCACGGTGGATAAGGACAAGAGCCAGCCCAACATGCTTTTTGTTGAGATCCCTGAATATCGGAACAAGCATATCCGCACACCTGTAA
AAGTGAACTTCTACGTCATCAATGGGAAGAGAAAACGAAGTCAGCCTCAGCACTTTACCTACCACCCAGTCCCAGCCATCAAGACGGAGC
CCACGGATGAATATGACCCCACTCTGATCTGCAGCCCCACCCATGGAGGCCTGGGGAGCCAGCCTTACTACCCCCAGCACCCGATGGTGG
CCGAGTCCCCCTCCTGCCTCGTGGCCACCATGGCTCCCTGCCAGCAGTTCCGCACGGGGCTCTCATCCCCTGACGCCCGCTACCAGCAAC
AGAACCCAGCGGCCGTACTCTACCAGCGGAGCAAGAGCCTGAGCCCCAGCCTGCTGGGCTATCAGCAGCCGGCCCTCATGGCCGCCCCGC
TGTCCCTTGCGGACGCTCACCGCTCTGTGCTGGTGCACGCCGGCTCCCAGGGCCAGAGCTCAGCCCTGCTCCACCCCTCTCCGACCAACC
AGCAGGCCTCGCCTGTGATCCACTACTCACCCACCAACCAGCAGCTGCGCTGCGGAAGCCACCAGGAGTTCCAGCACATCATGTACTGCG
AGAATTTCGCACCAGGCACCACCAGACCTGGCCCGCCCCCGGTCAGTCAAGGTCAGAGGCTGAGCCCGGGTTCCTACCCCACAGTCATTC
AGCAGCAGAATGCCACGAGCCAAAGAGCCGCCAAAAACGGACCCCCGGTCAGTGACCAAAAGGAAGTATTACCTGCGGGGGTGACCATTA
AACAGGAGCAGAACTTGGACCAGACCTACTTGGATGATGTTAATGAAATTATCAGGAAGGAGTTTTCAGGACCTCCTGCCAGAAATCAGA
CGTAAAAGAAGCCATTATAGCAAGACACCTTCTGTATCTGACCCCTCGGAGCCCTCCACAGCCCCTCACCTTCTGTCTCCTTTCATGTTC
ATCTCCCAGCCCGGAGTCCACACGCGGATCAATGTATGGGCACTAAGCGGACTCTCACTTAAGGAGCTCGCCACCTCCCTCTAAACACCA
GAGAGAACTCTTCTTTTCGGTTTATGTTTTAAATCCCAGAGAGCATCCTGGTTGATCTTAATGGTGTTCCGTCCAAATAGTAAGCACCTG
CTGACCAAAAGCACATTCTACATGAGACAGGACACTGGAACTCTCCTGAGAACAGAGTGACTGGAGCTTGGGGGGATGGACGGGGGACAG
AAGATGTGGGCACTGTGATTAAACCCCAGCCCTTGCGTTCGTTTTTCCAGGTCACAGATACAGCTCCTGTACCTTTTGAAGGCAAGGAGT
TCTCAGAGCAACCAAAGGAACGTGACCCAAGAGCCCAGCTTACAGGCTGAAGAAACCCAAAACCCTCGATAGAGACAGAAACTGAACTGT
CAGTCCTTAGAGCTCGCCCAGTCCATGCCACAACTGGGCCACAGCTAAAGCTTTATTTTTGAATTCTCATTCCAAAACCAAACTGTCTTG
CCCAGACAAGATCACCTGTTAAGACTTCTTGGCGTTAAGTTATGACATGTATACGCGTTTGTTATTATTATTTTTTCTGCTTTAAAAGGC
TGACCAGGGCACCTAGCCCTGGAGCTGTCTTGGCGAGCTGTTCTTTAACCCCTGCAGCACGCAGTCCTGCTAACACAATTTCCATAGACT
TGGGGGGCTGACCCAGGCTGCAGAGAGCAAGCACCTGTCTGCTGCAGCTGTACAACCTGGATGCTTTGCAAGGTTCCGGCTTGCTTTCTT
CCTAGCAGCCAGAGTGCTTTTCCGTAAAGCGGTGGAGAATCTCAAGCATGTGCATTTAATTGAGGAATAGCAGAAGGGCTAAAGCAACCA
AGAAAAGAAGTGTGGGTATTTTTGTTAAGTAAAACAGCCCAAGTGCTTCTGGAGGTGGGTTTCTACCAAGATAGAGGAAAAGGGCTGAAT
TCCCTCTAAGTGGGACAGCCGAGCTCAGGATGTGCTTCCCAGCTTCACTGGTTAATTTGACCTGAACCTATTTAAAGATCCCTTCTGCCC
CTGAAGACCTATCCGCACTCAAATTCTAACATGAAGAAATCTACTCGAATGCATCCTTTACTTTGAATGAGCTCTATTCGGTTGCATGTT
ATATGTGATTTCCTTCCTCCCAACTGTTTCCACTGAGCGCACCCAGTCTCCCCTAGTCTTCCTCTGTGGGTGTGATTTTTGTGATTTTTA
CAAACAAAACCCTTGAAGTTCTTGGCAGATGTGTTTGTTTCTGTTTGCATGTACTGCAGATACCCCAGGACAAGCGGGGGATTCATTTTT
CAGCCATTCAGTTGTTTCCTCAATAATCCGCAGCAAAGTGAAAATATTCTTAGCACTCAGACTGTACTTAGAGTGTTTTCTCAGTCCAGT
CTGTACAGTCTGTAGGCAGAAGGCCTCAGAAGAAAGTCATGGCCACTCAGTGCCCACTGTGGGCTTTGTAAGTCCTGGCTCTCCCGTCAA
GGTTACCCAGAGGTAAAAGCTTCCTGGGAGTGGGGCCAGGTGTGTTTGGCACTCCAGATAGAAGGCAAAATGCTCAGATTCGGGCCTGTG
CACTTGTATGCAACCTGTCGGTCGATACCTAGCATTTATTTTTCCCTGACAATGAACGACCTTTCCCTCACCCACCCTAAGCTCAAAGAG
TTTAGCAAAATTCTCTTTTAAATAAACAGAATGCCAGTAAGAGGTTGACCCCTACCATGGAACTTCTGGGATGCTAAATACTTCCTCATG
AACAAAATAAGTTCCTTATTATAAGTTCCTTATACTAGCAGCTTCACCTAAAGAATTTTCTCTCCAGCAATATTGACTTCACTGGGGAAA
AGCCAAGAGTGTGTGGTGAGTGATTTGTTCTCACTCGACCTGGCTAGGACTGGCTAGGAGCTGTTTTTTGTACATGAGGGAATTTGGGCT
TTCCTCAGTTATCTGAATGTTTTACCCAAGTGCCTTCCTGCTATTGTAGCAAAGTAGCTCAGCTTCCTTGTCCACAGGGTGAAAAAGGAC
TAATGCATTTTCCATCAGTTTTCTAACTATGTTAGCAAAAACGGCCTCCTGGTAGCTCAACCTCCTGTACGCGTGTGTGTGTGTAATACA
CACACAAATAAACCCCTCTGTTTTTCTAAGACATCTTAGCTGGATATTATAGGAAGCACTTTCATAAACAACTGTAACAAATCGCAAAGG
AAAGAGAAACAAAAGCATTAGATTTGAGACATAAACAGGCAAGAGAAAGTGTATTAGGAACTGACAGCTATCAAGGAAGTTTTGTCAGTT
ACAAATGCTAGGAGGAAATTTTGCCAAGAAGGATGGCTCATGAAATATTTCCAGTACGGGAAGAGGCAATAAGATCCTCTAAGAGAATGA
GAAAGTAGGGGTGTCTAAATGGTAAAGATGGGTGTGTTGCACGTGTGTTAGAAGGATCTCAGTTGAGTGAAGGTTTGCACTGCTACATCT
AAGTTAATGTAAATATGTAGCACTCTGACAGGTCTACCGTGTTGCTGAATGTAGTATATTTCCAAAGTTTGCAAGTCTTCCTGTATTGTA
CAAAGATGCTGCTGCTTGATAATATGTATAGCAATCCAGATTAGTATGTTATTAAATTTTATTTTCTTACCTGTATTTTTATGCTTTTTA
CCTGTCCTCAAAATATTACACCCCTGTTGGAATTAGATTTATATTTATAAATGGTCAGAAATCTTTTTAAGTGTCTCTTTTTACACATAG
GTTGATTTTTTTTTCTTAAGAGAAATGATGTATTCTTGAAACATTTGTTACTCATTCCAGGAAACAAAAACCCATATAATAAAACCCCCA
CTCAGAGCCTGTTAGTCACCTCTCTAGAAGATGGCATCTCAGGAGAAGGAATGGCTTTGTGGAAGAAGGAATCACCTTTTTCTTGCTCAA
GAATTATGCTGACTTCAGCCCTGAGCCTGGATCTGGTCACTGAGAATCATCAAGTGTCTAGATCCTCCCCCCAAAATAACTAATTTAGTA
GGTGATTTTGATTTTAAAAAATTGACACCAAAACCCTGCCTGCATTGTAATGGAATTCGAAAAGAATTCATGTTCACAGAACTCAACGTT
CAGGCTAATATTTACAGAAGGGACCAAATCTAAATCCTGGTAGATAACTCCTGTATGCTTTATCCAAAGGACACCCACAGTTTTCCAGCA
TAGATATAACCAAGGATGAATTGATTCCTTCAAAGAACTGGGAGGCACGGATATTGCATTTTTTGTTTACATCCAGTAGCCAAGACGCCT
CAGTGAGCCAGTCTTGGGCAGAGGCTGTCACATTTAGGCAGATTGGAAGTTGGTATGTTCTAATTCTCACTCTGGACTACAGTGAGGCTG
AATTTATCATGTCAAAAAAAAAAAAAAAAAAAGACCTTTCCAAGTGCTTTCTATTGCTCAGAATTGAAAGAATGTTTTCATTTCAAGTTT
ACAAGAGGCATGGATGGAGTTGTGACGTTCTTGACAAGCTGGGCTAACCTTTCCCGAACTTGTTTCCCGGAGGCAAGGTGCTCGGTGACC
CAGCGCATCTTAACCTTGGGTCTCCTAGGCTCGAGGCTAGGGCATTACGTTTCGTGGAACCAAAGCAGCCAATTGCATAGCAAGTATTTT
CCTGCATTCCAATTAAATGCTTAAGAAAAAGCAGCATCCTATAAAATTGTGATCATAAACATCCATTTCCCTCAGCTTTTGTGAGTGCCT
TGACTTACAGCCAACATCACTGTTTAACTCAGTCTGTTTAAAAACAAACTTTTCTGGTGGTTGATAACAGAGAGTTGCTCCCTGAGCCAT
CAGGGTCCTGGGAGCTGGAAGTGAAAGGGTTATTAACATTCTACCTTTATGCAGCTGTTGGCTGACCAGAATAAACTCCCTGCTGAGTTC
AAGCTTTGAATGGAATGGATGCAAATGATGTTGTTTCCATTAGAGCAGGTGCTCACAGCATTCTGATTGGCCTGAGCAGACCGAGGCTAT
GGCTGTTGGGACAAGCTTAGCATCCTGGACATCTTGTCAAAGAACCTCACTCACCCCTCTGGCCTCTACAGCCCTCAGAGGAGAGAAAAC
CAATTCTCCAACAAACAGGTCTCTCCAACATGGTGGTGCTGGCAGGCTTAGGTTTAGAAAATCCTGACTGTTAAAGGCGTTTGAATACAT
CACATTCCTATGCAAATGTTTTTAATCTCCAGTTTAATGTAGTTTATTTTTCCTATATGTAAAGTATTTTTATACGGCTTGTATCATGAT

>In-frame_EWSR1_ENST00000332035_chr22_29684775_+_NFATC2_ENST00000609943_chr20_50133495_-_5205nt
AAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTC
AAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGA
CCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACA
GCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTG
CATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGCTATTCCTCTACACAGCCGACTAGTT
ATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATG
GGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGC
AGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGGA
GCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGTG
GAATGGGCATCCCAGTGACTGCATCCCTCCCTCCACTTGAGTGGCCGCTGTCCAGTCAGTCAGGCTCTTACGAGCTGCGGATCGAGGTGC
AGCCCAAGCCACATCACCGGGCCCACTATGAGACAGAAGGCAGCCGAGGGGCTGTCAAAGCTCCAACTGGAGGCCACCCTGTGGTTCAGC
TCCATGGCTACATGGAAAACAAGCCTCTGGGACTTCAGATCTTCATTGGGACAGCTGATGAGCGGATCCTTAAGCCGCACGCCTTCTACC
AGGTGCACCGAATCACGGGGAAAACTGTCACCACCACCAGCTATGAGAAGATAGTGGGCAACACCAAAGTCCTGGAGATACCCTTGGAGC
CCAAAAACAACATGAGGGCAACCATCGACTGTGCGGGGATCTTGAAGCTTAGAAACGCCGACATTGAGCTGCGGAAAGGCGAGACGGACA
TTGGAAGAAAGAACACGCGGGTGAGACTGGTTTTCCGAGTTCACATCCCAGAGTCCAGTGGCAGAATCGTCTCTTTACAGACTGCATCTA
ACCCCATCGAGTGCTCCCAGCGATCTGCTCACGAGCTGCCCATGGTTGAAAGACAAGACACAGACAGCTGCCTGGTCTATGGCGGCCAGC
AAATGATCCTCACGGGGCAGAACTTTACATCCGAGTCCAAAGTTGTGTTTACTGAGAAGACCACAGATGGACAGCAAATTTGGGAGATGG
AAGCCACGGTGGATAAGGACAAGAGCCAGCCCAACATGCTTTTTGTTGAGATCCCTGAATATCGGAACAAGCATATCCGCACACCTGTAA
AAGTGAACTTCTACGTCATCAATGGGAAGAGAAAACGAAGTCAGCCTCAGCACTTTACCTACCACCCAGTCCCAGCCATCAAGACGGAGC
CCACGGATGAATATGACCCCACTCTGATCTGCAGCCCCACCCATGGAGGCCTGGGGAGCCAGCCTTACTACCCCCAGCACCCGATGGTGG
CCGAGTCCCCCTCCTGCCTCGTGGCCACCATGGCTCCCTGCCAGCAGTTCCGCACGGGGCTCTCATCCCCTGACGCCCGCTACCAGCAAC
AGAACCCAGCGGCCGTACTCTACCAGCGGAGCAAGAGCCTGAGCCCCAGCCTGCTGGGCTATCAGCAGCCGGCCCTCATGGCCGCCCCGC
TGTCCCTTGCGGACGCTCACCGCTCTGTGCTGGTGCACGCCGGCTCCCAGGGCCAGAGCTCAGCCCTGCTCCACCCCTCTCCGACCAACC
AGCAGGCCTCGCCTGTGATCCACTACTCACCCACCAACCAGCAGCTGCGCTGCGGAAGCCACCAGGAGTTCCAGCACATCATGTACTGCG
AGAATTTCGCACCAGGCACCACCAGACCTGGCCCGCCCCCGGTCAGTCAAGGTCAGAGGCTGAGCCCGGGTTCCTACCCCACAGTCATTC
AGCAGCAGAATGCCACGAGCCAAAGAGCCGCCAAAAACGGACCCCCGGTCAGTGACCAAAAGGAAGTATTACCTGCGGGGGTGACCATTA
AACAGGAGCAGAACTTGGACCAGACCTACTTGGATGATGTTAATGAAATTATCAGGAAGGAGTTTTCAGGACCTCCTGCCAGAAATCAGA
CGTAAAAGAAGCCATTATAGCAAGACACCTTCTGTATCTGACCCCTCGGAGCCCTCCACAGCCCCTCACCTTCTGTCTCCTTTCATGTTC
ATCTCCCAGCCCGGAGTCCACACGCGGATCAATGTATGGGCACTAAGCGGACTCTCACTTAAGGAGCTCGCCACCTCCCTCTAAACACCA
GAGAGAACTCTTCTTTTCGGTTTATGTTTTAAATCCCAGAGAGCATCCTGGTTGATCTTAATGGTGTTCCGTCCAAATAGTAAGCACCTG
CTGACCAAAAGCACATTCTACATGAGACAGGACACTGGAACTCTCCTGAGAACAGAGTGACTGGAGCTTGGGGGGATGGACGGGGGACAG
AAGATGTGGGCACTGTGATTAAACCCCAGCCCTTGCGTTCGTTTTTCCAGGTCACAGATACAGCTCCTGTACCTTTTGAAGGCAAGGAGT
TCTCAGAGCAACCAAAGGAACGTGACCCAAGAGCCCAGCTTACAGGCTGAAGAAACCCAAAACCCTCGATAGAGACAGAAACTGAACTGT
CAGTCCTTAGAGCTCGCCCAGTCCATGCCACAACTGGGCCACAGCTAAAGCTTTATTTTTGAATTCTCATTCCAAAACCAAACTGTCTTG
CCCAGACAAGATCACCTGTTAAGACTTCTTGGCGTTAAGTTATGACATGTATACGCGTTTGTTATTATTATTTTTTCTGCTTTAAAAGGC
TGACCAGGGCACCTAGCCCTGGAGCTGTCTTGGCGAGCTGTTCTTTAACCCCTGCAGCACGCAGTCCTGCTAACACAATTTCCATAGACT
TGGGGGGCTGACCCAGGCTGCAGAGAGCAAGCACCTGTCTGCTGCAGCTGTACAACCTGGATGCTTTGCAAGGTTCCGGCTTGCTTTCTT
CCTAGCAGCCAGAGTGCTTTTCCGTAAAGCGGTGGAGAATCTCAAGCATGTGCATTTAATTGAGGAATAGCAGAAGGGCTAAAGCAACCA
AGAAAAGAAGTGTGGGTATTTTTGTTAAGTAAAACAGCCCAAGTGCTTCTGGAGGTGGGTTTCTACCAAGATAGAGGAAAAGGGCTGAAT
TCCCTCTAAGTGGGACAGCCGAGCTCAGGATGTGCTTCCCAGCTTCACTGGTTAATTTGACCTGAACCTATTTAAAGATCCCTTCTGCCC
CTGAAGACCTATCCGCACTCAAATTCTAACATGAAGAAATCTACTCGAATGCATCCTTTACTTTGAATGAGCTCTATTCGGTTGCATGTT
ATATGTGATTTCCTTCCTCCCAACTGTTTCCACTGAGCGCACCCAGTCTCCCCTAGTCTTCCTCTGTGGGTGTGATTTTTGTGATTTTTA
CAAACAAAACCCTTGAAGTTCTTGGCAGATGTGTTTGTTTCTGTTTGCATGTACTGCAGATACCCCAGGACAAGCGGGGGATTCATTTTT
CAGCCATTCAGTTGTTTCCTCAATAATCCGCAGCAAAGTGAAAATATTCTTAGCACTCAGACTGTACTTAGAGTGTTTTCTCAGTCCAGT
CTGTACAGTCTGTAGGCAGAAGGCCTCAGAAGAAAGTCATGGCCACTCAGTGCCCACTGTGGGCTTTGTAAGTCCTGGCTCTCCCGTCAA
GGTTACCCAGAGGTAAAAGCTTCCTGGGAGTGGGGCCAGGTGTGTTTGGCACTCCAGATAGAAGGCAAAATGCTCAGATTCGGGCCTGTG
CACTTGTATGCAACCTGTCGGTCGATACCTAGCATTTATTTTTCCCTGACAATGAACGACCTTTCCCTCACCCACCCTAAGCTCAAAGAG
TTTAGCAAAATTCTCTTTTAAATAAACAGAATGCCAGTAAGAGGTTGACCCCTACCATGGAACTTCTGGGATGCTAAATACTTCCTCATG
AACAAAATAAGTTCCTTATTATAAGTTCCTTATACTAGCAGCTTCACCTAAAGAATTTTCTCTCCAGCAATATTGACTTCACTGGGGAAA
AGCCAAGAGTGTGTGGTGAGTGATTTGTTCTCACTCGACCTGGCTAGGACTGGCTAGGAGCTGTTTTTTGTACATGAGGGAATTTGGGCT
TTCCTCAGTTATCTGAATGTTTTACCCAAGTGCCTTCCTGCTATTGTAGCAAAGTAGCTCAGCTTCCTTGTCCACAGGGTGAAAAAGGAC
TAATGCATTTTCCATCAGTTTTCTAACTATGTTAGCAAAAACGGCCTCCTGGTAGCTCAACCTCCTGTACGCGTGTGTGTGTGTAATACA
CACACAAATAAACCCCTCTGTTTTTCTAAGACATCTTAGCTGGATATTATAGGAAGCACTTTCATAAACAACTGTAACAAATCGCAAAGG
AAAGAGAAACAAAAGCATTAGATTTGAGACATAAACAGGCAAGAGAAAGTGTATTAGGAACTGACAGCTATCAAGGAAGTTTTGTCAGTT
ACAAATGCTAGGAGGAAATTTTGCCAAGAAGGATGGCTCATGAAATATTTCCAGTACGGGAAGAGGCAATAAGATCCTCTAAGAGAATGA
GAAAGTAGGGGTGTCTAAATGGTAAAGATGGGTGTGTTGCACGTGTGTTAGAAGGATCTCAGTTGAGTGAAGGTTTGCACTGCTACATCT
AAGTTAATGTAAATATGTAGCACTCTGACAGGTCTACCGTGTTGCTGAATGTAGTATATTTCCAAAGTTTGCAAGTCTTCCTGTATTGTA

>In-frame_EWSR1_ENST00000332035_chr22_29684775_+_NFATC2_ENST00000610033_chr20_50133495_-_2691nt
AAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTC
AAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGA
CCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACA
GCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTG
CATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGCTATTCCTCTACACAGCCGACTAGTT
ATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATG
GGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGC
AGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGGA
GCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGTG
GAATGGGCATCCCAGTGACTGCATCCCTCCCTCCACTTGAGTGGCCGCTGTCCAGTCAGTCAGGCTCTTACGAGCTGCGGATCGAGGTGC
AGCCCAAGCCACATCACCGGGCCCACTATGAGACAGAAGGCAGCCGAGGGGCTGTCAAAGCTCCAACTGGAGGCCACCCTGTGGTTCAGC
TCCATGGCTACATGGAAAACAAGCCTCTGGGACTTCAGATCTTCATTGGGACAGCTGATGAGCGGATCCTTAAGCCGCACGCCTTCTACC
AGGTGCACCGAATCACGGGGAAAACTGTCACCACCACCAGCTATGAGAAGATAGTGGGCAACACCAAAGTCCTGGAGATACCCTTGGAGC
CCAAAAACAACATGAGGGCAACCATCGACTGTGCGGGGATCTTGAAGCTTAGAAACGCCGACATTGAGCTGCGGAAAGGCGAGACGGACA
TTGGAAGAAAGAACACGCGGGTGAGACTGGTTTTCCGAGTTCACATCCCAGAGTCCAGTGGCAGAATCGTCTCTTTACAGACTGCATCTA
ACCCCATCGAGTGCTCCCAGCGATCTGCTCACGAGCTGCCCATGGTTGAAAGACAAGACACAGACAGCTGCCTGGTCTATGGCGGCCAGC
AAATGATCCTCACGGGGCAGAACTTTACATCCGAGTCCAAAGTTGTGTTTACTGAGAAGACCACAGATGGACAGCAAATTTGGGAGATGG
AAGCCACGGTGGATAAGGACAAGAGCCAGCCCAACATGCTTTTTGTTGAGATCCCTGAATATCGGAACAAGCATATCCGCACACCTGTAA
AAGTGAACTTCTACGTCATCAATGGGAAGAGAAAACGAAGTCAGCCTCAGCACTTTACCTACCACCCAGTCCCAGCCATCAAGACGGAGC
CCACGGATGAATATGACCCCACTCTGATCTGCAGCCCCACCCATGGAGGCCTGGGGAGCCAGCCTTACTACCCCCAGCACCCGATGGTGG
CCGAGTCCCCCTCCTGCCTCGTGGCCACCATGGCTCCCTGCCAGCAGTTCCGCACGGGGCTCTCATCCCCTGACGCCCGCTACCAGCAAC
AGAACCCAGCGGCCGTACTCTACCAGCGGAGCAAGAGCCTGAGCCCCAGCCTGCTGGGCTATCAGCAGCCGGCCCTCATGGCCGCCCCGC
TGTCCCTTGCGGACGCTCACCGCTCTGTGCTGGTGCACGCCGGCTCCCAGGGCCAGAGCTCAGCCCTGCTCCACCCCTCTCCGACCAACC
AGCAGGCCTCGCCTGTGATCCACTACTCACCCACCAACCAGCAGCTGCGCTGCGGAAGCCACCAGGAGTTCCAGCACATCATGTACTGCG
AGAATTTCGCACCAGGCACCACCAGACCTGGCCCGCCCCCGGTCAGTCAAGGTCAGAGGCTGAGCCCGGGTTCCTACCCCACAGTCATTC
AGCAGCAGAATGCCACGAGCCAAAGAGCCGCCAAAAACGGACCCCCGGTCAGTGACCAAAAGGAAGTATTACCTGCGGGGGTGACCATTA
AACAGGAGCAGAACTTGGACCAGACCTACTTGGATGATGAGCTGATAGACACACACCTTAGCTGGATACAAAACATATTATGAAACAGAA
TGACTGTGATCTTTGATCCGAGAAATCAAAGTTAAAGTTAATGAAATTATCAGGAAGGAGTTTTCAGGACCTCCTGCCAGAAATCAGACG
TAAAAGAAGCCATTATAGCAAGACACCTTCTGTATCTGACCCCTCGGAGCCCTCCACAGCCCCTCACCTTCTGTCTCCTTTCATGTTCAT

>In-frame_EWSR1_ENST00000332035_chr22_29684775_+_NFATC2_ENST00000414705_chr20_50133495_-_2691nt
AAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTC
AAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGA
CCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACA
GCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTG
CATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGCTATTCCTCTACACAGCCGACTAGTT
ATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATG
GGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGC
AGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGGA
GCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGTG
GAATGGGCATCCCAGTGACTGCATCCCTCCCTCCACTTGAGTGGCCGCTGTCCAGTCAGTCAGGCTCTTACGAGCTGCGGATCGAGGTGC
AGCCCAAGCCACATCACCGGGCCCACTATGAGACAGAAGGCAGCCGAGGGGCTGTCAAAGCTCCAACTGGAGGCCACCCTGTGGTTCAGC
TCCATGGCTACATGGAAAACAAGCCTCTGGGACTTCAGATCTTCATTGGGACAGCTGATGAGCGGATCCTTAAGCCGCACGCCTTCTACC
AGGTGCACCGAATCACGGGGAAAACTGTCACCACCACCAGCTATGAGAAGATAGTGGGCAACACCAAAGTCCTGGAGATACCCTTGGAGC
CCAAAAACAACATGAGGGCAACCATCGACTGTGCGGGGATCTTGAAGCTTAGAAACGCCGACATTGAGCTGCGGAAAGGCGAGACGGACA
TTGGAAGAAAGAACACGCGGGTGAGACTGGTTTTCCGAGTTCACATCCCAGAGTCCAGTGGCAGAATCGTCTCTTTACAGACTGCATCTA
ACCCCATCGAGTGCTCCCAGCGATCTGCTCACGAGCTGCCCATGGTTGAAAGACAAGACACAGACAGCTGCCTGGTCTATGGCGGCCAGC
AAATGATCCTCACGGGGCAGAACTTTACATCCGAGTCCAAAGTTGTGTTTACTGAGAAGACCACAGATGGACAGCAAATTTGGGAGATGG
AAGCCACGGTGGATAAGGACAAGAGCCAGCCCAACATGCTTTTTGTTGAGATCCCTGAATATCGGAACAAGCATATCCGCACACCTGTAA
AAGTGAACTTCTACGTCATCAATGGGAAGAGAAAACGAAGTCAGCCTCAGCACTTTACCTACCACCCAGTCCCAGCCATCAAGACGGAGC
CCACGGATGAATATGACCCCACTCTGATCTGCAGCCCCACCCATGGAGGCCTGGGGAGCCAGCCTTACTACCCCCAGCACCCGATGGTGG
CCGAGTCCCCCTCCTGCCTCGTGGCCACCATGGCTCCCTGCCAGCAGTTCCGCACGGGGCTCTCATCCCCTGACGCCCGCTACCAGCAAC
AGAACCCAGCGGCCGTACTCTACCAGCGGAGCAAGAGCCTGAGCCCCAGCCTGCTGGGCTATCAGCAGCCGGCCCTCATGGCCGCCCCGC
TGTCCCTTGCGGACGCTCACCGCTCTGTGCTGGTGCACGCCGGCTCCCAGGGCCAGAGCTCAGCCCTGCTCCACCCCTCTCCGACCAACC
AGCAGGCCTCGCCTGTGATCCACTACTCACCCACCAACCAGCAGCTGCGCTGCGGAAGCCACCAGGAGTTCCAGCACATCATGTACTGCG
AGAATTTCGCACCAGGCACCACCAGACCTGGCCCGCCCCCGGTCAGTCAAGGTCAGAGGCTGAGCCCGGGTTCCTACCCCACAGTCATTC
AGCAGCAGAATGCCACGAGCCAAAGAGCCGCCAAAAACGGACCCCCGGTCAGTGACCAAAAGGAAGTATTACCTGCGGGGGTGACCATTA
AACAGGAGCAGAACTTGGACCAGACCTACTTGGATGATGAGCTGATAGACACACACCTTAGCTGGATACAAAACATATTATGAAACAGAA
TGACTGTGATCTTTGATCCGAGAAATCAAAGTTAAAGTTAATGAAATTATCAGGAAGGAGTTTTCAGGACCTCCTGCCAGAAATCAGACG
TAAAAGAAGCCATTATAGCAAGACACCTTCTGTATCTGACCCCTCGGAGCCCTCCACAGCCCCTCACCTTCTGTCTCCTTTCATGTTCAT

>In-frame_EWSR1_ENST00000332035_chr22_29684775_+_NFATC2_ENST00000609507_chr20_50133495_-_2691nt
AAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTC
AAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGA
CCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACA
GCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTG
CATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGCTATTCCTCTACACAGCCGACTAGTT
ATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATG
GGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGC
AGCAGAGTTCATTCCGACAGGACCACCCCAGTAGCATGGGTGTTTATGGGCAGGAGTCTGGAGGATTTTCCGGACCAGGAGAGAACCGGA
GCATGAGTGGCCCTGATAACCGGGGCAGGGGAAGAGGGGGATTTGATCGTGGAGGCATGAGCAGAGGTGGGCGGGGAGGAGGACGCGGTG
GAATGGGCATCCCAGTGACTGCATCCCTCCCTCCACTTGAGTGGCCGCTGTCCAGTCAGTCAGGCTCTTACGAGCTGCGGATCGAGGTGC
AGCCCAAGCCACATCACCGGGCCCACTATGAGACAGAAGGCAGCCGAGGGGCTGTCAAAGCTCCAACTGGAGGCCACCCTGTGGTTCAGC
TCCATGGCTACATGGAAAACAAGCCTCTGGGACTTCAGATCTTCATTGGGACAGCTGATGAGCGGATCCTTAAGCCGCACGCCTTCTACC
AGGTGCACCGAATCACGGGGAAAACTGTCACCACCACCAGCTATGAGAAGATAGTGGGCAACACCAAAGTCCTGGAGATACCCTTGGAGC
CCAAAAACAACATGAGGGCAACCATCGACTGTGCGGGGATCTTGAAGCTTAGAAACGCCGACATTGAGCTGCGGAAAGGCGAGACGGACA
TTGGAAGAAAGAACACGCGGGTGAGACTGGTTTTCCGAGTTCACATCCCAGAGTCCAGTGGCAGAATCGTCTCTTTACAGACTGCATCTA
ACCCCATCGAGTGCTCCCAGCGATCTGCTCACGAGCTGCCCATGGTTGAAAGACAAGACACAGACAGCTGCCTGGTCTATGGCGGCCAGC
AAATGATCCTCACGGGGCAGAACTTTACATCCGAGTCCAAAGTTGTGTTTACTGAGAAGACCACAGATGGACAGCAAATTTGGGAGATGG
AAGCCACGGTGGATAAGGACAAGAGCCAGCCCAACATGCTTTTTGTTGAGATCCCTGAATATCGGAACAAGCATATCCGCACACCTGTAA
AAGTGAACTTCTACGTCATCAATGGGAAGAGAAAACGAAGTCAGCCTCAGCACTTTACCTACCACCCAGTCCCAGCCATCAAGACGGAGC
CCACGGATGAATATGACCCCACTCTGATCTGCAGCCCCACCCATGGAGGCCTGGGGAGCCAGCCTTACTACCCCCAGCACCCGATGGTGG
CCGAGTCCCCCTCCTGCCTCGTGGCCACCATGGCTCCCTGCCAGCAGTTCCGCACGGGGCTCTCATCCCCTGACGCCCGCTACCAGCAAC
AGAACCCAGCGGCCGTACTCTACCAGCGGAGCAAGAGCCTGAGCCCCAGCCTGCTGGGCTATCAGCAGCCGGCCCTCATGGCCGCCCCGC
TGTCCCTTGCGGACGCTCACCGCTCTGTGCTGGTGCACGCCGGCTCCCAGGGCCAGAGCTCAGCCCTGCTCCACCCCTCTCCGACCAACC
AGCAGGCCTCGCCTGTGATCCACTACTCACCCACCAACCAGCAGCTGCGCTGCGGAAGCCACCAGGAGTTCCAGCACATCATGTACTGCG
AGAATTTCGCACCAGGCACCACCAGACCTGGCCCGCCCCCGGTCAGTCAAGGTCAGAGGCTGAGCCCGGGTTCCTACCCCACAGTCATTC
AGCAGCAGAATGCCACGAGCCAAAGAGCCGCCAAAAACGGACCCCCGGTCAGTGACCAAAAGGAAGTATTACCTGCGGGGGTGACCATTA
AACAGGAGCAGAACTTGGACCAGACCTACTTGGATGATGAGCTGATAGACACACACCTTAGCTGGATACAAAACATATTATGAAACAGAA
TGACTGTGATCTTTGATCCGAGAAATCAAAGTTAAAGTTAATGAAATTATCAGGAAGGAGTTTTCAGGACCTCCTGCCAGAAATCAGACG
TAAAAGAAGCCATTATAGCAAGACACCTTCTGTATCTGACCCCTCGGAGCCCTCCACAGCCCCTCACCTTCTGTCTCCTTTCATGTTCAT


Top

FusionGenePPI for EWSR1_NFATC2


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
EWSR1PRTFDC1, ZDHHC3, MSC, SLC22A24, MYO1F, KXD1, KHDRBS2, DNAJB3, FASN, NLE1, MNS1, PRUNE2, WWP2, NDUFB1, BNIP3L, NSUN4, KRR1, WWP1, RMND5B, SLC1A1, RASL11B, DFFA, WDR37, RPS15A, CPSF6, C11orf16, YY1AP1, RNF183, MTCP1, TULP2, RBPMS, KEL, MYOZ2, FAM131C, HMGA1, NPPB, HERPUD1, CD177, RPL31, VPS72, ACTL6A, RAD23A, MAGEA11, CFDP1, DMRTB1, CXADR, ZNF165, SSBP2, TPGS2, RAB37, CETP, NDUFV1, DYNLL2, NBPF3, CEACAM5, GPBP1L1, SERP2, GNPDA1, C19orf57, ELAVL3, ELAVL4, LILRA3, BAD, CCDC7, MRPS18B, CUEDC2, CNST, TSPAN3, CCDC91, TRIM37, NINL, NTNG2, CPSF7, PGLS, EPT1, MYL6, SMAD4, TMSB4Y, TRPV5, MVK, MAPK1IP1L, MDFI, MTMR9, PLSCR1, RALYL, PDHX, C10orf12, RHOXF2, MATK, SALL2, AGT, KCNMB1, SUV39H2, SMNDC1, ARHGDIA, PUF60, GSK3B, ILK, CD2BP2, BARD1, CREBBP, BTK, SF1, SNRPC, ELK1, PTK2B, CALM1, POU4F1, EZH2, IRF3, TONSL, RFX3, HLTF, SUPT4H1, ZNF184, HIST1H2BN, BLZF1, HDAC3, FXR2, HMGN4, POLR3A, ECD, ZBTB1, SCMH1, SUZ12, E2F8, TRIM5, ZNF383, DHX9, SMN1, PCM1, RAD21, NDRG1, CEBPA, ELAVL1, SIRT7, HNRNPA1, TSG101, TP53, POLR2A, YBX1, TDRD3, CUL3, CUL4A, CUL4B, CUL5, CUL2, CUL1, COPS5, COPS6, DCUN1D1, CAND1, NEDD8, KCND3, ATN1, ATXN3, ERCC5, HBP1, HSPA2, PCBP1, USP7, SRSF5, TMEM126A, SAP30BP, GORASP2, MBD3, MRPS9, HAX1, SFXN1, ITGA5, TCIRG1, RNF168, GEMIN5, HAS1, MTCH1, NDUFA5, MCAT, MRPL57, HDAC2, ESR1, FN1, VCAM1, ITGA4, CD81, PRMT1, SF3B4, EP300, PRRC2A, EWSR1, FUS, ITGB5, NONO, TRAF3, HNRNPUL1, EPAS1, CHERP, CDK12, ITCH, WBP4, RPA3, RPA2, RPA1, HSPA5, RIOK2, TRAF1, TRAF2, SEC24D, TFG, SEC24A, SSBP3, PRR13, ATPAF2, PEF1, JUN, CUL7, OBSL1, CCDC8, RNF2, BMI1, EGFR, ABL1, SRPK1, ABCE1, PRMT8, RPS6KB2, ACAA2, ACAT1, EIF4H, ANXA2, HIP1R, PICALM, POR, NTRK1, SCARNA22, NPM1, KRT2, PRDX2, S100A9, YWHAZ, DDX17, PCLO, ANXA6, SEC24C, GIPC1, CSRP2, FHL1, HNRNPA3, CTTN, MARCKSL1, PARP1, SERPINB3, CCDC50, KIF2A, KRT6B, HIST1H1D, STK38, H2AFV, PACSIN2, U2AF1, RSL24D1, XRCC5, ESYT3, RPL29, SDF2L1, LRP1B, MSN, SEC23A, RPL7A, SNX18, PPIL1, RPS27A, IGHM, SUMO3, GTF2I, RUVBL1, KRT16, RBM8A, RPL8, SRSF9, ZC3HAV1L, GAPDH, ETV3, IGF2R, COL5A2, HNRNPD, ANP32B, WAC, TFAP2A, TTN, CBR3, ARGLU1, HNRNPAB, SRRT, ATP1B3, COPS7B, PRR12, ATF3, NOMO3, NOMO1, NOMO2, EYA3, C1orf198, MAZ, U2AF2, SSB, TRA2B, C1orf52, HMGB1, HMGB1P10, RPRD1A, HNRNPH3, EIF5A2, C1orf131, SEC13, MAPRE1, CSTF2T, SRSF3, LENG1, UPF1, HDGFRP2, RPS10P7, RPS10P11, RPS10, RPS10P13, RPS10P4, RPS10P22, DACH1, ANO1, NCOR1, MLX, SUMO1P3, SUMO1, WIZ, PFDN6, ARFIP2, ZHX3, EEF1B2, MBIP, BAG6, DENND2A, PRCC, SRSF1, EIF4ENIF1, SPTAN1, CDCA8, PLS3, API5P1, API5, PSMA4, DNTTIP1, AKAP8, NCOA3, SMTN, FBRS, SMARCE1, ERC1, WBP11, SPTBN1, NFRKB, OLA1, ZNF207, R3HDM1, TRIM33, SAFB, UBFD1, SRSF7, SRSF2, GATA6, VDAC1P1, VDAC1, IL16, GMNN, ILF2, MED4, QKI, VCL, MFAP1, SNAP29, PADI1, BCL9, BCL9L, PKM, GPATCH11, CASC3, PSMC6, CACYBP, RPL12P6, RPL12P32, RPL12P14, RPL12, RPL12P2, RPL12P35, RPL12P19, TPI1, TPI1P1, CHAF1A, MIA3, CIC, SDCBP, CA2, FKBP3, ACE, NKX2-5, CSTF2, PFDN2, UBTF, FAM207A, LOC729774, BRD8, C12orf45, C1orf35, TCF20, SOD1, SPAG7, MED8, ETS2, ALDOC, FKBP4, INCENP, CEP85, CECR2, TFE3, SUPT16HP1, SUPT16H, MAPT, HTATSF1, RPS18P12, RPS18P5, KPNA2, TMX1, CKAP4, HSPE1, COPRS, PTGES3, LAMP2, ERLIN2, CTNNBL1, TOMM22, NRBF2, C9orf78, NCOA6, MED26, RANBP1, LOC389842, LOC727803, HMGB3, CANX, PUS7, RPSAP19, RPSA, RPSAP18, RPSAP58, RPSAP15, RPSAP8, RPSAP9, RPSAP12, RPSAP29, RPSAP61, ARHGAP17, USF1, PSIP1, SNRPEP2, SNRPE, NUDT5, PPM1G, OTUB1, AHCY, COPS3, NSMCE2, SAE1, PROSER1, GRWD1, CREB5, TAF9B, RBM33, EDF1, PGK1, FAM114A2, SRRM1, RAD23B, CIAPIN1, CIAPIN1P, LRRC59, PABPN1, KMT2A, RPRD1B, GPATCH8, CCDC43, DGCR14, PPP1R2, ERICH1, EIF5A, EIF5AL1, BAG3, PCNA, SOX7, PNISR, FAM168A, MED15, SRSF11, SIRT1, RSF1, MAML1, HPRT1, SPDL1, CRTC3, CEP55, CDV3, ALYREF, RNF40, STOML2, DGCR8, NUCKS1, UBN2, PSMD7, WNT10A, HMBS, KHDRBS1, VBP1, NCSTN, CDCA2, SFSWAP, ZRANB2, DDB1, RBBP6, ZEB1, SRSF6, LOC644422, EIF2S1, RFX5, RPS19, RPS19P3, TALDO1, CWC15, CDCA5, LOC645086, C11orf58, TXN, STX12, PHRF1, BSG, TAF4, SH3GL1, LIN37, HRNR, FAM192A, RRBP1, KIAA0907, GOLGB1, PAX9, P4HB, CHMP5, LDHB, CALR, SUMO2P1, SUMO2, PDIA6, AHSA1, EN2, CCDC124, RPLP0P6, RPLP0P2, RPLP0P3, RPLP0, NIPBL, PDLIM4, PRKCSH, C15orf39, HNRNPDL, PDIA4, NUP210, RPLP2P3, RPLP2, PRDX4, DAZAP1, UBE2T, PHAX, AMOT, MARCKS, LOC284685, SMARCC1, BCORL1, RFC4, GLRX3, ANP32E, HYOU1, NPM3, ATF7IP, SARNP, TRA2A, HDGF, STIP1, PELP1, KCTD12, GLO1, PCF11, CLIC1, DNAJC8, RNF114, SLC4A1AP, FAM50A, GTF2A1, PRPF40A, CDC37, PPIAP22, PPIA, SMARCC2, MEGF11, KIAA1143, DENR, LAMP1, MYBL2, PITX1, UBE2MP1, UBE2M, CHTF8, OTX1, NACA, FNBP4, GTF2F2, GLTSCR1, GTF2E1, PQBP1, EMD, RNF113A, GPALPP1, SNRPA, RRP15, RPS25, RPS25P8, GMEB2, LNPEP, DNAJB1, IGBP1P1, IGBP1, HINT1, ARID1A, PPIB, ANXA11, MATR3, PPARGC1A, MCM2, UBASH3B, SFPQ, CAPN13, HEY1, BRCA1NFATC2NFATC2, EP300, CREBBP, MED31, VIM, PRKCZ, PIN1, MEF2D, IRF4, FOXP3, MAPK9, MAPK8, SUV39H1, TUBA1A, KPNB1, TAF9, HNRNPA1, TFAP4, IRF2BP2, JUN, LRRK2, IQGAP1, CSE1L, TNPO1, PPP2R1A, USP22, GNB2, CREB1, IKZF1, RPTOR, FOS, CHEK1, SCAI, IKZF2, GSK3B, RUNX1, SATB1, WDR48, NFATC1, ZNF384, ATF7, ZNF131, MAFK, XRCC5, PRKDC, CSNK1D, JUNB, NFYC, PLK1, LIG3, XRCC1, HSPA1A, HLTF, BTAF1, YWHAB, CHAF1B, LEF1, IRF2BP1, JUND, TFAM, MAFG, SSBP1, RANBP9, CHAMP1, RPA1, WDR26, ZNF148, FOXK1, ZNF217, DEK, RPA3, POLG, CACYBP, RPA2, NFYB, PARP1, ETV6, XRCC6, KIF4A, RFC4, RFC3, EGR1, CAD, RFC5, CTBP1, RFC2, BCL11B, YWHAG, KIF2C, RNGTT, PRDM15, ALDH18A1, MTHFD2, YWHAE, MRPL39, TUFM, IFI16, TP53BP1, ERAL1, SSRP1, TRRAP, YWHAQ, HIRA, ERCC3, UBE2S, SUPT6H, ARID1A, HSPA9, POGZ, UHRF1, SUCLA2, HSPA5, DPF2, YWHAZ, GATAD2A, LRRC47, ZMYM2, DNAJA1, IDH3A, SDHA, CBX5, CABIN1, VAPA, CBX3, MRE11A, SMARCA5, EEF2, RB1, MCRS1, EMD, GTF2H2C, GTF2H2, GTF2H2C_2, SUPT5H, RCOR1, VAPB, MRPL17, UQCRC2, TCF12, BEND3, SMARCA4, KDM1A, SMARCD2, AIFM1, MCM2, H2AFY, HSPA8, POLDIP2, RAD50, SMARCC1, POLR1C, TIMM50, MTA2, HADHA, TLK2, TLK1, RBBP4, GATAD2B, RANBP2, CEBPE, ADNP, SMARCE1, CNP, CBX1, SMARCC2, ZNF24, CHD4, SMARCD1, MBD3, NUDC, ACTL6A, MTA1, IDH3B, CSTF1, RPL23, PPP1CA, HSPH1, PMPCB, GTF3C5, TCP1, GTF3C4, DCAF7, HDAC1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for EWSR1_NFATC2


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for EWSR1_NFATC2


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneEWSR1C0553580Ewings sarcoma3CTD_human;HPO;ORPHANET
HgeneEWSR1C0206663Neuroectodermal Tumor, Primitive1CTD_human
TgeneNFATC2C0027765nervous system disorder1CTD_human