FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 12228

FusionGeneSummary for EWSR1_ATF1

check button Fusion gene summary
Fusion gene informationFusion gene name: EWSR1_ATF1
Fusion gene ID: 12228
HgeneTgene
Gene symbol

EWSR1

ATF1

Gene ID

2130

2668

Gene nameEWS RNA binding protein 1glial cell derived neurotrophic factor
SynonymsEWS|EWS-FLI1|bK984G1.4ATF|ATF1|ATF2|HFB1-GDNF|HSCR3
Cytomap

22q12.2

5p13.2

Type of geneprotein-codingprotein-coding
DescriptionRNA-binding protein EWSEWS RNA-binding protein variant 6Ewing sarcoma breakpoint region 1Ewings sarcoma EWS-Fli1 (type 1) oncogeneglial cell line-derived neurotrophic factorastrocyte-derived trophic factor
Modification date2018052720180519
UniProtAcc

Q01844

P18846

Ensembl transtripts involved in fusion geneENST00000332050, ENST00000397938, 
ENST00000406548, ENST00000331029, 
ENST00000414183, ENST00000333395, 
ENST00000332035, 
ENST00000262053, 
ENST00000539132, 
Fusion gene scores* DoF score17 X 31 X 5=26355 X 7 X 3=105
# samples 5310
** MAII scorelog2(53/2635*10)=-2.31373869707402
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(10/105*10)=-0.070389327891398
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: EWSR1 [Title/Abstract] AND ATF1 [Title/Abstract] AND fusion [Title/Abstract]

Expression profiling of t(12;22) positive clear cell sarcoma of soft tissue cell lines reveals characteristic up-regulation of potential new marker genes including ERBB3 (pmid: 15150091)
Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Transcription factor involved fusion gene, inframe and retained DNA-binding domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneATF1

GO:0001755

neural crest cell migration

15242795

TgeneATF1

GO:0008284

positive regulation of cell proliferation

22897442

TgeneATF1

GO:0031175

neuron projection development

15242795

TgeneATF1

GO:0032770

positive regulation of monooxygenase activity

12358785

TgeneATF1

GO:0043524

negative regulation of neuron apoptotic process

8493557

TgeneATF1

GO:0045944

positive regulation of transcription by RNA polymerase II

12358785

TgeneATF1

GO:0048255

mRNA stabilization

12358785

TgeneATF1

GO:0051584

regulation of dopamine uptake involved in synaptic transmission

8493557

TgeneATF1

GO:0072107

positive regulation of ureteric bud formation

8657307

TgeneATF1

GO:0090190

positive regulation of branching involved in ureteric bud morphogenesis

8657307|17229286

TgeneATF1

GO:2001240

negative regulation of extrinsic apoptotic signaling pathway in absence of ligand

10921886


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
ChiTaRS3.1AF047022EWSR1chr22

29683123

+ATF1chr12

51207793

+
ChiTaRS3.1JF290488EWSR1chr22

29683123

+ATF1chr12

51207793

+
ChiTaRS3.1JN202449EWSR1chr22

29687856

+ATF1chr12

51203238

+
ChiTaRS3.1JN624779EWSR1chr22

29683123

+ATF1chr12

51208063

+
ChiTaRS3.1JF290487EWSR1chr22

29684775

+ATF1chr12

51203238

+
ChiTaRS3.1JN202448EWSR1chr22

29683123

+ATF1chr12

51203239

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000332050ENST00000262053EWSR1chr22

29683123

+ATF1chr12

51207793

+
5CDS-5UTRENST00000332050ENST00000539132EWSR1chr22

29683123

+ATF1chr12

51207793

+
In-frameENST00000397938ENST00000262053EWSR1chr22

29683123

+ATF1chr12

51207793

+
5CDS-5UTRENST00000397938ENST00000539132EWSR1chr22

29683123

+ATF1chr12

51207793

+
In-frameENST00000406548ENST00000262053EWSR1chr22

29683123

+ATF1chr12

51207793

+
5CDS-5UTRENST00000406548ENST00000539132EWSR1chr22

29683123

+ATF1chr12

51207793

+
In-frameENST00000331029ENST00000262053EWSR1chr22

29683123

+ATF1chr12

51207793

+
5CDS-5UTRENST00000331029ENST00000539132EWSR1chr22

29683123

+ATF1chr12

51207793

+
In-frameENST00000414183ENST00000262053EWSR1chr22

29683123

+ATF1chr12

51207793

+
5CDS-5UTRENST00000414183ENST00000539132EWSR1chr22

29683123

+ATF1chr12

51207793

+
In-frameENST00000333395ENST00000262053EWSR1chr22

29683123

+ATF1chr12

51207793

+
5CDS-5UTRENST00000333395ENST00000539132EWSR1chr22

29683123

+ATF1chr12

51207793

+
In-frameENST00000332035ENST00000262053EWSR1chr22

29683123

+ATF1chr12

51207793

+
5CDS-5UTRENST00000332035ENST00000539132EWSR1chr22

29683123

+ATF1chr12

51207793

+
intron-3CDSENST00000332050ENST00000262053EWSR1chr22

29687856

+ATF1chr12

51203238

+
intron-intronENST00000332050ENST00000539132EWSR1chr22

29687856

+ATF1chr12

51203238

+
intron-3CDSENST00000397938ENST00000262053EWSR1chr22

29687856

+ATF1chr12

51203238

+
intron-intronENST00000397938ENST00000539132EWSR1chr22

29687856

+ATF1chr12

51203238

+
intron-3CDSENST00000406548ENST00000262053EWSR1chr22

29687856

+ATF1chr12

51203238

+
intron-intronENST00000406548ENST00000539132EWSR1chr22

29687856

+ATF1chr12

51203238

+
intron-3CDSENST00000331029ENST00000262053EWSR1chr22

29687856

+ATF1chr12

51203238

+
intron-intronENST00000331029ENST00000539132EWSR1chr22

29687856

+ATF1chr12

51203238

+
intron-3CDSENST00000414183ENST00000262053EWSR1chr22

29687856

+ATF1chr12

51203238

+
intron-intronENST00000414183ENST00000539132EWSR1chr22

29687856

+ATF1chr12

51203238

+
intron-3CDSENST00000333395ENST00000262053EWSR1chr22

29687856

+ATF1chr12

51203238

+
intron-intronENST00000333395ENST00000539132EWSR1chr22

29687856

+ATF1chr12

51203238

+
intron-3CDSENST00000332035ENST00000262053EWSR1chr22

29687856

+ATF1chr12

51203238

+
intron-intronENST00000332035ENST00000539132EWSR1chr22

29687856

+ATF1chr12

51203238

+
In-frameENST00000332050ENST00000262053EWSR1chr22

29683123

+ATF1chr12

51208063

+
In-frameENST00000332050ENST00000539132EWSR1chr22

29683123

+ATF1chr12

51208063

+
In-frameENST00000397938ENST00000262053EWSR1chr22

29683123

+ATF1chr12

51208063

+
In-frameENST00000397938ENST00000539132EWSR1chr22

29683123

+ATF1chr12

51208063

+
In-frameENST00000406548ENST00000262053EWSR1chr22

29683123

+ATF1chr12

51208063

+
In-frameENST00000406548ENST00000539132EWSR1chr22

29683123

+ATF1chr12

51208063

+
In-frameENST00000331029ENST00000262053EWSR1chr22

29683123

+ATF1chr12

51208063

+
In-frameENST00000331029ENST00000539132EWSR1chr22

29683123

+ATF1chr12

51208063

+
In-frameENST00000414183ENST00000262053EWSR1chr22

29683123

+ATF1chr12

51208063

+
In-frameENST00000414183ENST00000539132EWSR1chr22

29683123

+ATF1chr12

51208063

+
In-frameENST00000333395ENST00000262053EWSR1chr22

29683123

+ATF1chr12

51208063

+
In-frameENST00000333395ENST00000539132EWSR1chr22

29683123

+ATF1chr12

51208063

+
In-frameENST00000332035ENST00000262053EWSR1chr22

29683123

+ATF1chr12

51208063

+
In-frameENST00000332035ENST00000539132EWSR1chr22

29683123

+ATF1chr12

51208063

+
intron-3CDSENST00000332050ENST00000262053EWSR1chr22

29684775

+ATF1chr12

51203238

+
intron-intronENST00000332050ENST00000539132EWSR1chr22

29684775

+ATF1chr12

51203238

+
In-frameENST00000397938ENST00000262053EWSR1chr22

29684775

+ATF1chr12

51203238

+
5CDS-intronENST00000397938ENST00000539132EWSR1chr22

29684775

+ATF1chr12

51203238

+
In-frameENST00000406548ENST00000262053EWSR1chr22

29684775

+ATF1chr12

51203238

+
5CDS-intronENST00000406548ENST00000539132EWSR1chr22

29684775

+ATF1chr12

51203238

+
intron-3CDSENST00000331029ENST00000262053EWSR1chr22

29684775

+ATF1chr12

51203238

+
intron-intronENST00000331029ENST00000539132EWSR1chr22

29684775

+ATF1chr12

51203238

+
In-frameENST00000414183ENST00000262053EWSR1chr22

29684775

+ATF1chr12

51203238

+
5CDS-intronENST00000414183ENST00000539132EWSR1chr22

29684775

+ATF1chr12

51203238

+
In-frameENST00000333395ENST00000262053EWSR1chr22

29684775

+ATF1chr12

51203238

+
5CDS-intronENST00000333395ENST00000539132EWSR1chr22

29684775

+ATF1chr12

51203238

+
In-frameENST00000332035ENST00000262053EWSR1chr22

29684775

+ATF1chr12

51203238

+
5CDS-intronENST00000332035ENST00000539132EWSR1chr22

29684775

+ATF1chr12

51203238

+
Frame-shitENST00000332050ENST00000262053EWSR1chr22

29683123

+ATF1chr12

51203239

+
5CDS-intronENST00000332050ENST00000539132EWSR1chr22

29683123

+ATF1chr12

51203239

+
Frame-shitENST00000397938ENST00000262053EWSR1chr22

29683123

+ATF1chr12

51203239

+
5CDS-intronENST00000397938ENST00000539132EWSR1chr22

29683123

+ATF1chr12

51203239

+
Frame-shitENST00000406548ENST00000262053EWSR1chr22

29683123

+ATF1chr12

51203239

+
5CDS-intronENST00000406548ENST00000539132EWSR1chr22

29683123

+ATF1chr12

51203239

+
Frame-shitENST00000331029ENST00000262053EWSR1chr22

29683123

+ATF1chr12

51203239

+
5CDS-intronENST00000331029ENST00000539132EWSR1chr22

29683123

+ATF1chr12

51203239

+
Frame-shitENST00000414183ENST00000262053EWSR1chr22

29683123

+ATF1chr12

51203239

+
5CDS-intronENST00000414183ENST00000539132EWSR1chr22

29683123

+ATF1chr12

51203239

+
Frame-shitENST00000333395ENST00000262053EWSR1chr22

29683123

+ATF1chr12

51203239

+
5CDS-intronENST00000333395ENST00000539132EWSR1chr22

29683123

+ATF1chr12

51203239

+
Frame-shitENST00000332035ENST00000262053EWSR1chr22

29683123

+ATF1chr12

51203239

+
5CDS-intronENST00000332035ENST00000539132EWSR1chr22

29683123

+ATF1chr12

51203239

+

Top

FusionProtFeatures for EWSR1_ATF1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
EWSR1

Q01844

ATF1

P18846

Might normally function as a transcriptional repressor.EWS-fusion-proteins (EFPS) may play a role in the tumorigenicprocess. They may disturb gene expression by mimicking, orinterfering with the normal function of CTD-POLII within thetranscription initiation complex. They may also contribute to anaberrant activation of the fusion protein target genes. This protein binds the cAMP response element (CRE)(consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in manyviral and cellular promoters. Binds to the Tax-responsive element(TRE) of HTLV-I. Mediates PKA-induced stimulation of CRE-reportergenes. Represses the expression of FTH1 and other antioxidantdetoxification genes. Triggers cell proliferation andtransformation. {ECO:0000269|PubMed:18794154,ECO:0000269|PubMed:20980392}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneEWSR1chr22:29683123chr12:51207793ENST00000332035+616111_116208601RepeatNote=12
HgeneEWSR1chr22:29683123chr12:51207793ENST00000332035+616117_125208601RepeatNote=13
HgeneEWSR1chr22:29683123chr12:51207793ENST00000332035+616126_156208601RepeatNote=14
HgeneEWSR1chr22:29683123chr12:51207793ENST00000332035+616157_163208601RepeatNote=15
HgeneEWSR1chr22:29683123chr12:51207793ENST00000332035+616164_170208601RepeatNote=16
HgeneEWSR1chr22:29683123chr12:51207793ENST00000332035+616171_177208601RepeatNote=17
HgeneEWSR1chr22:29683123chr12:51207793ENST00000332035+616178_188208601RepeatNote=18
HgeneEWSR1chr22:29683123chr12:51207793ENST00000332035+61617_27208601RepeatNote=2
HgeneEWSR1chr22:29683123chr12:51207793ENST00000332035+616189_193208601RepeatNote=19
HgeneEWSR1chr22:29683123chr12:51207793ENST00000332035+616194_201208601RepeatNote=20
HgeneEWSR1chr22:29683123chr12:51207793ENST00000332035+616202_206208601RepeatNote=21
HgeneEWSR1chr22:29683123chr12:51207793ENST00000332035+61628_34208601RepeatNote=3
HgeneEWSR1chr22:29683123chr12:51207793ENST00000332035+61635_42208601RepeatNote=4
HgeneEWSR1chr22:29683123chr12:51207793ENST00000332035+61643_50208601RepeatNote=5
HgeneEWSR1chr22:29683123chr12:51207793ENST00000332035+61651_59208601RepeatNote=6
HgeneEWSR1chr22:29683123chr12:51207793ENST00000332035+61660_68208601RepeatNote=7
HgeneEWSR1chr22:29683123chr12:51207793ENST00000332035+61669_75208601RepeatNote=8
HgeneEWSR1chr22:29683123chr12:51207793ENST00000332035+61676_84208601RepeatNote=9
HgeneEWSR1chr22:29683123chr12:51207793ENST00000332035+61685_91208601RepeatNote=10
HgeneEWSR1chr22:29683123chr12:51207793ENST00000332035+6168_16208601RepeatNote=1
HgeneEWSR1chr22:29683123chr12:51207793ENST00000332035+61692_110208601RepeatNote=11
HgeneEWSR1chr22:29683123chr12:51207793ENST00000333395+79111_116264355RepeatNote=12
HgeneEWSR1chr22:29683123chr12:51207793ENST00000333395+79117_125264355RepeatNote=13
HgeneEWSR1chr22:29683123chr12:51207793ENST00000333395+79126_156264355RepeatNote=14
HgeneEWSR1chr22:29683123chr12:51207793ENST00000333395+79157_163264355RepeatNote=15
HgeneEWSR1chr22:29683123chr12:51207793ENST00000333395+79164_170264355RepeatNote=16
HgeneEWSR1chr22:29683123chr12:51207793ENST00000333395+79171_177264355RepeatNote=17
HgeneEWSR1chr22:29683123chr12:51207793ENST00000333395+79178_188264355RepeatNote=18
HgeneEWSR1chr22:29683123chr12:51207793ENST00000333395+7917_27264355RepeatNote=2
HgeneEWSR1chr22:29683123chr12:51207793ENST00000333395+79189_193264355RepeatNote=19
HgeneEWSR1chr22:29683123chr12:51207793ENST00000333395+79194_201264355RepeatNote=20
HgeneEWSR1chr22:29683123chr12:51207793ENST00000333395+79202_206264355RepeatNote=21
HgeneEWSR1chr22:29683123chr12:51207793ENST00000333395+79207_212264355RepeatNote=22
HgeneEWSR1chr22:29683123chr12:51207793ENST00000333395+79213_218264355RepeatNote=23
HgeneEWSR1chr22:29683123chr12:51207793ENST00000333395+79219_224264355RepeatNote=24
HgeneEWSR1chr22:29683123chr12:51207793ENST00000333395+79225_230264355RepeatNote=25
HgeneEWSR1chr22:29683123chr12:51207793ENST00000333395+79231_238264355RepeatNote=26
HgeneEWSR1chr22:29683123chr12:51207793ENST00000333395+79239_245264355RepeatNote=27
HgeneEWSR1chr22:29683123chr12:51207793ENST00000333395+79246_252264355RepeatNote=28
HgeneEWSR1chr22:29683123chr12:51207793ENST00000333395+79253_259264355RepeatNote=29
HgeneEWSR1chr22:29683123chr12:51207793ENST00000333395+7928_34264355RepeatNote=3
HgeneEWSR1chr22:29683123chr12:51207793ENST00000333395+7935_42264355RepeatNote=4
HgeneEWSR1chr22:29683123chr12:51207793ENST00000333395+7943_50264355RepeatNote=5
HgeneEWSR1chr22:29683123chr12:51207793ENST00000333395+7951_59264355RepeatNote=6
HgeneEWSR1chr22:29683123chr12:51207793ENST00000333395+7960_68264355RepeatNote=7
HgeneEWSR1chr22:29683123chr12:51207793ENST00000333395+7969_75264355RepeatNote=8
HgeneEWSR1chr22:29683123chr12:51207793ENST00000333395+7976_84264355RepeatNote=9
HgeneEWSR1chr22:29683123chr12:51207793ENST00000333395+7985_91264355RepeatNote=10
HgeneEWSR1chr22:29683123chr12:51207793ENST00000333395+798_16264355RepeatNote=1
HgeneEWSR1chr22:29683123chr12:51207793ENST00000333395+7992_110264355RepeatNote=11
HgeneEWSR1chr22:29683123chr12:51207793ENST00000397938+717111_116264657RepeatNote=12
HgeneEWSR1chr22:29683123chr12:51207793ENST00000397938+717117_125264657RepeatNote=13
HgeneEWSR1chr22:29683123chr12:51207793ENST00000397938+717126_156264657RepeatNote=14
HgeneEWSR1chr22:29683123chr12:51207793ENST00000397938+717157_163264657RepeatNote=15
HgeneEWSR1chr22:29683123chr12:51207793ENST00000397938+717164_170264657RepeatNote=16
HgeneEWSR1chr22:29683123chr12:51207793ENST00000397938+717171_177264657RepeatNote=17
HgeneEWSR1chr22:29683123chr12:51207793ENST00000397938+717178_188264657RepeatNote=18
HgeneEWSR1chr22:29683123chr12:51207793ENST00000397938+71717_27264657RepeatNote=2
HgeneEWSR1chr22:29683123chr12:51207793ENST00000397938+717189_193264657RepeatNote=19
HgeneEWSR1chr22:29683123chr12:51207793ENST00000397938+717194_201264657RepeatNote=20
HgeneEWSR1chr22:29683123chr12:51207793ENST00000397938+717202_206264657RepeatNote=21
HgeneEWSR1chr22:29683123chr12:51207793ENST00000397938+717207_212264657RepeatNote=22
HgeneEWSR1chr22:29683123chr12:51207793ENST00000397938+717213_218264657RepeatNote=23
HgeneEWSR1chr22:29683123chr12:51207793ENST00000397938+717219_224264657RepeatNote=24
HgeneEWSR1chr22:29683123chr12:51207793ENST00000397938+717225_230264657RepeatNote=25
HgeneEWSR1chr22:29683123chr12:51207793ENST00000397938+717231_238264657RepeatNote=26
HgeneEWSR1chr22:29683123chr12:51207793ENST00000397938+717239_245264657RepeatNote=27
HgeneEWSR1chr22:29683123chr12:51207793ENST00000397938+717246_252264657RepeatNote=28
HgeneEWSR1chr22:29683123chr12:51207793ENST00000397938+717253_259264657RepeatNote=29
HgeneEWSR1chr22:29683123chr12:51207793ENST00000397938+71728_34264657RepeatNote=3
HgeneEWSR1chr22:29683123chr12:51207793ENST00000397938+71735_42264657RepeatNote=4
HgeneEWSR1chr22:29683123chr12:51207793ENST00000397938+71743_50264657RepeatNote=5
HgeneEWSR1chr22:29683123chr12:51207793ENST00000397938+71751_59264657RepeatNote=6
HgeneEWSR1chr22:29683123chr12:51207793ENST00000397938+71760_68264657RepeatNote=7
HgeneEWSR1chr22:29683123chr12:51207793ENST00000397938+71769_75264657RepeatNote=8
HgeneEWSR1chr22:29683123chr12:51207793ENST00000397938+71776_84264657RepeatNote=9
HgeneEWSR1chr22:29683123chr12:51207793ENST00000397938+71785_91264657RepeatNote=10
HgeneEWSR1chr22:29683123chr12:51207793ENST00000397938+7178_16264657RepeatNote=1
HgeneEWSR1chr22:29683123chr12:51207793ENST00000397938+71792_110264657RepeatNote=11
HgeneEWSR1chr22:29683123chr12:51207793ENST00000406548+717111_116264656RepeatNote=12
HgeneEWSR1chr22:29683123chr12:51207793ENST00000406548+717117_125264656RepeatNote=13
HgeneEWSR1chr22:29683123chr12:51207793ENST00000406548+717126_156264656RepeatNote=14
HgeneEWSR1chr22:29683123chr12:51207793ENST00000406548+717157_163264656RepeatNote=15
HgeneEWSR1chr22:29683123chr12:51207793ENST00000406548+717164_170264656RepeatNote=16
HgeneEWSR1chr22:29683123chr12:51207793ENST00000406548+717171_177264656RepeatNote=17
HgeneEWSR1chr22:29683123chr12:51207793ENST00000406548+717178_188264656RepeatNote=18
HgeneEWSR1chr22:29683123chr12:51207793ENST00000406548+71717_27264656RepeatNote=2
HgeneEWSR1chr22:29683123chr12:51207793ENST00000406548+717189_193264656RepeatNote=19
HgeneEWSR1chr22:29683123chr12:51207793ENST00000406548+717194_201264656RepeatNote=20
HgeneEWSR1chr22:29683123chr12:51207793ENST00000406548+717202_206264656RepeatNote=21
HgeneEWSR1chr22:29683123chr12:51207793ENST00000406548+717207_212264656RepeatNote=22
HgeneEWSR1chr22:29683123chr12:51207793ENST00000406548+717213_218264656RepeatNote=23
HgeneEWSR1chr22:29683123chr12:51207793ENST00000406548+717219_224264656RepeatNote=24
HgeneEWSR1chr22:29683123chr12:51207793ENST00000406548+717225_230264656RepeatNote=25
HgeneEWSR1chr22:29683123chr12:51207793ENST00000406548+717231_238264656RepeatNote=26
HgeneEWSR1chr22:29683123chr12:51207793ENST00000406548+717239_245264656RepeatNote=27
HgeneEWSR1chr22:29683123chr12:51207793ENST00000406548+717246_252264656RepeatNote=28
HgeneEWSR1chr22:29683123chr12:51207793ENST00000406548+717253_259264656RepeatNote=29
HgeneEWSR1chr22:29683123chr12:51207793ENST00000406548+71728_34264656RepeatNote=3
HgeneEWSR1chr22:29683123chr12:51207793ENST00000406548+71735_42264656RepeatNote=4
HgeneEWSR1chr22:29683123chr12:51207793ENST00000406548+71743_50264656RepeatNote=5
HgeneEWSR1chr22:29683123chr12:51207793ENST00000406548+71751_59264656RepeatNote=6
HgeneEWSR1chr22:29683123chr12:51207793ENST00000406548+71760_68264656RepeatNote=7
HgeneEWSR1chr22:29683123chr12:51207793ENST00000406548+71769_75264656RepeatNote=8
HgeneEWSR1chr22:29683123chr12:51207793ENST00000406548+71776_84264656RepeatNote=9
HgeneEWSR1chr22:29683123chr12:51207793ENST00000406548+71785_91264656RepeatNote=10
HgeneEWSR1chr22:29683123chr12:51207793ENST00000406548+7178_16264656RepeatNote=1
HgeneEWSR1chr22:29683123chr12:51207793ENST00000406548+71792_110264656RepeatNote=11
HgeneEWSR1chr22:29683123chr12:51207793ENST00000414183+818111_116270662RepeatNote=12
HgeneEWSR1chr22:29683123chr12:51207793ENST00000414183+818117_125270662RepeatNote=13
HgeneEWSR1chr22:29683123chr12:51207793ENST00000414183+818126_156270662RepeatNote=14
HgeneEWSR1chr22:29683123chr12:51207793ENST00000414183+818157_163270662RepeatNote=15
HgeneEWSR1chr22:29683123chr12:51207793ENST00000414183+818164_170270662RepeatNote=16
HgeneEWSR1chr22:29683123chr12:51207793ENST00000414183+818171_177270662RepeatNote=17
HgeneEWSR1chr22:29683123chr12:51207793ENST00000414183+818178_188270662RepeatNote=18
HgeneEWSR1chr22:29683123chr12:51207793ENST00000414183+81817_27270662RepeatNote=2
HgeneEWSR1chr22:29683123chr12:51207793ENST00000414183+818189_193270662RepeatNote=19
HgeneEWSR1chr22:29683123chr12:51207793ENST00000414183+818194_201270662RepeatNote=20
HgeneEWSR1chr22:29683123chr12:51207793ENST00000414183+818202_206270662RepeatNote=21
HgeneEWSR1chr22:29683123chr12:51207793ENST00000414183+818207_212270662RepeatNote=22
HgeneEWSR1chr22:29683123chr12:51207793ENST00000414183+818213_218270662RepeatNote=23
HgeneEWSR1chr22:29683123chr12:51207793ENST00000414183+818219_224270662RepeatNote=24
HgeneEWSR1chr22:29683123chr12:51207793ENST00000414183+818225_230270662RepeatNote=25
HgeneEWSR1chr22:29683123chr12:51207793ENST00000414183+818231_238270662RepeatNote=26
HgeneEWSR1chr22:29683123chr12:51207793ENST00000414183+818239_245270662RepeatNote=27
HgeneEWSR1chr22:29683123chr12:51207793ENST00000414183+818246_252270662RepeatNote=28
HgeneEWSR1chr22:29683123chr12:51207793ENST00000414183+818253_259270662RepeatNote=29
HgeneEWSR1chr22:29683123chr12:51207793ENST00000414183+81828_34270662RepeatNote=3
HgeneEWSR1chr22:29683123chr12:51207793ENST00000414183+81835_42270662RepeatNote=4
HgeneEWSR1chr22:29683123chr12:51207793ENST00000414183+81843_50270662RepeatNote=5
HgeneEWSR1chr22:29683123chr12:51207793ENST00000414183+81851_59270662RepeatNote=6
HgeneEWSR1chr22:29683123chr12:51207793ENST00000414183+81860_68270662RepeatNote=7
HgeneEWSR1chr22:29683123chr12:51207793ENST00000414183+81869_75270662RepeatNote=8
HgeneEWSR1chr22:29683123chr12:51207793ENST00000414183+81876_84270662RepeatNote=9
HgeneEWSR1chr22:29683123chr12:51207793ENST00000414183+81885_91270662RepeatNote=10
HgeneEWSR1chr22:29683123chr12:51207793ENST00000414183+8188_16270662RepeatNote=1
HgeneEWSR1chr22:29683123chr12:51207793ENST00000414183+81892_110270662RepeatNote=11
HgeneEWSR1chr22:29683123chr12:51208063ENST00000332035+616111_116208601RepeatNote=12
HgeneEWSR1chr22:29683123chr12:51208063ENST00000332035+616117_125208601RepeatNote=13
HgeneEWSR1chr22:29683123chr12:51208063ENST00000332035+616126_156208601RepeatNote=14
HgeneEWSR1chr22:29683123chr12:51208063ENST00000332035+616157_163208601RepeatNote=15
HgeneEWSR1chr22:29683123chr12:51208063ENST00000332035+616164_170208601RepeatNote=16
HgeneEWSR1chr22:29683123chr12:51208063ENST00000332035+616171_177208601RepeatNote=17
HgeneEWSR1chr22:29683123chr12:51208063ENST00000332035+616178_188208601RepeatNote=18
HgeneEWSR1chr22:29683123chr12:51208063ENST00000332035+61617_27208601RepeatNote=2
HgeneEWSR1chr22:29683123chr12:51208063ENST00000332035+616189_193208601RepeatNote=19
HgeneEWSR1chr22:29683123chr12:51208063ENST00000332035+616194_201208601RepeatNote=20
HgeneEWSR1chr22:29683123chr12:51208063ENST00000332035+616202_206208601RepeatNote=21
HgeneEWSR1chr22:29683123chr12:51208063ENST00000332035+61628_34208601RepeatNote=3
HgeneEWSR1chr22:29683123chr12:51208063ENST00000332035+61635_42208601RepeatNote=4
HgeneEWSR1chr22:29683123chr12:51208063ENST00000332035+61643_50208601RepeatNote=5
HgeneEWSR1chr22:29683123chr12:51208063ENST00000332035+61651_59208601RepeatNote=6
HgeneEWSR1chr22:29683123chr12:51208063ENST00000332035+61660_68208601RepeatNote=7
HgeneEWSR1chr22:29683123chr12:51208063ENST00000332035+61669_75208601RepeatNote=8
HgeneEWSR1chr22:29683123chr12:51208063ENST00000332035+61676_84208601RepeatNote=9
HgeneEWSR1chr22:29683123chr12:51208063ENST00000332035+61685_91208601RepeatNote=10
HgeneEWSR1chr22:29683123chr12:51208063ENST00000332035+6168_16208601RepeatNote=1
HgeneEWSR1chr22:29683123chr12:51208063ENST00000332035+61692_110208601RepeatNote=11
HgeneEWSR1chr22:29683123chr12:51208063ENST00000333395+79111_116264355RepeatNote=12
HgeneEWSR1chr22:29683123chr12:51208063ENST00000333395+79117_125264355RepeatNote=13
HgeneEWSR1chr22:29683123chr12:51208063ENST00000333395+79126_156264355RepeatNote=14
HgeneEWSR1chr22:29683123chr12:51208063ENST00000333395+79157_163264355RepeatNote=15
HgeneEWSR1chr22:29683123chr12:51208063ENST00000333395+79164_170264355RepeatNote=16
HgeneEWSR1chr22:29683123chr12:51208063ENST00000333395+79171_177264355RepeatNote=17
HgeneEWSR1chr22:29683123chr12:51208063ENST00000333395+79178_188264355RepeatNote=18
HgeneEWSR1chr22:29683123chr12:51208063ENST00000333395+7917_27264355RepeatNote=2
HgeneEWSR1chr22:29683123chr12:51208063ENST00000333395+79189_193264355RepeatNote=19
HgeneEWSR1chr22:29683123chr12:51208063ENST00000333395+79194_201264355RepeatNote=20
HgeneEWSR1chr22:29683123chr12:51208063ENST00000333395+79202_206264355RepeatNote=21
HgeneEWSR1chr22:29683123chr12:51208063ENST00000333395+79207_212264355RepeatNote=22
HgeneEWSR1chr22:29683123chr12:51208063ENST00000333395+79213_218264355RepeatNote=23
HgeneEWSR1chr22:29683123chr12:51208063ENST00000333395+79219_224264355RepeatNote=24
HgeneEWSR1chr22:29683123chr12:51208063ENST00000333395+79225_230264355RepeatNote=25
HgeneEWSR1chr22:29683123chr12:51208063ENST00000333395+79231_238264355RepeatNote=26
HgeneEWSR1chr22:29683123chr12:51208063ENST00000333395+79239_245264355RepeatNote=27
HgeneEWSR1chr22:29683123chr12:51208063ENST00000333395+79246_252264355RepeatNote=28
HgeneEWSR1chr22:29683123chr12:51208063ENST00000333395+79253_259264355RepeatNote=29
HgeneEWSR1chr22:29683123chr12:51208063ENST00000333395+7928_34264355RepeatNote=3
HgeneEWSR1chr22:29683123chr12:51208063ENST00000333395+7935_42264355RepeatNote=4
HgeneEWSR1chr22:29683123chr12:51208063ENST00000333395+7943_50264355RepeatNote=5
HgeneEWSR1chr22:29683123chr12:51208063ENST00000333395+7951_59264355RepeatNote=6
HgeneEWSR1chr22:29683123chr12:51208063ENST00000333395+7960_68264355RepeatNote=7
HgeneEWSR1chr22:29683123chr12:51208063ENST00000333395+7969_75264355RepeatNote=8
HgeneEWSR1chr22:29683123chr12:51208063ENST00000333395+7976_84264355RepeatNote=9
HgeneEWSR1chr22:29683123chr12:51208063ENST00000333395+7985_91264355RepeatNote=10
HgeneEWSR1chr22:29683123chr12:51208063ENST00000333395+798_16264355RepeatNote=1
HgeneEWSR1chr22:29683123chr12:51208063ENST00000333395+7992_110264355RepeatNote=11
HgeneEWSR1chr22:29683123chr12:51208063ENST00000397938+717111_116264657RepeatNote=12
HgeneEWSR1chr22:29683123chr12:51208063ENST00000397938+717117_125264657RepeatNote=13
HgeneEWSR1chr22:29683123chr12:51208063ENST00000397938+717126_156264657RepeatNote=14
HgeneEWSR1chr22:29683123chr12:51208063ENST00000397938+717157_163264657RepeatNote=15
HgeneEWSR1chr22:29683123chr12:51208063ENST00000397938+717164_170264657RepeatNote=16
HgeneEWSR1chr22:29683123chr12:51208063ENST00000397938+717171_177264657RepeatNote=17
HgeneEWSR1chr22:29683123chr12:51208063ENST00000397938+717178_188264657RepeatNote=18
HgeneEWSR1chr22:29683123chr12:51208063ENST00000397938+71717_27264657RepeatNote=2
HgeneEWSR1chr22:29683123chr12:51208063ENST00000397938+717189_193264657RepeatNote=19
HgeneEWSR1chr22:29683123chr12:51208063ENST00000397938+717194_201264657RepeatNote=20
HgeneEWSR1chr22:29683123chr12:51208063ENST00000397938+717202_206264657RepeatNote=21
HgeneEWSR1chr22:29683123chr12:51208063ENST00000397938+717207_212264657RepeatNote=22
HgeneEWSR1chr22:29683123chr12:51208063ENST00000397938+717213_218264657RepeatNote=23
HgeneEWSR1chr22:29683123chr12:51208063ENST00000397938+717219_224264657RepeatNote=24
HgeneEWSR1chr22:29683123chr12:51208063ENST00000397938+717225_230264657RepeatNote=25
HgeneEWSR1chr22:29683123chr12:51208063ENST00000397938+717231_238264657RepeatNote=26
HgeneEWSR1chr22:29683123chr12:51208063ENST00000397938+717239_245264657RepeatNote=27
HgeneEWSR1chr22:29683123chr12:51208063ENST00000397938+717246_252264657RepeatNote=28
HgeneEWSR1chr22:29683123chr12:51208063ENST00000397938+717253_259264657RepeatNote=29
HgeneEWSR1chr22:29683123chr12:51208063ENST00000397938+71728_34264657RepeatNote=3
HgeneEWSR1chr22:29683123chr12:51208063ENST00000397938+71735_42264657RepeatNote=4
HgeneEWSR1chr22:29683123chr12:51208063ENST00000397938+71743_50264657RepeatNote=5
HgeneEWSR1chr22:29683123chr12:51208063ENST00000397938+71751_59264657RepeatNote=6
HgeneEWSR1chr22:29683123chr12:51208063ENST00000397938+71760_68264657RepeatNote=7
HgeneEWSR1chr22:29683123chr12:51208063ENST00000397938+71769_75264657RepeatNote=8
HgeneEWSR1chr22:29683123chr12:51208063ENST00000397938+71776_84264657RepeatNote=9
HgeneEWSR1chr22:29683123chr12:51208063ENST00000397938+71785_91264657RepeatNote=10
HgeneEWSR1chr22:29683123chr12:51208063ENST00000397938+7178_16264657RepeatNote=1
HgeneEWSR1chr22:29683123chr12:51208063ENST00000397938+71792_110264657RepeatNote=11
HgeneEWSR1chr22:29683123chr12:51208063ENST00000406548+717111_116264656RepeatNote=12
HgeneEWSR1chr22:29683123chr12:51208063ENST00000406548+717117_125264656RepeatNote=13
HgeneEWSR1chr22:29683123chr12:51208063ENST00000406548+717126_156264656RepeatNote=14
HgeneEWSR1chr22:29683123chr12:51208063ENST00000406548+717157_163264656RepeatNote=15
HgeneEWSR1chr22:29683123chr12:51208063ENST00000406548+717164_170264656RepeatNote=16
HgeneEWSR1chr22:29683123chr12:51208063ENST00000406548+717171_177264656RepeatNote=17
HgeneEWSR1chr22:29683123chr12:51208063ENST00000406548+717178_188264656RepeatNote=18
HgeneEWSR1chr22:29683123chr12:51208063ENST00000406548+71717_27264656RepeatNote=2
HgeneEWSR1chr22:29683123chr12:51208063ENST00000406548+717189_193264656RepeatNote=19
HgeneEWSR1chr22:29683123chr12:51208063ENST00000406548+717194_201264656RepeatNote=20
HgeneEWSR1chr22:29683123chr12:51208063ENST00000406548+717202_206264656RepeatNote=21
HgeneEWSR1chr22:29683123chr12:51208063ENST00000406548+717207_212264656RepeatNote=22
HgeneEWSR1chr22:29683123chr12:51208063ENST00000406548+717213_218264656RepeatNote=23
HgeneEWSR1chr22:29683123chr12:51208063ENST00000406548+717219_224264656RepeatNote=24
HgeneEWSR1chr22:29683123chr12:51208063ENST00000406548+717225_230264656RepeatNote=25
HgeneEWSR1chr22:29683123chr12:51208063ENST00000406548+717231_238264656RepeatNote=26
HgeneEWSR1chr22:29683123chr12:51208063ENST00000406548+717239_245264656RepeatNote=27
HgeneEWSR1chr22:29683123chr12:51208063ENST00000406548+717246_252264656RepeatNote=28
HgeneEWSR1chr22:29683123chr12:51208063ENST00000406548+717253_259264656RepeatNote=29
HgeneEWSR1chr22:29683123chr12:51208063ENST00000406548+71728_34264656RepeatNote=3
HgeneEWSR1chr22:29683123chr12:51208063ENST00000406548+71735_42264656RepeatNote=4
HgeneEWSR1chr22:29683123chr12:51208063ENST00000406548+71743_50264656RepeatNote=5
HgeneEWSR1chr22:29683123chr12:51208063ENST00000406548+71751_59264656RepeatNote=6
HgeneEWSR1chr22:29683123chr12:51208063ENST00000406548+71760_68264656RepeatNote=7
HgeneEWSR1chr22:29683123chr12:51208063ENST00000406548+71769_75264656RepeatNote=8
HgeneEWSR1chr22:29683123chr12:51208063ENST00000406548+71776_84264656RepeatNote=9
HgeneEWSR1chr22:29683123chr12:51208063ENST00000406548+71785_91264656RepeatNote=10
HgeneEWSR1chr22:29683123chr12:51208063ENST00000406548+7178_16264656RepeatNote=1
HgeneEWSR1chr22:29683123chr12:51208063ENST00000406548+71792_110264656RepeatNote=11
HgeneEWSR1chr22:29683123chr12:51208063ENST00000414183+818111_116270662RepeatNote=12
HgeneEWSR1chr22:29683123chr12:51208063ENST00000414183+818117_125270662RepeatNote=13
HgeneEWSR1chr22:29683123chr12:51208063ENST00000414183+818126_156270662RepeatNote=14
HgeneEWSR1chr22:29683123chr12:51208063ENST00000414183+818157_163270662RepeatNote=15
HgeneEWSR1chr22:29683123chr12:51208063ENST00000414183+818164_170270662RepeatNote=16
HgeneEWSR1chr22:29683123chr12:51208063ENST00000414183+818171_177270662RepeatNote=17
HgeneEWSR1chr22:29683123chr12:51208063ENST00000414183+818178_188270662RepeatNote=18
HgeneEWSR1chr22:29683123chr12:51208063ENST00000414183+81817_27270662RepeatNote=2
HgeneEWSR1chr22:29683123chr12:51208063ENST00000414183+818189_193270662RepeatNote=19
HgeneEWSR1chr22:29683123chr12:51208063ENST00000414183+818194_201270662RepeatNote=20
HgeneEWSR1chr22:29683123chr12:51208063ENST00000414183+818202_206270662RepeatNote=21
HgeneEWSR1chr22:29683123chr12:51208063ENST00000414183+818207_212270662RepeatNote=22
HgeneEWSR1chr22:29683123chr12:51208063ENST00000414183+818213_218270662RepeatNote=23
HgeneEWSR1chr22:29683123chr12:51208063ENST00000414183+818219_224270662RepeatNote=24
HgeneEWSR1chr22:29683123chr12:51208063ENST00000414183+818225_230270662RepeatNote=25
HgeneEWSR1chr22:29683123chr12:51208063ENST00000414183+818231_238270662RepeatNote=26
HgeneEWSR1chr22:29683123chr12:51208063ENST00000414183+818239_245270662RepeatNote=27
HgeneEWSR1chr22:29683123chr12:51208063ENST00000414183+818246_252270662RepeatNote=28
HgeneEWSR1chr22:29683123chr12:51208063ENST00000414183+818253_259270662RepeatNote=29
HgeneEWSR1chr22:29683123chr12:51208063ENST00000414183+81828_34270662RepeatNote=3
HgeneEWSR1chr22:29683123chr12:51208063ENST00000414183+81835_42270662RepeatNote=4
HgeneEWSR1chr22:29683123chr12:51208063ENST00000414183+81843_50270662RepeatNote=5
HgeneEWSR1chr22:29683123chr12:51208063ENST00000414183+81851_59270662RepeatNote=6
HgeneEWSR1chr22:29683123chr12:51208063ENST00000414183+81860_68270662RepeatNote=7
HgeneEWSR1chr22:29683123chr12:51208063ENST00000414183+81869_75270662RepeatNote=8
HgeneEWSR1chr22:29683123chr12:51208063ENST00000414183+81876_84270662RepeatNote=9
HgeneEWSR1chr22:29683123chr12:51208063ENST00000414183+81885_91270662RepeatNote=10
HgeneEWSR1chr22:29683123chr12:51208063ENST00000414183+8188_16270662RepeatNote=1
HgeneEWSR1chr22:29683123chr12:51208063ENST00000414183+81892_110270662RepeatNote=11
TgeneATF1chr22:29683123chr12:51207793ENST00000262053+37213_271109272DomainbZIP
TgeneATF1chr22:29683123chr12:51208063ENST00000262053+47213_271170272DomainbZIP
TgeneATF1chr22:29683123chr12:51207793ENST00000262053+37215_239109272RegionBasic motif
TgeneATF1chr22:29683123chr12:51207793ENST00000262053+37241_262109272RegionLeucine-zipper
TgeneATF1chr22:29683123chr12:51208063ENST00000262053+47215_239170272RegionBasic motif
TgeneATF1chr22:29683123chr12:51208063ENST00000262053+47241_262170272RegionLeucine-zipper

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneEWSR1chr22:29683123chr12:51207793ENST00000332035+616300_340208601Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29683123chr12:51207793ENST00000332035+616454_513208601Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29683123chr12:51207793ENST00000332035+616559_640208601Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29683123chr12:51207793ENST00000333395+79300_340264355Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29683123chr12:51207793ENST00000333395+79454_513264355Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29683123chr12:51207793ENST00000333395+79559_640264355Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29683123chr12:51207793ENST00000397938+717300_340264657Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29683123chr12:51207793ENST00000397938+717454_513264657Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29683123chr12:51207793ENST00000397938+717559_640264657Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29683123chr12:51207793ENST00000406548+717300_340264656Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29683123chr12:51207793ENST00000406548+717454_513264656Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29683123chr12:51207793ENST00000406548+717559_640264656Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29683123chr12:51207793ENST00000414183+818300_340270662Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29683123chr12:51207793ENST00000414183+818454_513270662Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29683123chr12:51207793ENST00000414183+818559_640270662Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29683123chr12:51208063ENST00000332035+616300_340208601Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29683123chr12:51208063ENST00000332035+616454_513208601Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29683123chr12:51208063ENST00000332035+616559_640208601Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29683123chr12:51208063ENST00000333395+79300_340264355Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29683123chr12:51208063ENST00000333395+79454_513264355Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29683123chr12:51208063ENST00000333395+79559_640264355Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29683123chr12:51208063ENST00000397938+717300_340264657Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29683123chr12:51208063ENST00000397938+717454_513264657Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29683123chr12:51208063ENST00000397938+717559_640264657Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29683123chr12:51208063ENST00000406548+717300_340264656Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29683123chr12:51208063ENST00000406548+717454_513264656Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29683123chr12:51208063ENST00000406548+717559_640264656Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29683123chr12:51208063ENST00000414183+818300_340270662Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29683123chr12:51208063ENST00000414183+818454_513270662Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29683123chr12:51208063ENST00000414183+818559_640270662Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29683123chr12:51207793ENST00000332035+616256_285208601DomainNote=IQ
HgeneEWSR1chr22:29683123chr12:51207793ENST00000332035+616361_447208601DomainRRM
HgeneEWSR1chr22:29683123chr12:51207793ENST00000333395+79256_285264355DomainNote=IQ
HgeneEWSR1chr22:29683123chr12:51207793ENST00000333395+79361_447264355DomainRRM
HgeneEWSR1chr22:29683123chr12:51207793ENST00000397938+717256_285264657DomainNote=IQ
HgeneEWSR1chr22:29683123chr12:51207793ENST00000397938+717361_447264657DomainRRM
HgeneEWSR1chr22:29683123chr12:51207793ENST00000406548+717256_285264656DomainNote=IQ
HgeneEWSR1chr22:29683123chr12:51207793ENST00000406548+717361_447264656DomainRRM
HgeneEWSR1chr22:29683123chr12:51207793ENST00000414183+818256_285270662DomainNote=IQ
HgeneEWSR1chr22:29683123chr12:51207793ENST00000414183+818361_447270662DomainRRM
HgeneEWSR1chr22:29683123chr12:51208063ENST00000332035+616256_285208601DomainNote=IQ
HgeneEWSR1chr22:29683123chr12:51208063ENST00000332035+616361_447208601DomainRRM
HgeneEWSR1chr22:29683123chr12:51208063ENST00000333395+79256_285264355DomainNote=IQ
HgeneEWSR1chr22:29683123chr12:51208063ENST00000333395+79361_447264355DomainRRM
HgeneEWSR1chr22:29683123chr12:51208063ENST00000397938+717256_285264657DomainNote=IQ
HgeneEWSR1chr22:29683123chr12:51208063ENST00000397938+717361_447264657DomainRRM
HgeneEWSR1chr22:29683123chr12:51208063ENST00000406548+717256_285264656DomainNote=IQ
HgeneEWSR1chr22:29683123chr12:51208063ENST00000406548+717361_447264656DomainRRM
HgeneEWSR1chr22:29683123chr12:51208063ENST00000414183+818256_285270662DomainNote=IQ
HgeneEWSR1chr22:29683123chr12:51208063ENST00000414183+818361_447270662DomainRRM
HgeneEWSR1chr22:29683123chr12:51207793ENST00000332035+616639_656208601MotifNuclear localization signal
HgeneEWSR1chr22:29683123chr12:51207793ENST00000333395+79639_656264355MotifNuclear localization signal
HgeneEWSR1chr22:29683123chr12:51207793ENST00000397938+717639_656264657MotifNuclear localization signal
HgeneEWSR1chr22:29683123chr12:51207793ENST00000406548+717639_656264656MotifNuclear localization signal
HgeneEWSR1chr22:29683123chr12:51207793ENST00000414183+818639_656270662MotifNuclear localization signal
HgeneEWSR1chr22:29683123chr12:51208063ENST00000332035+616639_656208601MotifNuclear localization signal
HgeneEWSR1chr22:29683123chr12:51208063ENST00000333395+79639_656264355MotifNuclear localization signal
HgeneEWSR1chr22:29683123chr12:51208063ENST00000397938+717639_656264657MotifNuclear localization signal
HgeneEWSR1chr22:29683123chr12:51208063ENST00000406548+717639_656264656MotifNuclear localization signal
HgeneEWSR1chr22:29683123chr12:51208063ENST00000414183+818639_656270662MotifNuclear localization signal
HgeneEWSR1chr22:29683123chr12:51207793ENST00000332035+6161_285208601RegionNote=EAD (Gln/Pro/Thr-rich)
HgeneEWSR1chr22:29683123chr12:51207793ENST00000332035+6168_285208601RegionNote=31 X approximate tandem repeats
HgeneEWSR1chr22:29683123chr12:51207793ENST00000333395+791_285264355RegionNote=EAD (Gln/Pro/Thr-rich)
HgeneEWSR1chr22:29683123chr12:51207793ENST00000333395+798_285264355RegionNote=31 X approximate tandem repeats
HgeneEWSR1chr22:29683123chr12:51207793ENST00000397938+7171_285264657RegionNote=EAD (Gln/Pro/Thr-rich)
HgeneEWSR1chr22:29683123chr12:51207793ENST00000397938+7178_285264657RegionNote=31 X approximate tandem repeats
HgeneEWSR1chr22:29683123chr12:51207793ENST00000406548+7171_285264656RegionNote=EAD (Gln/Pro/Thr-rich)
HgeneEWSR1chr22:29683123chr12:51207793ENST00000406548+7178_285264656RegionNote=31 X approximate tandem repeats
HgeneEWSR1chr22:29683123chr12:51207793ENST00000414183+8181_285270662RegionNote=EAD (Gln/Pro/Thr-rich)
HgeneEWSR1chr22:29683123chr12:51207793ENST00000414183+8188_285270662RegionNote=31 X approximate tandem repeats
HgeneEWSR1chr22:29683123chr12:51208063ENST00000332035+6161_285208601RegionNote=EAD (Gln/Pro/Thr-rich)
HgeneEWSR1chr22:29683123chr12:51208063ENST00000332035+6168_285208601RegionNote=31 X approximate tandem repeats
HgeneEWSR1chr22:29683123chr12:51208063ENST00000333395+791_285264355RegionNote=EAD (Gln/Pro/Thr-rich)
HgeneEWSR1chr22:29683123chr12:51208063ENST00000333395+798_285264355RegionNote=31 X approximate tandem repeats
HgeneEWSR1chr22:29683123chr12:51208063ENST00000397938+7171_285264657RegionNote=EAD (Gln/Pro/Thr-rich)
HgeneEWSR1chr22:29683123chr12:51208063ENST00000397938+7178_285264657RegionNote=31 X approximate tandem repeats
HgeneEWSR1chr22:29683123chr12:51208063ENST00000406548+7171_285264656RegionNote=EAD (Gln/Pro/Thr-rich)
HgeneEWSR1chr22:29683123chr12:51208063ENST00000406548+7178_285264656RegionNote=31 X approximate tandem repeats
HgeneEWSR1chr22:29683123chr12:51208063ENST00000414183+8181_285270662RegionNote=EAD (Gln/Pro/Thr-rich)
HgeneEWSR1chr22:29683123chr12:51208063ENST00000414183+8188_285270662RegionNote=31 X approximate tandem repeats
HgeneEWSR1chr22:29683123chr12:51207793ENST00000332035+616207_212208601RepeatNote=22
HgeneEWSR1chr22:29683123chr12:51207793ENST00000332035+616213_218208601RepeatNote=23
HgeneEWSR1chr22:29683123chr12:51207793ENST00000332035+616219_224208601RepeatNote=24
HgeneEWSR1chr22:29683123chr12:51207793ENST00000332035+616225_230208601RepeatNote=25
HgeneEWSR1chr22:29683123chr12:51207793ENST00000332035+616231_238208601RepeatNote=26
HgeneEWSR1chr22:29683123chr12:51207793ENST00000332035+616239_245208601RepeatNote=27
HgeneEWSR1chr22:29683123chr12:51207793ENST00000332035+616246_252208601RepeatNote=28
HgeneEWSR1chr22:29683123chr12:51207793ENST00000332035+616253_259208601RepeatNote=29
HgeneEWSR1chr22:29683123chr12:51207793ENST00000332035+616260_276208601RepeatNote=30
HgeneEWSR1chr22:29683123chr12:51207793ENST00000332035+616277_285208601RepeatNote=31
HgeneEWSR1chr22:29683123chr12:51207793ENST00000333395+79260_276264355RepeatNote=30
HgeneEWSR1chr22:29683123chr12:51207793ENST00000333395+79277_285264355RepeatNote=31
HgeneEWSR1chr22:29683123chr12:51207793ENST00000397938+717260_276264657RepeatNote=30
HgeneEWSR1chr22:29683123chr12:51207793ENST00000397938+717277_285264657RepeatNote=31
HgeneEWSR1chr22:29683123chr12:51207793ENST00000406548+717260_276264656RepeatNote=30
HgeneEWSR1chr22:29683123chr12:51207793ENST00000406548+717277_285264656RepeatNote=31
HgeneEWSR1chr22:29683123chr12:51207793ENST00000414183+818260_276270662RepeatNote=30
HgeneEWSR1chr22:29683123chr12:51207793ENST00000414183+818277_285270662RepeatNote=31
HgeneEWSR1chr22:29683123chr12:51208063ENST00000332035+616207_212208601RepeatNote=22
HgeneEWSR1chr22:29683123chr12:51208063ENST00000332035+616213_218208601RepeatNote=23
HgeneEWSR1chr22:29683123chr12:51208063ENST00000332035+616219_224208601RepeatNote=24
HgeneEWSR1chr22:29683123chr12:51208063ENST00000332035+616225_230208601RepeatNote=25
HgeneEWSR1chr22:29683123chr12:51208063ENST00000332035+616231_238208601RepeatNote=26
HgeneEWSR1chr22:29683123chr12:51208063ENST00000332035+616239_245208601RepeatNote=27
HgeneEWSR1chr22:29683123chr12:51208063ENST00000332035+616246_252208601RepeatNote=28
HgeneEWSR1chr22:29683123chr12:51208063ENST00000332035+616253_259208601RepeatNote=29
HgeneEWSR1chr22:29683123chr12:51208063ENST00000332035+616260_276208601RepeatNote=30
HgeneEWSR1chr22:29683123chr12:51208063ENST00000332035+616277_285208601RepeatNote=31
HgeneEWSR1chr22:29683123chr12:51208063ENST00000333395+79260_276264355RepeatNote=30
HgeneEWSR1chr22:29683123chr12:51208063ENST00000333395+79277_285264355RepeatNote=31
HgeneEWSR1chr22:29683123chr12:51208063ENST00000397938+717260_276264657RepeatNote=30
HgeneEWSR1chr22:29683123chr12:51208063ENST00000397938+717277_285264657RepeatNote=31
HgeneEWSR1chr22:29683123chr12:51208063ENST00000406548+717260_276264656RepeatNote=30
HgeneEWSR1chr22:29683123chr12:51208063ENST00000406548+717277_285264656RepeatNote=31
HgeneEWSR1chr22:29683123chr12:51208063ENST00000414183+818260_276270662RepeatNote=30
HgeneEWSR1chr22:29683123chr12:51208063ENST00000414183+818277_285270662RepeatNote=31
HgeneEWSR1chr22:29683123chr12:51207793ENST00000332035+616518_549208601Zinc fingerRanBP2-type
HgeneEWSR1chr22:29683123chr12:51207793ENST00000333395+79518_549264355Zinc fingerRanBP2-type
HgeneEWSR1chr22:29683123chr12:51207793ENST00000397938+717518_549264657Zinc fingerRanBP2-type
HgeneEWSR1chr22:29683123chr12:51207793ENST00000406548+717518_549264656Zinc fingerRanBP2-type
HgeneEWSR1chr22:29683123chr12:51207793ENST00000414183+818518_549270662Zinc fingerRanBP2-type
HgeneEWSR1chr22:29683123chr12:51208063ENST00000332035+616518_549208601Zinc fingerRanBP2-type
HgeneEWSR1chr22:29683123chr12:51208063ENST00000333395+79518_549264355Zinc fingerRanBP2-type
HgeneEWSR1chr22:29683123chr12:51208063ENST00000397938+717518_549264657Zinc fingerRanBP2-type
HgeneEWSR1chr22:29683123chr12:51208063ENST00000406548+717518_549264656Zinc fingerRanBP2-type
HgeneEWSR1chr22:29683123chr12:51208063ENST00000414183+818518_549270662Zinc fingerRanBP2-type
TgeneATF1chr22:29683123chr12:51207793ENST00000262053+3731_90109272DomainKID
TgeneATF1chr22:29683123chr12:51208063ENST00000262053+4731_90170272DomainKID


Top

FusionGeneSequence for EWSR1_ATF1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_EWSR1_ENST00000332050_chr22_29683123_+_ATF1_ENST00000262053_chr12_51207793_+_427aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQIAIAPN
GALQLASPGTDGVQGLQTLTMTNSGSTQQGTTILQTAQTSDGQQILVPSNQVVVQTASGDMQTTQIRTTPSATSLPQTVVMTSPVTLTSQ

>In-frame_EWSR1_ENST00000397938_chr22_29683123_+_ATF1_ENST00000262053_chr12_51207793_+_427aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQIAIAPN
GALQLASPGTDGVQGLQTLTMTNSGSTQQGTTILQTAQTSDGQQILVPSNQVVVQTASGDMQTTQIRTTPSATSLPQTVVMTSPVTLTSQ

>In-frame_EWSR1_ENST00000406548_chr22_29683123_+_ATF1_ENST00000262053_chr12_51207793_+_427aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQIAIAPN
GALQLASPGTDGVQGLQTLTMTNSGSTQQGTTILQTAQTSDGQQILVPSNQVVVQTASGDMQTTQIRTTPSATSLPQTVVMTSPVTLTSQ

>In-frame_EWSR1_ENST00000331029_chr22_29683123_+_ATF1_ENST00000262053_chr12_51207793_+_427aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQIAIAPN
GALQLASPGTDGVQGLQTLTMTNSGSTQQGTTILQTAQTSDGQQILVPSNQVVVQTASGDMQTTQIRTTPSATSLPQTVVMTSPVTLTSQ

>In-frame_EWSR1_ENST00000414183_chr22_29683123_+_ATF1_ENST00000262053_chr12_51207793_+_433aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTVEGTSTGTTTPTAPQ
AYSQPVQGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQ
VPGSYPMQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQ
IAIAPNGALQLASPGTDGVQGLQTLTMTNSGSTQQGTTILQTAQTSDGQQILVPSNQVVVQTASGDMQTTQIRTTPSATSLPQTVVMTSP

>In-frame_EWSR1_ENST00000333395_chr22_29683123_+_ATF1_ENST00000262053_chr12_51207793_+_427aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQIAIAPN
GALQLASPGTDGVQGLQTLTMTNSGSTQQGTTILQTAQTSDGQQILVPSNQVVVQTASGDMQTTQIRTTPSATSLPQTVVMTSPVTLTSQ

>In-frame_EWSR1_ENST00000332035_chr22_29683123_+_ATF1_ENST00000262053_chr12_51207793_+_371aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQP
PTSYPPQTGSYSQAPSQTSQQSSSYGQQIAIAPNGALQLASPGTDGVQGLQTLTMTNSGSTQQGTTILQTAQTSDGQQILVPSNQVVVQT
ASGDMQTTQIRTTPSATSLPQTVVMTSPVTLTSQTTKTDDPQLKREIRLMKNREAARECRRKKKETVKCLENRVAVLENQNKTLIEELKT

>In-frame_EWSR1_ENST00000332050_chr22_29683123_+_ATF1_ENST00000262053_chr12_51207793_+_427aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQIAIAPN
GALQLASPGTDGVQGLQTLTMTNSGSTQQGTTILQTAQTSDGQQILVPSNQVVVQTASGDMQTTQIRTTPSATSLPQTVVMTSPVTLTSQ

>In-frame_EWSR1_ENST00000397938_chr22_29683123_+_ATF1_ENST00000262053_chr12_51207793_+_427aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQIAIAPN
GALQLASPGTDGVQGLQTLTMTNSGSTQQGTTILQTAQTSDGQQILVPSNQVVVQTASGDMQTTQIRTTPSATSLPQTVVMTSPVTLTSQ

>In-frame_EWSR1_ENST00000406548_chr22_29683123_+_ATF1_ENST00000262053_chr12_51207793_+_427aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQIAIAPN
GALQLASPGTDGVQGLQTLTMTNSGSTQQGTTILQTAQTSDGQQILVPSNQVVVQTASGDMQTTQIRTTPSATSLPQTVVMTSPVTLTSQ

>In-frame_EWSR1_ENST00000331029_chr22_29683123_+_ATF1_ENST00000262053_chr12_51207793_+_427aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQIAIAPN
GALQLASPGTDGVQGLQTLTMTNSGSTQQGTTILQTAQTSDGQQILVPSNQVVVQTASGDMQTTQIRTTPSATSLPQTVVMTSPVTLTSQ

>In-frame_EWSR1_ENST00000414183_chr22_29683123_+_ATF1_ENST00000262053_chr12_51207793_+_433aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTVEGTSTGTTTPTAPQ
AYSQPVQGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQ
VPGSYPMQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQ
IAIAPNGALQLASPGTDGVQGLQTLTMTNSGSTQQGTTILQTAQTSDGQQILVPSNQVVVQTASGDMQTTQIRTTPSATSLPQTVVMTSP

>In-frame_EWSR1_ENST00000333395_chr22_29683123_+_ATF1_ENST00000262053_chr12_51207793_+_427aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQIAIAPN
GALQLASPGTDGVQGLQTLTMTNSGSTQQGTTILQTAQTSDGQQILVPSNQVVVQTASGDMQTTQIRTTPSATSLPQTVVMTSPVTLTSQ

>In-frame_EWSR1_ENST00000332035_chr22_29683123_+_ATF1_ENST00000262053_chr12_51207793_+_371aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQP
PTSYPPQTGSYSQAPSQTSQQSSSYGQQIAIAPNGALQLASPGTDGVQGLQTLTMTNSGSTQQGTTILQTAQTSDGQQILVPSNQVVVQT
ASGDMQTTQIRTTPSATSLPQTVVMTSPVTLTSQTTKTDDPQLKREIRLMKNREAARECRRKKKETVKCLENRVAVLENQNKTLIEELKT

>In-frame_EWSR1_ENST00000332050_chr22_29683123_+_ATF1_ENST00000262053_chr12_51208063_+_366aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQTASGDM
QTTQIRTTPSATSLPQTVVMTSPVTLTSQTTKTDDPQLKREIRLMKNREAARECRRKKKETVKCLENRVAVLENQNKTLIEELKTLKDLT

>In-frame_EWSR1_ENST00000332050_chr22_29683123_+_ATF1_ENST00000539132_chr12_51208063_+_366aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQTASGDM
QTTQIRTTPSATSLPQTVVMTSPVTLTSQTTKTDDPQLKREIRLMKNREAARECRRKKKETVKCLENRVAVLENQNKTLIEELKTLKDLT

>In-frame_EWSR1_ENST00000397938_chr22_29683123_+_ATF1_ENST00000262053_chr12_51208063_+_366aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQTASGDM
QTTQIRTTPSATSLPQTVVMTSPVTLTSQTTKTDDPQLKREIRLMKNREAARECRRKKKETVKCLENRVAVLENQNKTLIEELKTLKDLT

>In-frame_EWSR1_ENST00000397938_chr22_29683123_+_ATF1_ENST00000539132_chr12_51208063_+_366aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQTASGDM
QTTQIRTTPSATSLPQTVVMTSPVTLTSQTTKTDDPQLKREIRLMKNREAARECRRKKKETVKCLENRVAVLENQNKTLIEELKTLKDLT

>In-frame_EWSR1_ENST00000406548_chr22_29683123_+_ATF1_ENST00000262053_chr12_51208063_+_366aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQTASGDM
QTTQIRTTPSATSLPQTVVMTSPVTLTSQTTKTDDPQLKREIRLMKNREAARECRRKKKETVKCLENRVAVLENQNKTLIEELKTLKDLT

>In-frame_EWSR1_ENST00000406548_chr22_29683123_+_ATF1_ENST00000539132_chr12_51208063_+_366aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQTASGDM
QTTQIRTTPSATSLPQTVVMTSPVTLTSQTTKTDDPQLKREIRLMKNREAARECRRKKKETVKCLENRVAVLENQNKTLIEELKTLKDLT

>In-frame_EWSR1_ENST00000331029_chr22_29683123_+_ATF1_ENST00000262053_chr12_51208063_+_366aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQTASGDM
QTTQIRTTPSATSLPQTVVMTSPVTLTSQTTKTDDPQLKREIRLMKNREAARECRRKKKETVKCLENRVAVLENQNKTLIEELKTLKDLT

>In-frame_EWSR1_ENST00000331029_chr22_29683123_+_ATF1_ENST00000539132_chr12_51208063_+_366aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQTASGDM
QTTQIRTTPSATSLPQTVVMTSPVTLTSQTTKTDDPQLKREIRLMKNREAARECRRKKKETVKCLENRVAVLENQNKTLIEELKTLKDLT

>In-frame_EWSR1_ENST00000414183_chr22_29683123_+_ATF1_ENST00000262053_chr12_51208063_+_372aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTVEGTSTGTTTPTAPQ
AYSQPVQGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQ
VPGSYPMQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQ
TASGDMQTTQIRTTPSATSLPQTVVMTSPVTLTSQTTKTDDPQLKREIRLMKNREAARECRRKKKETVKCLENRVAVLENQNKTLIEELK

>In-frame_EWSR1_ENST00000414183_chr22_29683123_+_ATF1_ENST00000539132_chr12_51208063_+_372aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTVEGTSTGTTTPTAPQ
AYSQPVQGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQ
VPGSYPMQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQ
TASGDMQTTQIRTTPSATSLPQTVVMTSPVTLTSQTTKTDDPQLKREIRLMKNREAARECRRKKKETVKCLENRVAVLENQNKTLIEELK

>In-frame_EWSR1_ENST00000333395_chr22_29683123_+_ATF1_ENST00000262053_chr12_51208063_+_366aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQTASGDM
QTTQIRTTPSATSLPQTVVMTSPVTLTSQTTKTDDPQLKREIRLMKNREAARECRRKKKETVKCLENRVAVLENQNKTLIEELKTLKDLT

>In-frame_EWSR1_ENST00000333395_chr22_29683123_+_ATF1_ENST00000539132_chr12_51208063_+_366aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTRPQDGNKPTETSQPQSSTGGYNQPSLGTGQSNYSTPQVPGSYP
MQPVTAPPSYPPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQPPTSYPPQTGSYSQAPSQTSQQSSSYGQQTASGDM
QTTQIRTTPSATSLPQTVVMTSPVTLTSQTTKTDDPQLKREIRLMKNREAARECRRKKKETVKCLENRVAVLENQNKTLIEELKTLKDLT

>In-frame_EWSR1_ENST00000332035_chr22_29683123_+_ATF1_ENST00000262053_chr12_51208063_+_310aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQP
PTSYPPQTGSYSQAPSQTSQQSSSYGQQTASGDMQTTQIRTTPSATSLPQTVVMTSPVTLTSQTTKTDDPQLKREIRLMKNREAARECRR

>In-frame_EWSR1_ENST00000332035_chr22_29683123_+_ATF1_ENST00000539132_chr12_51208063_+_310aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTGTTTPTAPQAYSQPV
QGTGTGATDTTTATVTTTQASTAAQSATGTQPATPATGQQPAATAPTSTSSTQPTSTDQSSYSQQNTTGQPSSTGQQSSTGQQSSTGQQP
PTSYPPQTGSYSQAPSQTSQQSSSYGQQTASGDMQTTQIRTTPSATSLPQTVVMTSPVTLTSQTTKTDDPQLKREIRLMKNREAARECRR


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_EWSR1_ENST00000332050_chr22_29683123_+_ATF1_ENST00000262053_chr12_51207793_+_1281nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGATTGCCATTGCCCCAAAT
GGAGCCTTACAGTTGGCAAGTCCAGGCACAGATGGAGTACAGGGACTTCAGACATTAACCATGACAAATTCAGGCAGTACTCAGCAAGGT
ACAACTATTCTTCAGTATGCACAGACCTCTGATGGACAGCAGATACTTGTGCCCAGCAATCAGGTGGTCGTACAAACTGCATCAGGAGAT
ATGCAAACATATCAGATCCGAACTACACCTTCAGCTACTTCTCTGCCACAAACTGTGGTGATGACATCTCCTGTGACTCTCACCTCTCAG
ACAACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAGGTTAATGAAAAACAGAGAAGCTGCTCGAGAATGTCGCAGAAAGAAGAAA
GAATATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAATCAAAATAAAACTCTAATAGAAGAGTTAAAAACTTTGAAGGATCTT

>In-frame_EWSR1_ENST00000397938_chr22_29683123_+_ATF1_ENST00000262053_chr12_51207793_+_1281nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGATTGCCATTGCCCCAAAT
GGAGCCTTACAGTTGGCAAGTCCAGGCACAGATGGAGTACAGGGACTTCAGACATTAACCATGACAAATTCAGGCAGTACTCAGCAAGGT
ACAACTATTCTTCAGTATGCACAGACCTCTGATGGACAGCAGATACTTGTGCCCAGCAATCAGGTGGTCGTACAAACTGCATCAGGAGAT
ATGCAAACATATCAGATCCGAACTACACCTTCAGCTACTTCTCTGCCACAAACTGTGGTGATGACATCTCCTGTGACTCTCACCTCTCAG
ACAACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAGGTTAATGAAAAACAGAGAAGCTGCTCGAGAATGTCGCAGAAAGAAGAAA
GAATATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAATCAAAATAAAACTCTAATAGAAGAGTTAAAAACTTTGAAGGATCTT

>In-frame_EWSR1_ENST00000406548_chr22_29683123_+_ATF1_ENST00000262053_chr12_51207793_+_1281nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGATTGCCATTGCCCCAAAT
GGAGCCTTACAGTTGGCAAGTCCAGGCACAGATGGAGTACAGGGACTTCAGACATTAACCATGACAAATTCAGGCAGTACTCAGCAAGGT
ACAACTATTCTTCAGTATGCACAGACCTCTGATGGACAGCAGATACTTGTGCCCAGCAATCAGGTGGTCGTACAAACTGCATCAGGAGAT
ATGCAAACATATCAGATCCGAACTACACCTTCAGCTACTTCTCTGCCACAAACTGTGGTGATGACATCTCCTGTGACTCTCACCTCTCAG
ACAACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAGGTTAATGAAAAACAGAGAAGCTGCTCGAGAATGTCGCAGAAAGAAGAAA
GAATATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAATCAAAATAAAACTCTAATAGAAGAGTTAAAAACTTTGAAGGATCTT

>In-frame_EWSR1_ENST00000331029_chr22_29683123_+_ATF1_ENST00000262053_chr12_51207793_+_1281nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGATTGCCATTGCCCCAAAT
GGAGCCTTACAGTTGGCAAGTCCAGGCACAGATGGAGTACAGGGACTTCAGACATTAACCATGACAAATTCAGGCAGTACTCAGCAAGGT
ACAACTATTCTTCAGTATGCACAGACCTCTGATGGACAGCAGATACTTGTGCCCAGCAATCAGGTGGTCGTACAAACTGCATCAGGAGAT
ATGCAAACATATCAGATCCGAACTACACCTTCAGCTACTTCTCTGCCACAAACTGTGGTGATGACATCTCCTGTGACTCTCACCTCTCAG
ACAACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAGGTTAATGAAAAACAGAGAAGCTGCTCGAGAATGTCGCAGAAAGAAGAAA
GAATATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAATCAAAATAAAACTCTAATAGAAGAGTTAAAAACTTTGAAGGATCTT

>In-frame_EWSR1_ENST00000414183_chr22_29683123_+_ATF1_ENST00000262053_chr12_51207793_+_1299nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGTAGAAGGGACCAGTACAGGTTATACTACTCCAACTGCCCCCCAG
GCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCT
CAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAG
CCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAG
GTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGAT
CAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAG
CAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAG
ATTGCCATTGCCCCAAATGGAGCCTTACAGTTGGCAAGTCCAGGCACAGATGGAGTACAGGGACTTCAGACATTAACCATGACAAATTCA
GGCAGTACTCAGCAAGGTACAACTATTCTTCAGTATGCACAGACCTCTGATGGACAGCAGATACTTGTGCCCAGCAATCAGGTGGTCGTA
CAAACTGCATCAGGAGATATGCAAACATATCAGATCCGAACTACACCTTCAGCTACTTCTCTGCCACAAACTGTGGTGATGACATCTCCT
GTGACTCTCACCTCTCAGACAACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAGGTTAATGAAAAACAGAGAAGCTGCTCGAGAA
TGTCGCAGAAAGAAGAAAGAATATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAATCAAAATAAAACTCTAATAGAAGAGTTA

>In-frame_EWSR1_ENST00000333395_chr22_29683123_+_ATF1_ENST00000262053_chr12_51207793_+_1281nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGATTGCCATTGCCCCAAAT
GGAGCCTTACAGTTGGCAAGTCCAGGCACAGATGGAGTACAGGGACTTCAGACATTAACCATGACAAATTCAGGCAGTACTCAGCAAGGT
ACAACTATTCTTCAGTATGCACAGACCTCTGATGGACAGCAGATACTTGTGCCCAGCAATCAGGTGGTCGTACAAACTGCATCAGGAGAT
ATGCAAACATATCAGATCCGAACTACACCTTCAGCTACTTCTCTGCCACAAACTGTGGTGATGACATCTCCTGTGACTCTCACCTCTCAG
ACAACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAGGTTAATGAAAAACAGAGAAGCTGCTCGAGAATGTCGCAGAAAGAAGAAA
GAATATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAATCAAAATAAAACTCTAATAGAAGAGTTAAAAACTTTGAAGGATCTT

>In-frame_EWSR1_ENST00000332035_chr22_29683123_+_ATF1_ENST00000262053_chr12_51207793_+_1113nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGC
AGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCT
CCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGATTGCC
ATTGCCCCAAATGGAGCCTTACAGTTGGCAAGTCCAGGCACAGATGGAGTACAGGGACTTCAGACATTAACCATGACAAATTCAGGCAGT
ACTCAGCAAGGTACAACTATTCTTCAGTATGCACAGACCTCTGATGGACAGCAGATACTTGTGCCCAGCAATCAGGTGGTCGTACAAACT
GCATCAGGAGATATGCAAACATATCAGATCCGAACTACACCTTCAGCTACTTCTCTGCCACAAACTGTGGTGATGACATCTCCTGTGACT
CTCACCTCTCAGACAACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAGGTTAATGAAAAACAGAGAAGCTGCTCGAGAATGTCGC
AGAAAGAAGAAAGAATATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAATCAAAATAAAACTCTAATAGAAGAGTTAAAAACT

>In-frame_EWSR1_ENST00000332050_chr22_29683123_+_ATF1_ENST00000262053_chr12_51207793_+_1281nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGATTGCCATTGCCCCAAAT
GGAGCCTTACAGTTGGCAAGTCCAGGCACAGATGGAGTACAGGGACTTCAGACATTAACCATGACAAATTCAGGCAGTACTCAGCAAGGT
ACAACTATTCTTCAGTATGCACAGACCTCTGATGGACAGCAGATACTTGTGCCCAGCAATCAGGTGGTCGTACAAACTGCATCAGGAGAT
ATGCAAACATATCAGATCCGAACTACACCTTCAGCTACTTCTCTGCCACAAACTGTGGTGATGACATCTCCTGTGACTCTCACCTCTCAG
ACAACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAGGTTAATGAAAAACAGAGAAGCTGCTCGAGAATGTCGCAGAAAGAAGAAA
GAATATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAATCAAAATAAAACTCTAATAGAAGAGTTAAAAACTTTGAAGGATCTT

>In-frame_EWSR1_ENST00000397938_chr22_29683123_+_ATF1_ENST00000262053_chr12_51207793_+_1281nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGATTGCCATTGCCCCAAAT
GGAGCCTTACAGTTGGCAAGTCCAGGCACAGATGGAGTACAGGGACTTCAGACATTAACCATGACAAATTCAGGCAGTACTCAGCAAGGT
ACAACTATTCTTCAGTATGCACAGACCTCTGATGGACAGCAGATACTTGTGCCCAGCAATCAGGTGGTCGTACAAACTGCATCAGGAGAT
ATGCAAACATATCAGATCCGAACTACACCTTCAGCTACTTCTCTGCCACAAACTGTGGTGATGACATCTCCTGTGACTCTCACCTCTCAG
ACAACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAGGTTAATGAAAAACAGAGAAGCTGCTCGAGAATGTCGCAGAAAGAAGAAA
GAATATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAATCAAAATAAAACTCTAATAGAAGAGTTAAAAACTTTGAAGGATCTT

>In-frame_EWSR1_ENST00000406548_chr22_29683123_+_ATF1_ENST00000262053_chr12_51207793_+_1281nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGATTGCCATTGCCCCAAAT
GGAGCCTTACAGTTGGCAAGTCCAGGCACAGATGGAGTACAGGGACTTCAGACATTAACCATGACAAATTCAGGCAGTACTCAGCAAGGT
ACAACTATTCTTCAGTATGCACAGACCTCTGATGGACAGCAGATACTTGTGCCCAGCAATCAGGTGGTCGTACAAACTGCATCAGGAGAT
ATGCAAACATATCAGATCCGAACTACACCTTCAGCTACTTCTCTGCCACAAACTGTGGTGATGACATCTCCTGTGACTCTCACCTCTCAG
ACAACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAGGTTAATGAAAAACAGAGAAGCTGCTCGAGAATGTCGCAGAAAGAAGAAA
GAATATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAATCAAAATAAAACTCTAATAGAAGAGTTAAAAACTTTGAAGGATCTT

>In-frame_EWSR1_ENST00000331029_chr22_29683123_+_ATF1_ENST00000262053_chr12_51207793_+_1281nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGATTGCCATTGCCCCAAAT
GGAGCCTTACAGTTGGCAAGTCCAGGCACAGATGGAGTACAGGGACTTCAGACATTAACCATGACAAATTCAGGCAGTACTCAGCAAGGT
ACAACTATTCTTCAGTATGCACAGACCTCTGATGGACAGCAGATACTTGTGCCCAGCAATCAGGTGGTCGTACAAACTGCATCAGGAGAT
ATGCAAACATATCAGATCCGAACTACACCTTCAGCTACTTCTCTGCCACAAACTGTGGTGATGACATCTCCTGTGACTCTCACCTCTCAG
ACAACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAGGTTAATGAAAAACAGAGAAGCTGCTCGAGAATGTCGCAGAAAGAAGAAA
GAATATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAATCAAAATAAAACTCTAATAGAAGAGTTAAAAACTTTGAAGGATCTT

>In-frame_EWSR1_ENST00000414183_chr22_29683123_+_ATF1_ENST00000262053_chr12_51207793_+_1299nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGTAGAAGGGACCAGTACAGGTTATACTACTCCAACTGCCCCCCAG
GCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCT
CAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAG
CCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAG
GTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGAT
CAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAG
CAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAG
ATTGCCATTGCCCCAAATGGAGCCTTACAGTTGGCAAGTCCAGGCACAGATGGAGTACAGGGACTTCAGACATTAACCATGACAAATTCA
GGCAGTACTCAGCAAGGTACAACTATTCTTCAGTATGCACAGACCTCTGATGGACAGCAGATACTTGTGCCCAGCAATCAGGTGGTCGTA
CAAACTGCATCAGGAGATATGCAAACATATCAGATCCGAACTACACCTTCAGCTACTTCTCTGCCACAAACTGTGGTGATGACATCTCCT
GTGACTCTCACCTCTCAGACAACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAGGTTAATGAAAAACAGAGAAGCTGCTCGAGAA
TGTCGCAGAAAGAAGAAAGAATATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAATCAAAATAAAACTCTAATAGAAGAGTTA

>In-frame_EWSR1_ENST00000333395_chr22_29683123_+_ATF1_ENST00000262053_chr12_51207793_+_1281nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGATTGCCATTGCCCCAAAT
GGAGCCTTACAGTTGGCAAGTCCAGGCACAGATGGAGTACAGGGACTTCAGACATTAACCATGACAAATTCAGGCAGTACTCAGCAAGGT
ACAACTATTCTTCAGTATGCACAGACCTCTGATGGACAGCAGATACTTGTGCCCAGCAATCAGGTGGTCGTACAAACTGCATCAGGAGAT
ATGCAAACATATCAGATCCGAACTACACCTTCAGCTACTTCTCTGCCACAAACTGTGGTGATGACATCTCCTGTGACTCTCACCTCTCAG
ACAACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAGGTTAATGAAAAACAGAGAAGCTGCTCGAGAATGTCGCAGAAAGAAGAAA
GAATATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAATCAAAATAAAACTCTAATAGAAGAGTTAAAAACTTTGAAGGATCTT

>In-frame_EWSR1_ENST00000332035_chr22_29683123_+_ATF1_ENST00000262053_chr12_51207793_+_1113nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGC
AGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCT
CCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGATTGCC
ATTGCCCCAAATGGAGCCTTACAGTTGGCAAGTCCAGGCACAGATGGAGTACAGGGACTTCAGACATTAACCATGACAAATTCAGGCAGT
ACTCAGCAAGGTACAACTATTCTTCAGTATGCACAGACCTCTGATGGACAGCAGATACTTGTGCCCAGCAATCAGGTGGTCGTACAAACT
GCATCAGGAGATATGCAAACATATCAGATCCGAACTACACCTTCAGCTACTTCTCTGCCACAAACTGTGGTGATGACATCTCCTGTGACT
CTCACCTCTCAGACAACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAGGTTAATGAAAAACAGAGAAGCTGCTCGAGAATGTCGC
AGAAAGAAGAAAGAATATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAATCAAAATAAAACTCTAATAGAAGAGTTAAAAACT

>In-frame_EWSR1_ENST00000332050_chr22_29683123_+_ATF1_ENST00000262053_chr12_51208063_+_1098nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGACTGCATCAGGAGATATG
CAAACATATCAGATCCGAACTACACCTTCAGCTACTTCTCTGCCACAAACTGTGGTGATGACATCTCCTGTGACTCTCACCTCTCAGACA
ACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAGGTTAATGAAAAACAGAGAAGCTGCTCGAGAATGTCGCAGAAAGAAGAAAGAA
TATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAATCAAAATAAAACTCTAATAGAAGAGTTAAAAACTTTGAAGGATCTTTAT

>In-frame_EWSR1_ENST00000332050_chr22_29683123_+_ATF1_ENST00000539132_chr12_51208063_+_1098nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGACTGCATCAGGAGATATG
CAAACATATCAGATCCGAACTACACCTTCAGCTACTTCTCTGCCACAAACTGTGGTGATGACATCTCCTGTGACTCTCACCTCTCAGACA
ACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAGGTTAATGAAAAACAGAGAAGCTGCTCGAGAATGTCGCAGAAAGAAGAAAGAA
TATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAATCAAAATAAAACTCTAATAGAAGAGTTAAAAACTTTGAAGGATCTTTAT

>In-frame_EWSR1_ENST00000397938_chr22_29683123_+_ATF1_ENST00000262053_chr12_51208063_+_1098nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGACTGCATCAGGAGATATG
CAAACATATCAGATCCGAACTACACCTTCAGCTACTTCTCTGCCACAAACTGTGGTGATGACATCTCCTGTGACTCTCACCTCTCAGACA
ACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAGGTTAATGAAAAACAGAGAAGCTGCTCGAGAATGTCGCAGAAAGAAGAAAGAA
TATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAATCAAAATAAAACTCTAATAGAAGAGTTAAAAACTTTGAAGGATCTTTAT

>In-frame_EWSR1_ENST00000397938_chr22_29683123_+_ATF1_ENST00000539132_chr12_51208063_+_1098nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGACTGCATCAGGAGATATG
CAAACATATCAGATCCGAACTACACCTTCAGCTACTTCTCTGCCACAAACTGTGGTGATGACATCTCCTGTGACTCTCACCTCTCAGACA
ACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAGGTTAATGAAAAACAGAGAAGCTGCTCGAGAATGTCGCAGAAAGAAGAAAGAA
TATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAATCAAAATAAAACTCTAATAGAAGAGTTAAAAACTTTGAAGGATCTTTAT

>In-frame_EWSR1_ENST00000406548_chr22_29683123_+_ATF1_ENST00000262053_chr12_51208063_+_1098nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGACTGCATCAGGAGATATG
CAAACATATCAGATCCGAACTACACCTTCAGCTACTTCTCTGCCACAAACTGTGGTGATGACATCTCCTGTGACTCTCACCTCTCAGACA
ACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAGGTTAATGAAAAACAGAGAAGCTGCTCGAGAATGTCGCAGAAAGAAGAAAGAA
TATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAATCAAAATAAAACTCTAATAGAAGAGTTAAAAACTTTGAAGGATCTTTAT

>In-frame_EWSR1_ENST00000406548_chr22_29683123_+_ATF1_ENST00000539132_chr12_51208063_+_1098nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGACTGCATCAGGAGATATG
CAAACATATCAGATCCGAACTACACCTTCAGCTACTTCTCTGCCACAAACTGTGGTGATGACATCTCCTGTGACTCTCACCTCTCAGACA
ACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAGGTTAATGAAAAACAGAGAAGCTGCTCGAGAATGTCGCAGAAAGAAGAAAGAA
TATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAATCAAAATAAAACTCTAATAGAAGAGTTAAAAACTTTGAAGGATCTTTAT

>In-frame_EWSR1_ENST00000331029_chr22_29683123_+_ATF1_ENST00000262053_chr12_51208063_+_1098nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGACTGCATCAGGAGATATG
CAAACATATCAGATCCGAACTACACCTTCAGCTACTTCTCTGCCACAAACTGTGGTGATGACATCTCCTGTGACTCTCACCTCTCAGACA
ACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAGGTTAATGAAAAACAGAGAAGCTGCTCGAGAATGTCGCAGAAAGAAGAAAGAA
TATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAATCAAAATAAAACTCTAATAGAAGAGTTAAAAACTTTGAAGGATCTTTAT

>In-frame_EWSR1_ENST00000331029_chr22_29683123_+_ATF1_ENST00000539132_chr12_51208063_+_1098nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGACTGCATCAGGAGATATG
CAAACATATCAGATCCGAACTACACCTTCAGCTACTTCTCTGCCACAAACTGTGGTGATGACATCTCCTGTGACTCTCACCTCTCAGACA
ACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAGGTTAATGAAAAACAGAGAAGCTGCTCGAGAATGTCGCAGAAAGAAGAAAGAA
TATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAATCAAAATAAAACTCTAATAGAAGAGTTAAAAACTTTGAAGGATCTTTAT

>In-frame_EWSR1_ENST00000414183_chr22_29683123_+_ATF1_ENST00000262053_chr12_51208063_+_1116nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGTAGAAGGGACCAGTACAGGTTATACTACTCCAACTGCCCCCCAG
GCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCT
CAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAG
CCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAG
GTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGAT
CAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAG
CAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAG
ACTGCATCAGGAGATATGCAAACATATCAGATCCGAACTACACCTTCAGCTACTTCTCTGCCACAAACTGTGGTGATGACATCTCCTGTG
ACTCTCACCTCTCAGACAACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAGGTTAATGAAAAACAGAGAAGCTGCTCGAGAATGT
CGCAGAAAGAAGAAAGAATATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAATCAAAATAAAACTCTAATAGAAGAGTTAAAA

>In-frame_EWSR1_ENST00000414183_chr22_29683123_+_ATF1_ENST00000539132_chr12_51208063_+_1116nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGTAGAAGGGACCAGTACAGGTTATACTACTCCAACTGCCCCCCAG
GCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCT
CAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAG
CCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAG
GTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGAT
CAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAG
CAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAG
ACTGCATCAGGAGATATGCAAACATATCAGATCCGAACTACACCTTCAGCTACTTCTCTGCCACAAACTGTGGTGATGACATCTCCTGTG
ACTCTCACCTCTCAGACAACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAGGTTAATGAAAAACAGAGAAGCTGCTCGAGAATGT
CGCAGAAAGAAGAAAGAATATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAATCAAAATAAAACTCTAATAGAAGAGTTAAAA

>In-frame_EWSR1_ENST00000333395_chr22_29683123_+_ATF1_ENST00000262053_chr12_51208063_+_1098nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGACTGCATCAGGAGATATG
CAAACATATCAGATCCGAACTACACCTTCAGCTACTTCTCTGCCACAAACTGTGGTGATGACATCTCCTGTGACTCTCACCTCTCAGACA
ACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAGGTTAATGAAAAACAGAGAAGCTGCTCGAGAATGTCGCAGAAAGAAGAAAGAA
TATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAATCAAAATAAAACTCTAATAGAAGAGTTAAAAACTTTGAAGGATCTTTAT

>In-frame_EWSR1_ENST00000333395_chr22_29683123_+_ATF1_ENST00000539132_chr12_51208063_+_1098nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAA
CCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCC
ATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAG
CAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTAC
CCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGACTGCATCAGGAGATATG
CAAACATATCAGATCCGAACTACACCTTCAGCTACTTCTCTGCCACAAACTGTGGTGATGACATCTCCTGTGACTCTCACCTCTCAGACA
ACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAGGTTAATGAAAAACAGAGAAGCTGCTCGAGAATGTCGCAGAAAGAAGAAAGAA
TATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAATCAAAATAAAACTCTAATAGAAGAGTTAAAAACTTTGAAGGATCTTTAT

>In-frame_EWSR1_ENST00000332035_chr22_29683123_+_ATF1_ENST00000262053_chr12_51208063_+_930nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGC
AGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCT
CCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGACTGCA
TCAGGAGATATGCAAACATATCAGATCCGAACTACACCTTCAGCTACTTCTCTGCCACAAACTGTGGTGATGACATCTCCTGTGACTCTC
ACCTCTCAGACAACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAGGTTAATGAAAAACAGAGAAGCTGCTCGAGAATGTCGCAGA
AAGAAGAAAGAATATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAATCAAAATAAAACTCTAATAGAAGAGTTAAAAACTTTG

>In-frame_EWSR1_ENST00000332035_chr22_29683123_+_ATF1_ENST00000539132_chr12_51208063_+_930nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTC
CAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACT
CAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGC
AGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCT
CCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGACTGCA
TCAGGAGATATGCAAACATATCAGATCCGAACTACACCTTCAGCTACTTCTCTGCCACAAACTGTGGTGATGACATCTCCTGTGACTCTC
ACCTCTCAGACAACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAGGTTAATGAAAAACAGAGAAGCTGCTCGAGAATGTCGCAGA
AAGAAGAAAGAATATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAATCAAAATAAAACTCTAATAGAAGAGTTAAAAACTTTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_EWSR1_ENST00000332050_chr22_29683123_+_ATF1_ENST00000262053_chr12_51207793_+_2952nt
AGAGCCAGCGGACGGAACCATTCCAAACAGCCTAGTCTCGTGCTGAGAGCCTCTCCGGTTTCACGCTGAGACCCGCTCACCCCCGCTCTG
GCCCCTTAGATGCTATTTTGGCCCGAGTGTCACGTCGGGCGCTCTTTAGAGAGGACTGGGACAAGAGTTGCGGACGCGAAGAACGAGTAA
GCGGTGGTTCATCCCTCCTGACCCCACCCCCGTGGCCTGGCCCGATGGTCGCGCCCGGGGTTGCGAGATTTGCGCCTGCGCAGTGCGGCG
CCTAGAGGGAAAGCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCA
AGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTA
TGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGG
ACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCAC
CACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCC
AGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCC
CAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCC
TCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGG
ACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCC
AAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGATTGCCATTGCCCCAAATGGAGCCTTACAGTTGGCAAGTCCAGGCACAGA
TGGAGTACAGGGACTTCAGACATTAACCATGACAAATTCAGGCAGTACTCAGCAAGGTACAACTATTCTTCAGTATGCACAGACCTCTGA
TGGACAGCAGATACTTGTGCCCAGCAATCAGGTGGTCGTACAAACTGCATCAGGAGATATGCAAACATATCAGATCCGAACTACACCTTC
AGCTACTTCTCTGCCACAAACTGTGGTGATGACATCTCCTGTGACTCTCACCTCTCAGACAACTAAGACAGATGACCCCCAATTGAAAAG
AGAAATAAGGTTAATGAAAAACAGAGAAGCTGCTCGAGAATGTCGCAGAAAGAAGAAAGAATATGTGAAATGCCTGGAAAACCGAGTTGC
AGTCCTGGAAAATCAAAATAAAACTCTAATAGAAGAGTTAAAAACTTTGAAGGATCTTTATTCCAATAAAAGTGTTTGATTCCTAAGAAA
GAAAATATTTTTGTGGACATGCATAAAAATTAAATGGATTTCCTAGTGGAGTTTTATAAATTAAAAGGTCAAAACTGAAGCTTTTTATTT
AGGCTTTTCCAAATCAAGGATAAATATCTTACGCACGATATCTAGTGACAGAGGAGAAAGTGGAAAATGACCTCAAGGAAGCTACGGGCA
CAACTGGAAGCTTTGTAGAAATTAAACATATTCAAGGAGCAAGAAATGAACTTTCAGCAGTCTAAATTTTCTAAATAACCAATAGTTGCC
AATCTAAAATGGCAGAGAAGATGAAATTTGATAAACTGAATTTTTTTTAAAAATCCATTTACCCTACAGGTTTGCATTTGTTTGCTGAAA
TTTACCTTTTTTTAGTTATATATATGTGTGTGTGTGTGTGTAATTTCTGCCAATAAATTCTAAATTACAAAGGTAAGAGAAAACCTAGTA
CATTACTAAATATATAAAGTATATGTTCTGATTATGTATACTTGTTCTAGTGTCAAGTCTTTTTAAGTGGGTTTTTAAAAGTTTGTTATT
GGACTTGAATGGATTTTTGAGACTAGGTTAATTATTTTTGAGGTCTTATCCTAAAAGGCATCTAAGGTACATGAATGGAGTATGGTGATT
TTATAACATTTTTTATCAGAATGGAAAAAGAACTGTTTAAAAGTTTGATACTTTTAAATAGTTGGTTTTTTTGCTTACTCTGGTAATGAT
TTTCTACAAATACATAATAAATTGTTTTTTTGAGTCTATATTCTGTATGCAGTTGAATATCCATTACTTATTCTGCTGTGCTTTAATAGA
ATGGAATGTTTACAGGCCCTTAAAATATTATTTTTAAAAAACCTTCTGAAGATACATACCAAAGTTTTTCCAAGAAGATTTTATAATCAA
TTTAATAATGTAAGGTTTATCAGATTCTATAATAGTATAGTTATTAAGGCAATTTTATGTTAGAGACTATTTTGTAATGTAGTGAGTGGT
ACCTTTATAAGAAAAGTGACTGCCAATATATTTTTATAGCTGATCTTTATAAATTCTAATGTTGAGTTTTTAATGATTATTTTAAATGTT
TATATAGTTTAGTAAAATTTGCATCTCAAAGTATCATTTTTATATTATGGGACGTTTTCAGATTGGCTAATATTTGCATTGTAAATTTTG
TATGCAGTTTATCTAAAATTCAAAAATACTGTCAGTACACCAGCGTTTAACATCTATATTCCAATTTGTATACAGTTTAAAATTGTACTG

>In-frame_EWSR1_ENST00000397938_chr22_29683123_+_ATF1_ENST00000262053_chr12_51207793_+_2943nt
GGACGGAACCATTCCAAACAGCCTAGTCTCGTGCTGAGAGCCTCTCCGGTTTCACGCTGAGACCCGCTCACCCCCGCTCTGGCCCCTTAG
ATGCTATTTTGGCCCGAGTGTCACGTCGGGCGCTCTTTAGAGAGGACTGGGACAAGAGTTGCGGACGCGAAGAACGAGTAAGCGGTGGTT
CATCCCTCCTGACCCCACCCCCGTGGCCTGGCCCGATGGTCGCGCCCGGGGTTGCGAGATTTGCGCCTGCGCAGTGCGGCGCCTAGAGGG
AAAGCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGC
GCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTA
TGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCC
CACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTAC
AGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCAC
TGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGG
ATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAG
CTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAG
TAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATA
TAGCCAACAGAGCAGCAGCTACGGGCAGCAGATTGCCATTGCCCCAAATGGAGCCTTACAGTTGGCAAGTCCAGGCACAGATGGAGTACA
GGGACTTCAGACATTAACCATGACAAATTCAGGCAGTACTCAGCAAGGTACAACTATTCTTCAGTATGCACAGACCTCTGATGGACAGCA
GATACTTGTGCCCAGCAATCAGGTGGTCGTACAAACTGCATCAGGAGATATGCAAACATATCAGATCCGAACTACACCTTCAGCTACTTC
TCTGCCACAAACTGTGGTGATGACATCTCCTGTGACTCTCACCTCTCAGACAACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAG
GTTAATGAAAAACAGAGAAGCTGCTCGAGAATGTCGCAGAAAGAAGAAAGAATATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGA
AAATCAAAATAAAACTCTAATAGAAGAGTTAAAAACTTTGAAGGATCTTTATTCCAATAAAAGTGTTTGATTCCTAAGAAAGAAAATATT
TTTGTGGACATGCATAAAAATTAAATGGATTTCCTAGTGGAGTTTTATAAATTAAAAGGTCAAAACTGAAGCTTTTTATTTAGGCTTTTC
CAAATCAAGGATAAATATCTTACGCACGATATCTAGTGACAGAGGAGAAAGTGGAAAATGACCTCAAGGAAGCTACGGGCACAACTGGAA
GCTTTGTAGAAATTAAACATATTCAAGGAGCAAGAAATGAACTTTCAGCAGTCTAAATTTTCTAAATAACCAATAGTTGCCAATCTAAAA
TGGCAGAGAAGATGAAATTTGATAAACTGAATTTTTTTTAAAAATCCATTTACCCTACAGGTTTGCATTTGTTTGCTGAAATTTACCTTT
TTTTAGTTATATATATGTGTGTGTGTGTGTGTAATTTCTGCCAATAAATTCTAAATTACAAAGGTAAGAGAAAACCTAGTACATTACTAA
ATATATAAAGTATATGTTCTGATTATGTATACTTGTTCTAGTGTCAAGTCTTTTTAAGTGGGTTTTTAAAAGTTTGTTATTGGACTTGAA
TGGATTTTTGAGACTAGGTTAATTATTTTTGAGGTCTTATCCTAAAAGGCATCTAAGGTACATGAATGGAGTATGGTGATTTTATAACAT
TTTTTATCAGAATGGAAAAAGAACTGTTTAAAAGTTTGATACTTTTAAATAGTTGGTTTTTTTGCTTACTCTGGTAATGATTTTCTACAA
ATACATAATAAATTGTTTTTTTGAGTCTATATTCTGTATGCAGTTGAATATCCATTACTTATTCTGCTGTGCTTTAATAGAATGGAATGT
TTACAGGCCCTTAAAATATTATTTTTAAAAAACCTTCTGAAGATACATACCAAAGTTTTTCCAAGAAGATTTTATAATCAATTTAATAAT
GTAAGGTTTATCAGATTCTATAATAGTATAGTTATTAAGGCAATTTTATGTTAGAGACTATTTTGTAATGTAGTGAGTGGTACCTTTATA
AGAAAAGTGACTGCCAATATATTTTTATAGCTGATCTTTATAAATTCTAATGTTGAGTTTTTAATGATTATTTTAAATGTTTATATAGTT
TAGTAAAATTTGCATCTCAAAGTATCATTTTTATATTATGGGACGTTTTCAGATTGGCTAATATTTGCATTGTAAATTTTGTATGCAGTT
TATCTAAAATTCAAAAATACTGTCAGTACACCAGCGTTTAACATCTATATTCCAATTTGTATACAGTTTAAAATTGTACTGCAAAACTAT

>In-frame_EWSR1_ENST00000406548_chr22_29683123_+_ATF1_ENST00000262053_chr12_51207793_+_2688nt
GCGGCGCCTAGAGGGAAAGCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTA
TAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACA
AAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTC
TTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGA
TACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCA
GCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAA
CCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATC
CTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAG
CTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCA
AGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGATTGCCATTGCCCCAAATGGAGCCTTACAGTTGGCAAGTCCAGG
CACAGATGGAGTACAGGGACTTCAGACATTAACCATGACAAATTCAGGCAGTACTCAGCAAGGTACAACTATTCTTCAGTATGCACAGAC
CTCTGATGGACAGCAGATACTTGTGCCCAGCAATCAGGTGGTCGTACAAACTGCATCAGGAGATATGCAAACATATCAGATCCGAACTAC
ACCTTCAGCTACTTCTCTGCCACAAACTGTGGTGATGACATCTCCTGTGACTCTCACCTCTCAGACAACTAAGACAGATGACCCCCAATT
GAAAAGAGAAATAAGGTTAATGAAAAACAGAGAAGCTGCTCGAGAATGTCGCAGAAAGAAGAAAGAATATGTGAAATGCCTGGAAAACCG
AGTTGCAGTCCTGGAAAATCAAAATAAAACTCTAATAGAAGAGTTAAAAACTTTGAAGGATCTTTATTCCAATAAAAGTGTTTGATTCCT
AAGAAAGAAAATATTTTTGTGGACATGCATAAAAATTAAATGGATTTCCTAGTGGAGTTTTATAAATTAAAAGGTCAAAACTGAAGCTTT
TTATTTAGGCTTTTCCAAATCAAGGATAAATATCTTACGCACGATATCTAGTGACAGAGGAGAAAGTGGAAAATGACCTCAAGGAAGCTA
CGGGCACAACTGGAAGCTTTGTAGAAATTAAACATATTCAAGGAGCAAGAAATGAACTTTCAGCAGTCTAAATTTTCTAAATAACCAATA
GTTGCCAATCTAAAATGGCAGAGAAGATGAAATTTGATAAACTGAATTTTTTTTAAAAATCCATTTACCCTACAGGTTTGCATTTGTTTG
CTGAAATTTACCTTTTTTTAGTTATATATATGTGTGTGTGTGTGTGTAATTTCTGCCAATAAATTCTAAATTACAAAGGTAAGAGAAAAC
CTAGTACATTACTAAATATATAAAGTATATGTTCTGATTATGTATACTTGTTCTAGTGTCAAGTCTTTTTAAGTGGGTTTTTAAAAGTTT
GTTATTGGACTTGAATGGATTTTTGAGACTAGGTTAATTATTTTTGAGGTCTTATCCTAAAAGGCATCTAAGGTACATGAATGGAGTATG
GTGATTTTATAACATTTTTTATCAGAATGGAAAAAGAACTGTTTAAAAGTTTGATACTTTTAAATAGTTGGTTTTTTTGCTTACTCTGGT
AATGATTTTCTACAAATACATAATAAATTGTTTTTTTGAGTCTATATTCTGTATGCAGTTGAATATCCATTACTTATTCTGCTGTGCTTT
AATAGAATGGAATGTTTACAGGCCCTTAAAATATTATTTTTAAAAAACCTTCTGAAGATACATACCAAAGTTTTTCCAAGAAGATTTTAT
AATCAATTTAATAATGTAAGGTTTATCAGATTCTATAATAGTATAGTTATTAAGGCAATTTTATGTTAGAGACTATTTTGTAATGTAGTG
AGTGGTACCTTTATAAGAAAAGTGACTGCCAATATATTTTTATAGCTGATCTTTATAAATTCTAATGTTGAGTTTTTAATGATTATTTTA
AATGTTTATATAGTTTAGTAAAATTTGCATCTCAAAGTATCATTTTTATATTATGGGACGTTTTCAGATTGGCTAATATTTGCATTGTAA
ATTTTGTATGCAGTTTATCTAAAATTCAAAAATACTGTCAGTACACCAGCGTTTAACATCTATATTCCAATTTGTATACAGTTTAAAATT

>In-frame_EWSR1_ENST00000331029_chr22_29683123_+_ATF1_ENST00000262053_chr12_51207793_+_2670nt
GCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCA
GCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGG
ACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCAC
TGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGT
CACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGC
ACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATA
TGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTA
TTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAG
CTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAG
CCAACAGAGCAGCAGCTACGGGCAGCAGATTGCCATTGCCCCAAATGGAGCCTTACAGTTGGCAAGTCCAGGCACAGATGGAGTACAGGG
ACTTCAGACATTAACCATGACAAATTCAGGCAGTACTCAGCAAGGTACAACTATTCTTCAGTATGCACAGACCTCTGATGGACAGCAGAT
ACTTGTGCCCAGCAATCAGGTGGTCGTACAAACTGCATCAGGAGATATGCAAACATATCAGATCCGAACTACACCTTCAGCTACTTCTCT
GCCACAAACTGTGGTGATGACATCTCCTGTGACTCTCACCTCTCAGACAACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAGGTT
AATGAAAAACAGAGAAGCTGCTCGAGAATGTCGCAGAAAGAAGAAAGAATATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAA
TCAAAATAAAACTCTAATAGAAGAGTTAAAAACTTTGAAGGATCTTTATTCCAATAAAAGTGTTTGATTCCTAAGAAAGAAAATATTTTT
GTGGACATGCATAAAAATTAAATGGATTTCCTAGTGGAGTTTTATAAATTAAAAGGTCAAAACTGAAGCTTTTTATTTAGGCTTTTCCAA
ATCAAGGATAAATATCTTACGCACGATATCTAGTGACAGAGGAGAAAGTGGAAAATGACCTCAAGGAAGCTACGGGCACAACTGGAAGCT
TTGTAGAAATTAAACATATTCAAGGAGCAAGAAATGAACTTTCAGCAGTCTAAATTTTCTAAATAACCAATAGTTGCCAATCTAAAATGG
CAGAGAAGATGAAATTTGATAAACTGAATTTTTTTTAAAAATCCATTTACCCTACAGGTTTGCATTTGTTTGCTGAAATTTACCTTTTTT
TAGTTATATATATGTGTGTGTGTGTGTGTAATTTCTGCCAATAAATTCTAAATTACAAAGGTAAGAGAAAACCTAGTACATTACTAAATA
TATAAAGTATATGTTCTGATTATGTATACTTGTTCTAGTGTCAAGTCTTTTTAAGTGGGTTTTTAAAAGTTTGTTATTGGACTTGAATGG
ATTTTTGAGACTAGGTTAATTATTTTTGAGGTCTTATCCTAAAAGGCATCTAAGGTACATGAATGGAGTATGGTGATTTTATAACATTTT
TTATCAGAATGGAAAAAGAACTGTTTAAAAGTTTGATACTTTTAAATAGTTGGTTTTTTTGCTTACTCTGGTAATGATTTTCTACAAATA
CATAATAAATTGTTTTTTTGAGTCTATATTCTGTATGCAGTTGAATATCCATTACTTATTCTGCTGTGCTTTAATAGAATGGAATGTTTA
CAGGCCCTTAAAATATTATTTTTAAAAAACCTTCTGAAGATACATACCAAAGTTTTTCCAAGAAGATTTTATAATCAATTTAATAATGTA
AGGTTTATCAGATTCTATAATAGTATAGTTATTAAGGCAATTTTATGTTAGAGACTATTTTGTAATGTAGTGAGTGGTACCTTTATAAGA
AAAGTGACTGCCAATATATTTTTATAGCTGATCTTTATAAATTCTAATGTTGAGTTTTTAATGATTATTTTAAATGTTTATATAGTTTAG
TAAAATTTGCATCTCAAAGTATCATTTTTATATTATGGGACGTTTTCAGATTGGCTAATATTTGCATTGTAAATTTTGTATGCAGTTTAT
CTAAAATTCAAAAATACTGTCAGTACACCAGCGTTTAACATCTATATTCCAATTTGTATACAGTTTAAAATTGTACTGCAAAACTATTGT

>In-frame_EWSR1_ENST00000414183_chr22_29683123_+_ATF1_ENST00000262053_chr12_51207793_+_2663nt
AACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCC
CAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACC
CAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGTAGAAGGGACCAGTACAGGTTAT
ACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACC
ACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACA
AGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAG
AGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCT
ACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGT
CAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAG
AGCAGCAGCTACGGGCAGCAGATTGCCATTGCCCCAAATGGAGCCTTACAGTTGGCAAGTCCAGGCACAGATGGAGTACAGGGACTTCAG
ACATTAACCATGACAAATTCAGGCAGTACTCAGCAAGGTACAACTATTCTTCAGTATGCACAGACCTCTGATGGACAGCAGATACTTGTG
CCCAGCAATCAGGTGGTCGTACAAACTGCATCAGGAGATATGCAAACATATCAGATCCGAACTACACCTTCAGCTACTTCTCTGCCACAA
ACTGTGGTGATGACATCTCCTGTGACTCTCACCTCTCAGACAACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAGGTTAATGAAA
AACAGAGAAGCTGCTCGAGAATGTCGCAGAAAGAAGAAAGAATATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAATCAAAAT
AAAACTCTAATAGAAGAGTTAAAAACTTTGAAGGATCTTTATTCCAATAAAAGTGTTTGATTCCTAAGAAAGAAAATATTTTTGTGGACA
TGCATAAAAATTAAATGGATTTCCTAGTGGAGTTTTATAAATTAAAAGGTCAAAACTGAAGCTTTTTATTTAGGCTTTTCCAAATCAAGG
ATAAATATCTTACGCACGATATCTAGTGACAGAGGAGAAAGTGGAAAATGACCTCAAGGAAGCTACGGGCACAACTGGAAGCTTTGTAGA
AATTAAACATATTCAAGGAGCAAGAAATGAACTTTCAGCAGTCTAAATTTTCTAAATAACCAATAGTTGCCAATCTAAAATGGCAGAGAA
GATGAAATTTGATAAACTGAATTTTTTTTAAAAATCCATTTACCCTACAGGTTTGCATTTGTTTGCTGAAATTTACCTTTTTTTAGTTAT
ATATATGTGTGTGTGTGTGTGTAATTTCTGCCAATAAATTCTAAATTACAAAGGTAAGAGAAAACCTAGTACATTACTAAATATATAAAG
TATATGTTCTGATTATGTATACTTGTTCTAGTGTCAAGTCTTTTTAAGTGGGTTTTTAAAAGTTTGTTATTGGACTTGAATGGATTTTTG
AGACTAGGTTAATTATTTTTGAGGTCTTATCCTAAAAGGCATCTAAGGTACATGAATGGAGTATGGTGATTTTATAACATTTTTTATCAG
AATGGAAAAAGAACTGTTTAAAAGTTTGATACTTTTAAATAGTTGGTTTTTTTGCTTACTCTGGTAATGATTTTCTACAAATACATAATA
AATTGTTTTTTTGAGTCTATATTCTGTATGCAGTTGAATATCCATTACTTATTCTGCTGTGCTTTAATAGAATGGAATGTTTACAGGCCC
TTAAAATATTATTTTTAAAAAACCTTCTGAAGATACATACCAAAGTTTTTCCAAGAAGATTTTATAATCAATTTAATAATGTAAGGTTTA
TCAGATTCTATAATAGTATAGTTATTAAGGCAATTTTATGTTAGAGACTATTTTGTAATGTAGTGAGTGGTACCTTTATAAGAAAAGTGA
CTGCCAATATATTTTTATAGCTGATCTTTATAAATTCTAATGTTGAGTTTTTAATGATTATTTTAAATGTTTATATAGTTTAGTAAAATT
TGCATCTCAAAGTATCATTTTTATATTATGGGACGTTTTCAGATTGGCTAATATTTGCATTGTAAATTTTGTATGCAGTTTATCTAAAAT
TCAAAAATACTGTCAGTACACCAGCGTTTAACATCTATATTCCAATTTGTATACAGTTTAAAATTGTACTGCAAAACTATTGTGTGCTCT

>In-frame_EWSR1_ENST00000333395_chr22_29683123_+_ATF1_ENST00000262053_chr12_51207793_+_2643nt
CGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCA
GCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCA
GGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCA
GGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGC
TCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAA
GCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCA
GGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGA
TCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCA
GCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCA
GATTGCCATTGCCCCAAATGGAGCCTTACAGTTGGCAAGTCCAGGCACAGATGGAGTACAGGGACTTCAGACATTAACCATGACAAATTC
AGGCAGTACTCAGCAAGGTACAACTATTCTTCAGTATGCACAGACCTCTGATGGACAGCAGATACTTGTGCCCAGCAATCAGGTGGTCGT
ACAAACTGCATCAGGAGATATGCAAACATATCAGATCCGAACTACACCTTCAGCTACTTCTCTGCCACAAACTGTGGTGATGACATCTCC
TGTGACTCTCACCTCTCAGACAACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAGGTTAATGAAAAACAGAGAAGCTGCTCGAGA
ATGTCGCAGAAAGAAGAAAGAATATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAATCAAAATAAAACTCTAATAGAAGAGTT
AAAAACTTTGAAGGATCTTTATTCCAATAAAAGTGTTTGATTCCTAAGAAAGAAAATATTTTTGTGGACATGCATAAAAATTAAATGGAT
TTCCTAGTGGAGTTTTATAAATTAAAAGGTCAAAACTGAAGCTTTTTATTTAGGCTTTTCCAAATCAAGGATAAATATCTTACGCACGAT
ATCTAGTGACAGAGGAGAAAGTGGAAAATGACCTCAAGGAAGCTACGGGCACAACTGGAAGCTTTGTAGAAATTAAACATATTCAAGGAG
CAAGAAATGAACTTTCAGCAGTCTAAATTTTCTAAATAACCAATAGTTGCCAATCTAAAATGGCAGAGAAGATGAAATTTGATAAACTGA
ATTTTTTTTAAAAATCCATTTACCCTACAGGTTTGCATTTGTTTGCTGAAATTTACCTTTTTTTAGTTATATATATGTGTGTGTGTGTGT
GTAATTTCTGCCAATAAATTCTAAATTACAAAGGTAAGAGAAAACCTAGTACATTACTAAATATATAAAGTATATGTTCTGATTATGTAT
ACTTGTTCTAGTGTCAAGTCTTTTTAAGTGGGTTTTTAAAAGTTTGTTATTGGACTTGAATGGATTTTTGAGACTAGGTTAATTATTTTT
GAGGTCTTATCCTAAAAGGCATCTAAGGTACATGAATGGAGTATGGTGATTTTATAACATTTTTTATCAGAATGGAAAAAGAACTGTTTA
AAAGTTTGATACTTTTAAATAGTTGGTTTTTTTGCTTACTCTGGTAATGATTTTCTACAAATACATAATAAATTGTTTTTTTGAGTCTAT
ATTCTGTATGCAGTTGAATATCCATTACTTATTCTGCTGTGCTTTAATAGAATGGAATGTTTACAGGCCCTTAAAATATTATTTTTAAAA
AACCTTCTGAAGATACATACCAAAGTTTTTCCAAGAAGATTTTATAATCAATTTAATAATGTAAGGTTTATCAGATTCTATAATAGTATA
GTTATTAAGGCAATTTTATGTTAGAGACTATTTTGTAATGTAGTGAGTGGTACCTTTATAAGAAAAGTGACTGCCAATATATTTTTATAG
CTGATCTTTATAAATTCTAATGTTGAGTTTTTAATGATTATTTTAAATGTTTATATAGTTTAGTAAAATTTGCATCTCAAAGTATCATTT
TTATATTATGGGACGTTTTCAGATTGGCTAATATTTGCATTGTAAATTTTGTATGCAGTTTATCTAAAATTCAAAAATACTGTCAGTACA
CCAGCGTTTAACATCTATATTCCAATTTGTATACAGTTTAAAATTGTACTGCAAAACTATTGTGTGCTCTTACACAGTATGCATCATATT

>In-frame_EWSR1_ENST00000332035_chr22_29683123_+_ATF1_ENST00000262053_chr12_51207793_+_2467nt
AAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTC
AAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGA
CCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACA
GCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTG
CATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGCTATTCCTCTACACAGCCGACTAGTT
ATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATG
GGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGC
AGCAGATTGCCATTGCCCCAAATGGAGCCTTACAGTTGGCAAGTCCAGGCACAGATGGAGTACAGGGACTTCAGACATTAACCATGACAA
ATTCAGGCAGTACTCAGCAAGGTACAACTATTCTTCAGTATGCACAGACCTCTGATGGACAGCAGATACTTGTGCCCAGCAATCAGGTGG
TCGTACAAACTGCATCAGGAGATATGCAAACATATCAGATCCGAACTACACCTTCAGCTACTTCTCTGCCACAAACTGTGGTGATGACAT
CTCCTGTGACTCTCACCTCTCAGACAACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAGGTTAATGAAAAACAGAGAAGCTGCTC
GAGAATGTCGCAGAAAGAAGAAAGAATATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAATCAAAATAAAACTCTAATAGAAG
AGTTAAAAACTTTGAAGGATCTTTATTCCAATAAAAGTGTTTGATTCCTAAGAAAGAAAATATTTTTGTGGACATGCATAAAAATTAAAT
GGATTTCCTAGTGGAGTTTTATAAATTAAAAGGTCAAAACTGAAGCTTTTTATTTAGGCTTTTCCAAATCAAGGATAAATATCTTACGCA
CGATATCTAGTGACAGAGGAGAAAGTGGAAAATGACCTCAAGGAAGCTACGGGCACAACTGGAAGCTTTGTAGAAATTAAACATATTCAA
GGAGCAAGAAATGAACTTTCAGCAGTCTAAATTTTCTAAATAACCAATAGTTGCCAATCTAAAATGGCAGAGAAGATGAAATTTGATAAA
CTGAATTTTTTTTAAAAATCCATTTACCCTACAGGTTTGCATTTGTTTGCTGAAATTTACCTTTTTTTAGTTATATATATGTGTGTGTGT
GTGTGTAATTTCTGCCAATAAATTCTAAATTACAAAGGTAAGAGAAAACCTAGTACATTACTAAATATATAAAGTATATGTTCTGATTAT
GTATACTTGTTCTAGTGTCAAGTCTTTTTAAGTGGGTTTTTAAAAGTTTGTTATTGGACTTGAATGGATTTTTGAGACTAGGTTAATTAT
TTTTGAGGTCTTATCCTAAAAGGCATCTAAGGTACATGAATGGAGTATGGTGATTTTATAACATTTTTTATCAGAATGGAAAAAGAACTG
TTTAAAAGTTTGATACTTTTAAATAGTTGGTTTTTTTGCTTACTCTGGTAATGATTTTCTACAAATACATAATAAATTGTTTTTTTGAGT
CTATATTCTGTATGCAGTTGAATATCCATTACTTATTCTGCTGTGCTTTAATAGAATGGAATGTTTACAGGCCCTTAAAATATTATTTTT
AAAAAACCTTCTGAAGATACATACCAAAGTTTTTCCAAGAAGATTTTATAATCAATTTAATAATGTAAGGTTTATCAGATTCTATAATAG
TATAGTTATTAAGGCAATTTTATGTTAGAGACTATTTTGTAATGTAGTGAGTGGTACCTTTATAAGAAAAGTGACTGCCAATATATTTTT
ATAGCTGATCTTTATAAATTCTAATGTTGAGTTTTTAATGATTATTTTAAATGTTTATATAGTTTAGTAAAATTTGCATCTCAAAGTATC
ATTTTTATATTATGGGACGTTTTCAGATTGGCTAATATTTGCATTGTAAATTTTGTATGCAGTTTATCTAAAATTCAAAAATACTGTCAG
TACACCAGCGTTTAACATCTATATTCCAATTTGTATACAGTTTAAAATTGTACTGCAAAACTATTGTGTGCTCTTACACAGTATGCATCA

>In-frame_EWSR1_ENST00000332050_chr22_29683123_+_ATF1_ENST00000262053_chr12_51207793_+_2952nt
AGAGCCAGCGGACGGAACCATTCCAAACAGCCTAGTCTCGTGCTGAGAGCCTCTCCGGTTTCACGCTGAGACCCGCTCACCCCCGCTCTG
GCCCCTTAGATGCTATTTTGGCCCGAGTGTCACGTCGGGCGCTCTTTAGAGAGGACTGGGACAAGAGTTGCGGACGCGAAGAACGAGTAA
GCGGTGGTTCATCCCTCCTGACCCCACCCCCGTGGCCTGGCCCGATGGTCGCGCCCGGGGTTGCGAGATTTGCGCCTGCGCAGTGCGGCG
CCTAGAGGGAAAGCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCA
AGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTA
TGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGG
ACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCAC
CACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCC
AGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCC
CAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCC
TCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGG
ACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCC
AAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGATTGCCATTGCCCCAAATGGAGCCTTACAGTTGGCAAGTCCAGGCACAGA
TGGAGTACAGGGACTTCAGACATTAACCATGACAAATTCAGGCAGTACTCAGCAAGGTACAACTATTCTTCAGTATGCACAGACCTCTGA
TGGACAGCAGATACTTGTGCCCAGCAATCAGGTGGTCGTACAAACTGCATCAGGAGATATGCAAACATATCAGATCCGAACTACACCTTC
AGCTACTTCTCTGCCACAAACTGTGGTGATGACATCTCCTGTGACTCTCACCTCTCAGACAACTAAGACAGATGACCCCCAATTGAAAAG
AGAAATAAGGTTAATGAAAAACAGAGAAGCTGCTCGAGAATGTCGCAGAAAGAAGAAAGAATATGTGAAATGCCTGGAAAACCGAGTTGC
AGTCCTGGAAAATCAAAATAAAACTCTAATAGAAGAGTTAAAAACTTTGAAGGATCTTTATTCCAATAAAAGTGTTTGATTCCTAAGAAA
GAAAATATTTTTGTGGACATGCATAAAAATTAAATGGATTTCCTAGTGGAGTTTTATAAATTAAAAGGTCAAAACTGAAGCTTTTTATTT
AGGCTTTTCCAAATCAAGGATAAATATCTTACGCACGATATCTAGTGACAGAGGAGAAAGTGGAAAATGACCTCAAGGAAGCTACGGGCA
CAACTGGAAGCTTTGTAGAAATTAAACATATTCAAGGAGCAAGAAATGAACTTTCAGCAGTCTAAATTTTCTAAATAACCAATAGTTGCC
AATCTAAAATGGCAGAGAAGATGAAATTTGATAAACTGAATTTTTTTTAAAAATCCATTTACCCTACAGGTTTGCATTTGTTTGCTGAAA
TTTACCTTTTTTTAGTTATATATATGTGTGTGTGTGTGTGTAATTTCTGCCAATAAATTCTAAATTACAAAGGTAAGAGAAAACCTAGTA
CATTACTAAATATATAAAGTATATGTTCTGATTATGTATACTTGTTCTAGTGTCAAGTCTTTTTAAGTGGGTTTTTAAAAGTTTGTTATT
GGACTTGAATGGATTTTTGAGACTAGGTTAATTATTTTTGAGGTCTTATCCTAAAAGGCATCTAAGGTACATGAATGGAGTATGGTGATT
TTATAACATTTTTTATCAGAATGGAAAAAGAACTGTTTAAAAGTTTGATACTTTTAAATAGTTGGTTTTTTTGCTTACTCTGGTAATGAT
TTTCTACAAATACATAATAAATTGTTTTTTTGAGTCTATATTCTGTATGCAGTTGAATATCCATTACTTATTCTGCTGTGCTTTAATAGA
ATGGAATGTTTACAGGCCCTTAAAATATTATTTTTAAAAAACCTTCTGAAGATACATACCAAAGTTTTTCCAAGAAGATTTTATAATCAA
TTTAATAATGTAAGGTTTATCAGATTCTATAATAGTATAGTTATTAAGGCAATTTTATGTTAGAGACTATTTTGTAATGTAGTGAGTGGT
ACCTTTATAAGAAAAGTGACTGCCAATATATTTTTATAGCTGATCTTTATAAATTCTAATGTTGAGTTTTTAATGATTATTTTAAATGTT
TATATAGTTTAGTAAAATTTGCATCTCAAAGTATCATTTTTATATTATGGGACGTTTTCAGATTGGCTAATATTTGCATTGTAAATTTTG
TATGCAGTTTATCTAAAATTCAAAAATACTGTCAGTACACCAGCGTTTAACATCTATATTCCAATTTGTATACAGTTTAAAATTGTACTG

>In-frame_EWSR1_ENST00000397938_chr22_29683123_+_ATF1_ENST00000262053_chr12_51207793_+_2943nt
GGACGGAACCATTCCAAACAGCCTAGTCTCGTGCTGAGAGCCTCTCCGGTTTCACGCTGAGACCCGCTCACCCCCGCTCTGGCCCCTTAG
ATGCTATTTTGGCCCGAGTGTCACGTCGGGCGCTCTTTAGAGAGGACTGGGACAAGAGTTGCGGACGCGAAGAACGAGTAAGCGGTGGTT
CATCCCTCCTGACCCCACCCCCGTGGCCTGGCCCGATGGTCGCGCCCGGGGTTGCGAGATTTGCGCCTGCGCAGTGCGGCGCCTAGAGGG
AAAGCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGC
GCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTA
TGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCC
CACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTAC
AGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCAC
TGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGG
ATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAG
CTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAG
TAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATA
TAGCCAACAGAGCAGCAGCTACGGGCAGCAGATTGCCATTGCCCCAAATGGAGCCTTACAGTTGGCAAGTCCAGGCACAGATGGAGTACA
GGGACTTCAGACATTAACCATGACAAATTCAGGCAGTACTCAGCAAGGTACAACTATTCTTCAGTATGCACAGACCTCTGATGGACAGCA
GATACTTGTGCCCAGCAATCAGGTGGTCGTACAAACTGCATCAGGAGATATGCAAACATATCAGATCCGAACTACACCTTCAGCTACTTC
TCTGCCACAAACTGTGGTGATGACATCTCCTGTGACTCTCACCTCTCAGACAACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAG
GTTAATGAAAAACAGAGAAGCTGCTCGAGAATGTCGCAGAAAGAAGAAAGAATATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGA
AAATCAAAATAAAACTCTAATAGAAGAGTTAAAAACTTTGAAGGATCTTTATTCCAATAAAAGTGTTTGATTCCTAAGAAAGAAAATATT
TTTGTGGACATGCATAAAAATTAAATGGATTTCCTAGTGGAGTTTTATAAATTAAAAGGTCAAAACTGAAGCTTTTTATTTAGGCTTTTC
CAAATCAAGGATAAATATCTTACGCACGATATCTAGTGACAGAGGAGAAAGTGGAAAATGACCTCAAGGAAGCTACGGGCACAACTGGAA
GCTTTGTAGAAATTAAACATATTCAAGGAGCAAGAAATGAACTTTCAGCAGTCTAAATTTTCTAAATAACCAATAGTTGCCAATCTAAAA
TGGCAGAGAAGATGAAATTTGATAAACTGAATTTTTTTTAAAAATCCATTTACCCTACAGGTTTGCATTTGTTTGCTGAAATTTACCTTT
TTTTAGTTATATATATGTGTGTGTGTGTGTGTAATTTCTGCCAATAAATTCTAAATTACAAAGGTAAGAGAAAACCTAGTACATTACTAA
ATATATAAAGTATATGTTCTGATTATGTATACTTGTTCTAGTGTCAAGTCTTTTTAAGTGGGTTTTTAAAAGTTTGTTATTGGACTTGAA
TGGATTTTTGAGACTAGGTTAATTATTTTTGAGGTCTTATCCTAAAAGGCATCTAAGGTACATGAATGGAGTATGGTGATTTTATAACAT
TTTTTATCAGAATGGAAAAAGAACTGTTTAAAAGTTTGATACTTTTAAATAGTTGGTTTTTTTGCTTACTCTGGTAATGATTTTCTACAA
ATACATAATAAATTGTTTTTTTGAGTCTATATTCTGTATGCAGTTGAATATCCATTACTTATTCTGCTGTGCTTTAATAGAATGGAATGT
TTACAGGCCCTTAAAATATTATTTTTAAAAAACCTTCTGAAGATACATACCAAAGTTTTTCCAAGAAGATTTTATAATCAATTTAATAAT
GTAAGGTTTATCAGATTCTATAATAGTATAGTTATTAAGGCAATTTTATGTTAGAGACTATTTTGTAATGTAGTGAGTGGTACCTTTATA
AGAAAAGTGACTGCCAATATATTTTTATAGCTGATCTTTATAAATTCTAATGTTGAGTTTTTAATGATTATTTTAAATGTTTATATAGTT
TAGTAAAATTTGCATCTCAAAGTATCATTTTTATATTATGGGACGTTTTCAGATTGGCTAATATTTGCATTGTAAATTTTGTATGCAGTT
TATCTAAAATTCAAAAATACTGTCAGTACACCAGCGTTTAACATCTATATTCCAATTTGTATACAGTTTAAAATTGTACTGCAAAACTAT

>In-frame_EWSR1_ENST00000406548_chr22_29683123_+_ATF1_ENST00000262053_chr12_51207793_+_2688nt
GCGGCGCCTAGAGGGAAAGCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTA
TAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACA
AAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTC
TTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGA
TACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCA
GCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAA
CCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATC
CTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAG
CTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCA
AGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGATTGCCATTGCCCCAAATGGAGCCTTACAGTTGGCAAGTCCAGG
CACAGATGGAGTACAGGGACTTCAGACATTAACCATGACAAATTCAGGCAGTACTCAGCAAGGTACAACTATTCTTCAGTATGCACAGAC
CTCTGATGGACAGCAGATACTTGTGCCCAGCAATCAGGTGGTCGTACAAACTGCATCAGGAGATATGCAAACATATCAGATCCGAACTAC
ACCTTCAGCTACTTCTCTGCCACAAACTGTGGTGATGACATCTCCTGTGACTCTCACCTCTCAGACAACTAAGACAGATGACCCCCAATT
GAAAAGAGAAATAAGGTTAATGAAAAACAGAGAAGCTGCTCGAGAATGTCGCAGAAAGAAGAAAGAATATGTGAAATGCCTGGAAAACCG
AGTTGCAGTCCTGGAAAATCAAAATAAAACTCTAATAGAAGAGTTAAAAACTTTGAAGGATCTTTATTCCAATAAAAGTGTTTGATTCCT
AAGAAAGAAAATATTTTTGTGGACATGCATAAAAATTAAATGGATTTCCTAGTGGAGTTTTATAAATTAAAAGGTCAAAACTGAAGCTTT
TTATTTAGGCTTTTCCAAATCAAGGATAAATATCTTACGCACGATATCTAGTGACAGAGGAGAAAGTGGAAAATGACCTCAAGGAAGCTA
CGGGCACAACTGGAAGCTTTGTAGAAATTAAACATATTCAAGGAGCAAGAAATGAACTTTCAGCAGTCTAAATTTTCTAAATAACCAATA
GTTGCCAATCTAAAATGGCAGAGAAGATGAAATTTGATAAACTGAATTTTTTTTAAAAATCCATTTACCCTACAGGTTTGCATTTGTTTG
CTGAAATTTACCTTTTTTTAGTTATATATATGTGTGTGTGTGTGTGTAATTTCTGCCAATAAATTCTAAATTACAAAGGTAAGAGAAAAC
CTAGTACATTACTAAATATATAAAGTATATGTTCTGATTATGTATACTTGTTCTAGTGTCAAGTCTTTTTAAGTGGGTTTTTAAAAGTTT
GTTATTGGACTTGAATGGATTTTTGAGACTAGGTTAATTATTTTTGAGGTCTTATCCTAAAAGGCATCTAAGGTACATGAATGGAGTATG
GTGATTTTATAACATTTTTTATCAGAATGGAAAAAGAACTGTTTAAAAGTTTGATACTTTTAAATAGTTGGTTTTTTTGCTTACTCTGGT
AATGATTTTCTACAAATACATAATAAATTGTTTTTTTGAGTCTATATTCTGTATGCAGTTGAATATCCATTACTTATTCTGCTGTGCTTT
AATAGAATGGAATGTTTACAGGCCCTTAAAATATTATTTTTAAAAAACCTTCTGAAGATACATACCAAAGTTTTTCCAAGAAGATTTTAT
AATCAATTTAATAATGTAAGGTTTATCAGATTCTATAATAGTATAGTTATTAAGGCAATTTTATGTTAGAGACTATTTTGTAATGTAGTG
AGTGGTACCTTTATAAGAAAAGTGACTGCCAATATATTTTTATAGCTGATCTTTATAAATTCTAATGTTGAGTTTTTAATGATTATTTTA
AATGTTTATATAGTTTAGTAAAATTTGCATCTCAAAGTATCATTTTTATATTATGGGACGTTTTCAGATTGGCTAATATTTGCATTGTAA
ATTTTGTATGCAGTTTATCTAAAATTCAAAAATACTGTCAGTACACCAGCGTTTAACATCTATATTCCAATTTGTATACAGTTTAAAATT

>In-frame_EWSR1_ENST00000331029_chr22_29683123_+_ATF1_ENST00000262053_chr12_51207793_+_2670nt
GCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCA
GCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGG
ACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCAC
TGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGT
CACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGC
ACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATA
TGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTA
TTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAG
CTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAG
CCAACAGAGCAGCAGCTACGGGCAGCAGATTGCCATTGCCCCAAATGGAGCCTTACAGTTGGCAAGTCCAGGCACAGATGGAGTACAGGG
ACTTCAGACATTAACCATGACAAATTCAGGCAGTACTCAGCAAGGTACAACTATTCTTCAGTATGCACAGACCTCTGATGGACAGCAGAT
ACTTGTGCCCAGCAATCAGGTGGTCGTACAAACTGCATCAGGAGATATGCAAACATATCAGATCCGAACTACACCTTCAGCTACTTCTCT
GCCACAAACTGTGGTGATGACATCTCCTGTGACTCTCACCTCTCAGACAACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAGGTT
AATGAAAAACAGAGAAGCTGCTCGAGAATGTCGCAGAAAGAAGAAAGAATATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAA
TCAAAATAAAACTCTAATAGAAGAGTTAAAAACTTTGAAGGATCTTTATTCCAATAAAAGTGTTTGATTCCTAAGAAAGAAAATATTTTT
GTGGACATGCATAAAAATTAAATGGATTTCCTAGTGGAGTTTTATAAATTAAAAGGTCAAAACTGAAGCTTTTTATTTAGGCTTTTCCAA
ATCAAGGATAAATATCTTACGCACGATATCTAGTGACAGAGGAGAAAGTGGAAAATGACCTCAAGGAAGCTACGGGCACAACTGGAAGCT
TTGTAGAAATTAAACATATTCAAGGAGCAAGAAATGAACTTTCAGCAGTCTAAATTTTCTAAATAACCAATAGTTGCCAATCTAAAATGG
CAGAGAAGATGAAATTTGATAAACTGAATTTTTTTTAAAAATCCATTTACCCTACAGGTTTGCATTTGTTTGCTGAAATTTACCTTTTTT
TAGTTATATATATGTGTGTGTGTGTGTGTAATTTCTGCCAATAAATTCTAAATTACAAAGGTAAGAGAAAACCTAGTACATTACTAAATA
TATAAAGTATATGTTCTGATTATGTATACTTGTTCTAGTGTCAAGTCTTTTTAAGTGGGTTTTTAAAAGTTTGTTATTGGACTTGAATGG
ATTTTTGAGACTAGGTTAATTATTTTTGAGGTCTTATCCTAAAAGGCATCTAAGGTACATGAATGGAGTATGGTGATTTTATAACATTTT
TTATCAGAATGGAAAAAGAACTGTTTAAAAGTTTGATACTTTTAAATAGTTGGTTTTTTTGCTTACTCTGGTAATGATTTTCTACAAATA
CATAATAAATTGTTTTTTTGAGTCTATATTCTGTATGCAGTTGAATATCCATTACTTATTCTGCTGTGCTTTAATAGAATGGAATGTTTA
CAGGCCCTTAAAATATTATTTTTAAAAAACCTTCTGAAGATACATACCAAAGTTTTTCCAAGAAGATTTTATAATCAATTTAATAATGTA
AGGTTTATCAGATTCTATAATAGTATAGTTATTAAGGCAATTTTATGTTAGAGACTATTTTGTAATGTAGTGAGTGGTACCTTTATAAGA
AAAGTGACTGCCAATATATTTTTATAGCTGATCTTTATAAATTCTAATGTTGAGTTTTTAATGATTATTTTAAATGTTTATATAGTTTAG
TAAAATTTGCATCTCAAAGTATCATTTTTATATTATGGGACGTTTTCAGATTGGCTAATATTTGCATTGTAAATTTTGTATGCAGTTTAT
CTAAAATTCAAAAATACTGTCAGTACACCAGCGTTTAACATCTATATTCCAATTTGTATACAGTTTAAAATTGTACTGCAAAACTATTGT

>In-frame_EWSR1_ENST00000414183_chr22_29683123_+_ATF1_ENST00000262053_chr12_51207793_+_2663nt
AACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCC
CAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACC
CAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGTAGAAGGGACCAGTACAGGTTAT
ACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACC
ACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACA
AGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAG
AGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCT
ACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGT
CAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAG
AGCAGCAGCTACGGGCAGCAGATTGCCATTGCCCCAAATGGAGCCTTACAGTTGGCAAGTCCAGGCACAGATGGAGTACAGGGACTTCAG
ACATTAACCATGACAAATTCAGGCAGTACTCAGCAAGGTACAACTATTCTTCAGTATGCACAGACCTCTGATGGACAGCAGATACTTGTG
CCCAGCAATCAGGTGGTCGTACAAACTGCATCAGGAGATATGCAAACATATCAGATCCGAACTACACCTTCAGCTACTTCTCTGCCACAA
ACTGTGGTGATGACATCTCCTGTGACTCTCACCTCTCAGACAACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAGGTTAATGAAA
AACAGAGAAGCTGCTCGAGAATGTCGCAGAAAGAAGAAAGAATATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAATCAAAAT
AAAACTCTAATAGAAGAGTTAAAAACTTTGAAGGATCTTTATTCCAATAAAAGTGTTTGATTCCTAAGAAAGAAAATATTTTTGTGGACA
TGCATAAAAATTAAATGGATTTCCTAGTGGAGTTTTATAAATTAAAAGGTCAAAACTGAAGCTTTTTATTTAGGCTTTTCCAAATCAAGG
ATAAATATCTTACGCACGATATCTAGTGACAGAGGAGAAAGTGGAAAATGACCTCAAGGAAGCTACGGGCACAACTGGAAGCTTTGTAGA
AATTAAACATATTCAAGGAGCAAGAAATGAACTTTCAGCAGTCTAAATTTTCTAAATAACCAATAGTTGCCAATCTAAAATGGCAGAGAA
GATGAAATTTGATAAACTGAATTTTTTTTAAAAATCCATTTACCCTACAGGTTTGCATTTGTTTGCTGAAATTTACCTTTTTTTAGTTAT
ATATATGTGTGTGTGTGTGTGTAATTTCTGCCAATAAATTCTAAATTACAAAGGTAAGAGAAAACCTAGTACATTACTAAATATATAAAG
TATATGTTCTGATTATGTATACTTGTTCTAGTGTCAAGTCTTTTTAAGTGGGTTTTTAAAAGTTTGTTATTGGACTTGAATGGATTTTTG
AGACTAGGTTAATTATTTTTGAGGTCTTATCCTAAAAGGCATCTAAGGTACATGAATGGAGTATGGTGATTTTATAACATTTTTTATCAG
AATGGAAAAAGAACTGTTTAAAAGTTTGATACTTTTAAATAGTTGGTTTTTTTGCTTACTCTGGTAATGATTTTCTACAAATACATAATA
AATTGTTTTTTTGAGTCTATATTCTGTATGCAGTTGAATATCCATTACTTATTCTGCTGTGCTTTAATAGAATGGAATGTTTACAGGCCC
TTAAAATATTATTTTTAAAAAACCTTCTGAAGATACATACCAAAGTTTTTCCAAGAAGATTTTATAATCAATTTAATAATGTAAGGTTTA
TCAGATTCTATAATAGTATAGTTATTAAGGCAATTTTATGTTAGAGACTATTTTGTAATGTAGTGAGTGGTACCTTTATAAGAAAAGTGA
CTGCCAATATATTTTTATAGCTGATCTTTATAAATTCTAATGTTGAGTTTTTAATGATTATTTTAAATGTTTATATAGTTTAGTAAAATT
TGCATCTCAAAGTATCATTTTTATATTATGGGACGTTTTCAGATTGGCTAATATTTGCATTGTAAATTTTGTATGCAGTTTATCTAAAAT
TCAAAAATACTGTCAGTACACCAGCGTTTAACATCTATATTCCAATTTGTATACAGTTTAAAATTGTACTGCAAAACTATTGTGTGCTCT

>In-frame_EWSR1_ENST00000333395_chr22_29683123_+_ATF1_ENST00000262053_chr12_51207793_+_2643nt
CGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCA
GCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCA
GGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCA
GGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGC
TCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAA
GCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCA
GGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGA
TCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCA
GCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCA
GATTGCCATTGCCCCAAATGGAGCCTTACAGTTGGCAAGTCCAGGCACAGATGGAGTACAGGGACTTCAGACATTAACCATGACAAATTC
AGGCAGTACTCAGCAAGGTACAACTATTCTTCAGTATGCACAGACCTCTGATGGACAGCAGATACTTGTGCCCAGCAATCAGGTGGTCGT
ACAAACTGCATCAGGAGATATGCAAACATATCAGATCCGAACTACACCTTCAGCTACTTCTCTGCCACAAACTGTGGTGATGACATCTCC
TGTGACTCTCACCTCTCAGACAACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAGGTTAATGAAAAACAGAGAAGCTGCTCGAGA
ATGTCGCAGAAAGAAGAAAGAATATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAATCAAAATAAAACTCTAATAGAAGAGTT
AAAAACTTTGAAGGATCTTTATTCCAATAAAAGTGTTTGATTCCTAAGAAAGAAAATATTTTTGTGGACATGCATAAAAATTAAATGGAT
TTCCTAGTGGAGTTTTATAAATTAAAAGGTCAAAACTGAAGCTTTTTATTTAGGCTTTTCCAAATCAAGGATAAATATCTTACGCACGAT
ATCTAGTGACAGAGGAGAAAGTGGAAAATGACCTCAAGGAAGCTACGGGCACAACTGGAAGCTTTGTAGAAATTAAACATATTCAAGGAG
CAAGAAATGAACTTTCAGCAGTCTAAATTTTCTAAATAACCAATAGTTGCCAATCTAAAATGGCAGAGAAGATGAAATTTGATAAACTGA
ATTTTTTTTAAAAATCCATTTACCCTACAGGTTTGCATTTGTTTGCTGAAATTTACCTTTTTTTAGTTATATATATGTGTGTGTGTGTGT
GTAATTTCTGCCAATAAATTCTAAATTACAAAGGTAAGAGAAAACCTAGTACATTACTAAATATATAAAGTATATGTTCTGATTATGTAT
ACTTGTTCTAGTGTCAAGTCTTTTTAAGTGGGTTTTTAAAAGTTTGTTATTGGACTTGAATGGATTTTTGAGACTAGGTTAATTATTTTT
GAGGTCTTATCCTAAAAGGCATCTAAGGTACATGAATGGAGTATGGTGATTTTATAACATTTTTTATCAGAATGGAAAAAGAACTGTTTA
AAAGTTTGATACTTTTAAATAGTTGGTTTTTTTGCTTACTCTGGTAATGATTTTCTACAAATACATAATAAATTGTTTTTTTGAGTCTAT
ATTCTGTATGCAGTTGAATATCCATTACTTATTCTGCTGTGCTTTAATAGAATGGAATGTTTACAGGCCCTTAAAATATTATTTTTAAAA
AACCTTCTGAAGATACATACCAAAGTTTTTCCAAGAAGATTTTATAATCAATTTAATAATGTAAGGTTTATCAGATTCTATAATAGTATA
GTTATTAAGGCAATTTTATGTTAGAGACTATTTTGTAATGTAGTGAGTGGTACCTTTATAAGAAAAGTGACTGCCAATATATTTTTATAG
CTGATCTTTATAAATTCTAATGTTGAGTTTTTAATGATTATTTTAAATGTTTATATAGTTTAGTAAAATTTGCATCTCAAAGTATCATTT
TTATATTATGGGACGTTTTCAGATTGGCTAATATTTGCATTGTAAATTTTGTATGCAGTTTATCTAAAATTCAAAAATACTGTCAGTACA
CCAGCGTTTAACATCTATATTCCAATTTGTATACAGTTTAAAATTGTACTGCAAAACTATTGTGTGCTCTTACACAGTATGCATCATATT

>In-frame_EWSR1_ENST00000332035_chr22_29683123_+_ATF1_ENST00000262053_chr12_51207793_+_2467nt
AAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTC
AAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGA
CCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACA
GCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTG
CATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGCTATTCCTCTACACAGCCGACTAGTT
ATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATG
GGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGC
AGCAGATTGCCATTGCCCCAAATGGAGCCTTACAGTTGGCAAGTCCAGGCACAGATGGAGTACAGGGACTTCAGACATTAACCATGACAA
ATTCAGGCAGTACTCAGCAAGGTACAACTATTCTTCAGTATGCACAGACCTCTGATGGACAGCAGATACTTGTGCCCAGCAATCAGGTGG
TCGTACAAACTGCATCAGGAGATATGCAAACATATCAGATCCGAACTACACCTTCAGCTACTTCTCTGCCACAAACTGTGGTGATGACAT
CTCCTGTGACTCTCACCTCTCAGACAACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAGGTTAATGAAAAACAGAGAAGCTGCTC
GAGAATGTCGCAGAAAGAAGAAAGAATATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAATCAAAATAAAACTCTAATAGAAG
AGTTAAAAACTTTGAAGGATCTTTATTCCAATAAAAGTGTTTGATTCCTAAGAAAGAAAATATTTTTGTGGACATGCATAAAAATTAAAT
GGATTTCCTAGTGGAGTTTTATAAATTAAAAGGTCAAAACTGAAGCTTTTTATTTAGGCTTTTCCAAATCAAGGATAAATATCTTACGCA
CGATATCTAGTGACAGAGGAGAAAGTGGAAAATGACCTCAAGGAAGCTACGGGCACAACTGGAAGCTTTGTAGAAATTAAACATATTCAA
GGAGCAAGAAATGAACTTTCAGCAGTCTAAATTTTCTAAATAACCAATAGTTGCCAATCTAAAATGGCAGAGAAGATGAAATTTGATAAA
CTGAATTTTTTTTAAAAATCCATTTACCCTACAGGTTTGCATTTGTTTGCTGAAATTTACCTTTTTTTAGTTATATATATGTGTGTGTGT
GTGTGTAATTTCTGCCAATAAATTCTAAATTACAAAGGTAAGAGAAAACCTAGTACATTACTAAATATATAAAGTATATGTTCTGATTAT
GTATACTTGTTCTAGTGTCAAGTCTTTTTAAGTGGGTTTTTAAAAGTTTGTTATTGGACTTGAATGGATTTTTGAGACTAGGTTAATTAT
TTTTGAGGTCTTATCCTAAAAGGCATCTAAGGTACATGAATGGAGTATGGTGATTTTATAACATTTTTTATCAGAATGGAAAAAGAACTG
TTTAAAAGTTTGATACTTTTAAATAGTTGGTTTTTTTGCTTACTCTGGTAATGATTTTCTACAAATACATAATAAATTGTTTTTTTGAGT
CTATATTCTGTATGCAGTTGAATATCCATTACTTATTCTGCTGTGCTTTAATAGAATGGAATGTTTACAGGCCCTTAAAATATTATTTTT
AAAAAACCTTCTGAAGATACATACCAAAGTTTTTCCAAGAAGATTTTATAATCAATTTAATAATGTAAGGTTTATCAGATTCTATAATAG
TATAGTTATTAAGGCAATTTTATGTTAGAGACTATTTTGTAATGTAGTGAGTGGTACCTTTATAAGAAAAGTGACTGCCAATATATTTTT
ATAGCTGATCTTTATAAATTCTAATGTTGAGTTTTTAATGATTATTTTAAATGTTTATATAGTTTAGTAAAATTTGCATCTCAAAGTATC
ATTTTTATATTATGGGACGTTTTCAGATTGGCTAATATTTGCATTGTAAATTTTGTATGCAGTTTATCTAAAATTCAAAAATACTGTCAG
TACACCAGCGTTTAACATCTATATTCCAATTTGTATACAGTTTAAAATTGTACTGCAAAACTATTGTGTGCTCTTACACAGTATGCATCA

>In-frame_EWSR1_ENST00000332050_chr22_29683123_+_ATF1_ENST00000262053_chr12_51208063_+_2769nt
AGAGCCAGCGGACGGAACCATTCCAAACAGCCTAGTCTCGTGCTGAGAGCCTCTCCGGTTTCACGCTGAGACCCGCTCACCCCCGCTCTG
GCCCCTTAGATGCTATTTTGGCCCGAGTGTCACGTCGGGCGCTCTTTAGAGAGGACTGGGACAAGAGTTGCGGACGCGAAGAACGAGTAA
GCGGTGGTTCATCCCTCCTGACCCCACCCCCGTGGCCTGGCCCGATGGTCGCGCCCGGGGTTGCGAGATTTGCGCCTGCGCAGTGCGGCG
CCTAGAGGGAAAGCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCA
AGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTA
TGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGG
ACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCAC
CACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCC
AGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCC
CAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCC
TCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGG
ACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCC
AAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGACTGCATCAGGAGATATGCAAACATATCAGATCCGAACTACACCTTCAGC
TACTTCTCTGCCACAAACTGTGGTGATGACATCTCCTGTGACTCTCACCTCTCAGACAACTAAGACAGATGACCCCCAATTGAAAAGAGA
AATAAGGTTAATGAAAAACAGAGAAGCTGCTCGAGAATGTCGCAGAAAGAAGAAAGAATATGTGAAATGCCTGGAAAACCGAGTTGCAGT
CCTGGAAAATCAAAATAAAACTCTAATAGAAGAGTTAAAAACTTTGAAGGATCTTTATTCCAATAAAAGTGTTTGATTCCTAAGAAAGAA
AATATTTTTGTGGACATGCATAAAAATTAAATGGATTTCCTAGTGGAGTTTTATAAATTAAAAGGTCAAAACTGAAGCTTTTTATTTAGG
CTTTTCCAAATCAAGGATAAATATCTTACGCACGATATCTAGTGACAGAGGAGAAAGTGGAAAATGACCTCAAGGAAGCTACGGGCACAA
CTGGAAGCTTTGTAGAAATTAAACATATTCAAGGAGCAAGAAATGAACTTTCAGCAGTCTAAATTTTCTAAATAACCAATAGTTGCCAAT
CTAAAATGGCAGAGAAGATGAAATTTGATAAACTGAATTTTTTTTAAAAATCCATTTACCCTACAGGTTTGCATTTGTTTGCTGAAATTT
ACCTTTTTTTAGTTATATATATGTGTGTGTGTGTGTGTAATTTCTGCCAATAAATTCTAAATTACAAAGGTAAGAGAAAACCTAGTACAT
TACTAAATATATAAAGTATATGTTCTGATTATGTATACTTGTTCTAGTGTCAAGTCTTTTTAAGTGGGTTTTTAAAAGTTTGTTATTGGA
CTTGAATGGATTTTTGAGACTAGGTTAATTATTTTTGAGGTCTTATCCTAAAAGGCATCTAAGGTACATGAATGGAGTATGGTGATTTTA
TAACATTTTTTATCAGAATGGAAAAAGAACTGTTTAAAAGTTTGATACTTTTAAATAGTTGGTTTTTTTGCTTACTCTGGTAATGATTTT
CTACAAATACATAATAAATTGTTTTTTTGAGTCTATATTCTGTATGCAGTTGAATATCCATTACTTATTCTGCTGTGCTTTAATAGAATG
GAATGTTTACAGGCCCTTAAAATATTATTTTTAAAAAACCTTCTGAAGATACATACCAAAGTTTTTCCAAGAAGATTTTATAATCAATTT
AATAATGTAAGGTTTATCAGATTCTATAATAGTATAGTTATTAAGGCAATTTTATGTTAGAGACTATTTTGTAATGTAGTGAGTGGTACC
TTTATAAGAAAAGTGACTGCCAATATATTTTTATAGCTGATCTTTATAAATTCTAATGTTGAGTTTTTAATGATTATTTTAAATGTTTAT
ATAGTTTAGTAAAATTTGCATCTCAAAGTATCATTTTTATATTATGGGACGTTTTCAGATTGGCTAATATTTGCATTGTAAATTTTGTAT
GCAGTTTATCTAAAATTCAAAAATACTGTCAGTACACCAGCGTTTAACATCTATATTCCAATTTGTATACAGTTTAAAATTGTACTGCAA

>In-frame_EWSR1_ENST00000332050_chr22_29683123_+_ATF1_ENST00000539132_chr12_51208063_+_1657nt
AGAGCCAGCGGACGGAACCATTCCAAACAGCCTAGTCTCGTGCTGAGAGCCTCTCCGGTTTCACGCTGAGACCCGCTCACCCCCGCTCTG
GCCCCTTAGATGCTATTTTGGCCCGAGTGTCACGTCGGGCGCTCTTTAGAGAGGACTGGGACAAGAGTTGCGGACGCGAAGAACGAGTAA
GCGGTGGTTCATCCCTCCTGACCCCACCCCCGTGGCCTGGCCCGATGGTCGCGCCCGGGGTTGCGAGATTTGCGCCTGCGCAGTGCGGCG
CCTAGAGGGAAAGCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCA
AGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTA
TGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGG
ACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCAC
CACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCC
AGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCC
CAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCC
TCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGG
ACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCC
AAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGACTGCATCAGGAGATATGCAAACATATCAGATCCGAACTACACCTTCAGC
TACTTCTCTGCCACAAACTGTGGTGATGACATCTCCTGTGACTCTCACCTCTCAGACAACTAAGACAGATGACCCCCAATTGAAAAGAGA
AATAAGGTTAATGAAAAACAGAGAAGCTGCTCGAGAATGTCGCAGAAAGAAGAAAGAATATGTGAAATGCCTGGAAAACCGAGTTGCAGT
CCTGGAAAATCAAAATAAAACTCTAATAGAAGAGTTAAAAACTTTGAAGGATCTTTATTCCAATAAAAGTGTTTGATTCCTAAGAAAGAA
AATATTTTTGTGGACATGCATAAAAATTAAATGGATTTCCTAGTGGAGTTTTATAAATTAAAAGGTCAAAACTGAAGCTTTTTATTTAGG
CTTTTCCAAATCAAGGATAAATATCTTACGCACGATATCTAGTGACAGAGGAGAAAGTGGAAAATGACCTCAAGGAAGCTACGGGCACAA

>In-frame_EWSR1_ENST00000397938_chr22_29683123_+_ATF1_ENST00000262053_chr12_51208063_+_2760nt
GGACGGAACCATTCCAAACAGCCTAGTCTCGTGCTGAGAGCCTCTCCGGTTTCACGCTGAGACCCGCTCACCCCCGCTCTGGCCCCTTAG
ATGCTATTTTGGCCCGAGTGTCACGTCGGGCGCTCTTTAGAGAGGACTGGGACAAGAGTTGCGGACGCGAAGAACGAGTAAGCGGTGGTT
CATCCCTCCTGACCCCACCCCCGTGGCCTGGCCCGATGGTCGCGCCCGGGGTTGCGAGATTTGCGCCTGCGCAGTGCGGCGCCTAGAGGG
AAAGCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGC
GCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTA
TGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCC
CACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTAC
AGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCAC
TGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGG
ATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAG
CTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAG
TAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATA
TAGCCAACAGAGCAGCAGCTACGGGCAGCAGACTGCATCAGGAGATATGCAAACATATCAGATCCGAACTACACCTTCAGCTACTTCTCT
GCCACAAACTGTGGTGATGACATCTCCTGTGACTCTCACCTCTCAGACAACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAGGTT
AATGAAAAACAGAGAAGCTGCTCGAGAATGTCGCAGAAAGAAGAAAGAATATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAA
TCAAAATAAAACTCTAATAGAAGAGTTAAAAACTTTGAAGGATCTTTATTCCAATAAAAGTGTTTGATTCCTAAGAAAGAAAATATTTTT
GTGGACATGCATAAAAATTAAATGGATTTCCTAGTGGAGTTTTATAAATTAAAAGGTCAAAACTGAAGCTTTTTATTTAGGCTTTTCCAA
ATCAAGGATAAATATCTTACGCACGATATCTAGTGACAGAGGAGAAAGTGGAAAATGACCTCAAGGAAGCTACGGGCACAACTGGAAGCT
TTGTAGAAATTAAACATATTCAAGGAGCAAGAAATGAACTTTCAGCAGTCTAAATTTTCTAAATAACCAATAGTTGCCAATCTAAAATGG
CAGAGAAGATGAAATTTGATAAACTGAATTTTTTTTAAAAATCCATTTACCCTACAGGTTTGCATTTGTTTGCTGAAATTTACCTTTTTT
TAGTTATATATATGTGTGTGTGTGTGTGTAATTTCTGCCAATAAATTCTAAATTACAAAGGTAAGAGAAAACCTAGTACATTACTAAATA
TATAAAGTATATGTTCTGATTATGTATACTTGTTCTAGTGTCAAGTCTTTTTAAGTGGGTTTTTAAAAGTTTGTTATTGGACTTGAATGG
ATTTTTGAGACTAGGTTAATTATTTTTGAGGTCTTATCCTAAAAGGCATCTAAGGTACATGAATGGAGTATGGTGATTTTATAACATTTT
TTATCAGAATGGAAAAAGAACTGTTTAAAAGTTTGATACTTTTAAATAGTTGGTTTTTTTGCTTACTCTGGTAATGATTTTCTACAAATA
CATAATAAATTGTTTTTTTGAGTCTATATTCTGTATGCAGTTGAATATCCATTACTTATTCTGCTGTGCTTTAATAGAATGGAATGTTTA
CAGGCCCTTAAAATATTATTTTTAAAAAACCTTCTGAAGATACATACCAAAGTTTTTCCAAGAAGATTTTATAATCAATTTAATAATGTA
AGGTTTATCAGATTCTATAATAGTATAGTTATTAAGGCAATTTTATGTTAGAGACTATTTTGTAATGTAGTGAGTGGTACCTTTATAAGA
AAAGTGACTGCCAATATATTTTTATAGCTGATCTTTATAAATTCTAATGTTGAGTTTTTAATGATTATTTTAAATGTTTATATAGTTTAG
TAAAATTTGCATCTCAAAGTATCATTTTTATATTATGGGACGTTTTCAGATTGGCTAATATTTGCATTGTAAATTTTGTATGCAGTTTAT
CTAAAATTCAAAAATACTGTCAGTACACCAGCGTTTAACATCTATATTCCAATTTGTATACAGTTTAAAATTGTACTGCAAAACTATTGT

>In-frame_EWSR1_ENST00000397938_chr22_29683123_+_ATF1_ENST00000539132_chr12_51208063_+_1648nt
GGACGGAACCATTCCAAACAGCCTAGTCTCGTGCTGAGAGCCTCTCCGGTTTCACGCTGAGACCCGCTCACCCCCGCTCTGGCCCCTTAG
ATGCTATTTTGGCCCGAGTGTCACGTCGGGCGCTCTTTAGAGAGGACTGGGACAAGAGTTGCGGACGCGAAGAACGAGTAAGCGGTGGTT
CATCCCTCCTGACCCCACCCCCGTGGCCTGGCCCGATGGTCGCGCCCGGGGTTGCGAGATTTGCGCCTGCGCAGTGCGGCGCCTAGAGGG
AAAGCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGC
GCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTA
TGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCC
CACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTAC
AGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCAC
TGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGG
ATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAG
CTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAG
TAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATA
TAGCCAACAGAGCAGCAGCTACGGGCAGCAGACTGCATCAGGAGATATGCAAACATATCAGATCCGAACTACACCTTCAGCTACTTCTCT
GCCACAAACTGTGGTGATGACATCTCCTGTGACTCTCACCTCTCAGACAACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAGGTT
AATGAAAAACAGAGAAGCTGCTCGAGAATGTCGCAGAAAGAAGAAAGAATATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAA
TCAAAATAAAACTCTAATAGAAGAGTTAAAAACTTTGAAGGATCTTTATTCCAATAAAAGTGTTTGATTCCTAAGAAAGAAAATATTTTT
GTGGACATGCATAAAAATTAAATGGATTTCCTAGTGGAGTTTTATAAATTAAAAGGTCAAAACTGAAGCTTTTTATTTAGGCTTTTCCAA
ATCAAGGATAAATATCTTACGCACGATATCTAGTGACAGAGGAGAAAGTGGAAAATGACCTCAAGGAAGCTACGGGCACAACTGGAAGCT

>In-frame_EWSR1_ENST00000406548_chr22_29683123_+_ATF1_ENST00000262053_chr12_51208063_+_2505nt
GCGGCGCCTAGAGGGAAAGCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTA
TAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACA
AAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTC
TTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGA
TACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCA
GCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAA
CCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATC
CTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAG
CTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCA
AGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGACTGCATCAGGAGATATGCAAACATATCAGATCCGAACTACACC
TTCAGCTACTTCTCTGCCACAAACTGTGGTGATGACATCTCCTGTGACTCTCACCTCTCAGACAACTAAGACAGATGACCCCCAATTGAA
AAGAGAAATAAGGTTAATGAAAAACAGAGAAGCTGCTCGAGAATGTCGCAGAAAGAAGAAAGAATATGTGAAATGCCTGGAAAACCGAGT
TGCAGTCCTGGAAAATCAAAATAAAACTCTAATAGAAGAGTTAAAAACTTTGAAGGATCTTTATTCCAATAAAAGTGTTTGATTCCTAAG
AAAGAAAATATTTTTGTGGACATGCATAAAAATTAAATGGATTTCCTAGTGGAGTTTTATAAATTAAAAGGTCAAAACTGAAGCTTTTTA
TTTAGGCTTTTCCAAATCAAGGATAAATATCTTACGCACGATATCTAGTGACAGAGGAGAAAGTGGAAAATGACCTCAAGGAAGCTACGG
GCACAACTGGAAGCTTTGTAGAAATTAAACATATTCAAGGAGCAAGAAATGAACTTTCAGCAGTCTAAATTTTCTAAATAACCAATAGTT
GCCAATCTAAAATGGCAGAGAAGATGAAATTTGATAAACTGAATTTTTTTTAAAAATCCATTTACCCTACAGGTTTGCATTTGTTTGCTG
AAATTTACCTTTTTTTAGTTATATATATGTGTGTGTGTGTGTGTAATTTCTGCCAATAAATTCTAAATTACAAAGGTAAGAGAAAACCTA
GTACATTACTAAATATATAAAGTATATGTTCTGATTATGTATACTTGTTCTAGTGTCAAGTCTTTTTAAGTGGGTTTTTAAAAGTTTGTT
ATTGGACTTGAATGGATTTTTGAGACTAGGTTAATTATTTTTGAGGTCTTATCCTAAAAGGCATCTAAGGTACATGAATGGAGTATGGTG
ATTTTATAACATTTTTTATCAGAATGGAAAAAGAACTGTTTAAAAGTTTGATACTTTTAAATAGTTGGTTTTTTTGCTTACTCTGGTAAT
GATTTTCTACAAATACATAATAAATTGTTTTTTTGAGTCTATATTCTGTATGCAGTTGAATATCCATTACTTATTCTGCTGTGCTTTAAT
AGAATGGAATGTTTACAGGCCCTTAAAATATTATTTTTAAAAAACCTTCTGAAGATACATACCAAAGTTTTTCCAAGAAGATTTTATAAT
CAATTTAATAATGTAAGGTTTATCAGATTCTATAATAGTATAGTTATTAAGGCAATTTTATGTTAGAGACTATTTTGTAATGTAGTGAGT
GGTACCTTTATAAGAAAAGTGACTGCCAATATATTTTTATAGCTGATCTTTATAAATTCTAATGTTGAGTTTTTAATGATTATTTTAAAT
GTTTATATAGTTTAGTAAAATTTGCATCTCAAAGTATCATTTTTATATTATGGGACGTTTTCAGATTGGCTAATATTTGCATTGTAAATT
TTGTATGCAGTTTATCTAAAATTCAAAAATACTGTCAGTACACCAGCGTTTAACATCTATATTCCAATTTGTATACAGTTTAAAATTGTA

>In-frame_EWSR1_ENST00000406548_chr22_29683123_+_ATF1_ENST00000539132_chr12_51208063_+_1393nt
GCGGCGCCTAGAGGGAAAGCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTA
TAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACA
AAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTC
TTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGA
TACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCA
GCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAA
CCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATC
CTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAG
CTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCA
AGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCAGACTGCATCAGGAGATATGCAAACATATCAGATCCGAACTACACC
TTCAGCTACTTCTCTGCCACAAACTGTGGTGATGACATCTCCTGTGACTCTCACCTCTCAGACAACTAAGACAGATGACCCCCAATTGAA
AAGAGAAATAAGGTTAATGAAAAACAGAGAAGCTGCTCGAGAATGTCGCAGAAAGAAGAAAGAATATGTGAAATGCCTGGAAAACCGAGT
TGCAGTCCTGGAAAATCAAAATAAAACTCTAATAGAAGAGTTAAAAACTTTGAAGGATCTTTATTCCAATAAAAGTGTTTGATTCCTAAG
AAAGAAAATATTTTTGTGGACATGCATAAAAATTAAATGGATTTCCTAGTGGAGTTTTATAAATTAAAAGGTCAAAACTGAAGCTTTTTA
TTTAGGCTTTTCCAAATCAAGGATAAATATCTTACGCACGATATCTAGTGACAGAGGAGAAAGTGGAAAATGACCTCAAGGAAGCTACGG

>In-frame_EWSR1_ENST00000331029_chr22_29683123_+_ATF1_ENST00000262053_chr12_51208063_+_2487nt
GCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCA
GCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGG
ACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCAC
TGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGT
CACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGC
ACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATA
TGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTA
TTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAG
CTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAG
CCAACAGAGCAGCAGCTACGGGCAGCAGACTGCATCAGGAGATATGCAAACATATCAGATCCGAACTACACCTTCAGCTACTTCTCTGCC
ACAAACTGTGGTGATGACATCTCCTGTGACTCTCACCTCTCAGACAACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAGGTTAAT
GAAAAACAGAGAAGCTGCTCGAGAATGTCGCAGAAAGAAGAAAGAATATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAATCA
AAATAAAACTCTAATAGAAGAGTTAAAAACTTTGAAGGATCTTTATTCCAATAAAAGTGTTTGATTCCTAAGAAAGAAAATATTTTTGTG
GACATGCATAAAAATTAAATGGATTTCCTAGTGGAGTTTTATAAATTAAAAGGTCAAAACTGAAGCTTTTTATTTAGGCTTTTCCAAATC
AAGGATAAATATCTTACGCACGATATCTAGTGACAGAGGAGAAAGTGGAAAATGACCTCAAGGAAGCTACGGGCACAACTGGAAGCTTTG
TAGAAATTAAACATATTCAAGGAGCAAGAAATGAACTTTCAGCAGTCTAAATTTTCTAAATAACCAATAGTTGCCAATCTAAAATGGCAG
AGAAGATGAAATTTGATAAACTGAATTTTTTTTAAAAATCCATTTACCCTACAGGTTTGCATTTGTTTGCTGAAATTTACCTTTTTTTAG
TTATATATATGTGTGTGTGTGTGTGTAATTTCTGCCAATAAATTCTAAATTACAAAGGTAAGAGAAAACCTAGTACATTACTAAATATAT
AAAGTATATGTTCTGATTATGTATACTTGTTCTAGTGTCAAGTCTTTTTAAGTGGGTTTTTAAAAGTTTGTTATTGGACTTGAATGGATT
TTTGAGACTAGGTTAATTATTTTTGAGGTCTTATCCTAAAAGGCATCTAAGGTACATGAATGGAGTATGGTGATTTTATAACATTTTTTA
TCAGAATGGAAAAAGAACTGTTTAAAAGTTTGATACTTTTAAATAGTTGGTTTTTTTGCTTACTCTGGTAATGATTTTCTACAAATACAT
AATAAATTGTTTTTTTGAGTCTATATTCTGTATGCAGTTGAATATCCATTACTTATTCTGCTGTGCTTTAATAGAATGGAATGTTTACAG
GCCCTTAAAATATTATTTTTAAAAAACCTTCTGAAGATACATACCAAAGTTTTTCCAAGAAGATTTTATAATCAATTTAATAATGTAAGG
TTTATCAGATTCTATAATAGTATAGTTATTAAGGCAATTTTATGTTAGAGACTATTTTGTAATGTAGTGAGTGGTACCTTTATAAGAAAA
GTGACTGCCAATATATTTTTATAGCTGATCTTTATAAATTCTAATGTTGAGTTTTTAATGATTATTTTAAATGTTTATATAGTTTAGTAA
AATTTGCATCTCAAAGTATCATTTTTATATTATGGGACGTTTTCAGATTGGCTAATATTTGCATTGTAAATTTTGTATGCAGTTTATCTA
AAATTCAAAAATACTGTCAGTACACCAGCGTTTAACATCTATATTCCAATTTGTATACAGTTTAAAATTGTACTGCAAAACTATTGTGTG

>In-frame_EWSR1_ENST00000331029_chr22_29683123_+_ATF1_ENST00000539132_chr12_51208063_+_1375nt
GCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCA
GCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGG
ACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCAC
TGGTTATACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGT
CACCACCACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGC
ACCTACAAGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATA
TGGACAGAGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTA
TTCCTCTACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAG
CTATGGTCAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAG
CCAACAGAGCAGCAGCTACGGGCAGCAGACTGCATCAGGAGATATGCAAACATATCAGATCCGAACTACACCTTCAGCTACTTCTCTGCC
ACAAACTGTGGTGATGACATCTCCTGTGACTCTCACCTCTCAGACAACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAGGTTAAT
GAAAAACAGAGAAGCTGCTCGAGAATGTCGCAGAAAGAAGAAAGAATATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAATCA
AAATAAAACTCTAATAGAAGAGTTAAAAACTTTGAAGGATCTTTATTCCAATAAAAGTGTTTGATTCCTAAGAAAGAAAATATTTTTGTG
GACATGCATAAAAATTAAATGGATTTCCTAGTGGAGTTTTATAAATTAAAAGGTCAAAACTGAAGCTTTTTATTTAGGCTTTTCCAAATC
AAGGATAAATATCTTACGCACGATATCTAGTGACAGAGGAGAAAGTGGAAAATGACCTCAAGGAAGCTACGGGCACAACTGGAAGCTTTG

>In-frame_EWSR1_ENST00000414183_chr22_29683123_+_ATF1_ENST00000262053_chr12_51208063_+_2480nt
AACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCC
CAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACC
CAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGTAGAAGGGACCAGTACAGGTTAT
ACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACC
ACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACA
AGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAG
AGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCT
ACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGT
CAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAG
AGCAGCAGCTACGGGCAGCAGACTGCATCAGGAGATATGCAAACATATCAGATCCGAACTACACCTTCAGCTACTTCTCTGCCACAAACT
GTGGTGATGACATCTCCTGTGACTCTCACCTCTCAGACAACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAGGTTAATGAAAAAC
AGAGAAGCTGCTCGAGAATGTCGCAGAAAGAAGAAAGAATATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAATCAAAATAAA
ACTCTAATAGAAGAGTTAAAAACTTTGAAGGATCTTTATTCCAATAAAAGTGTTTGATTCCTAAGAAAGAAAATATTTTTGTGGACATGC
ATAAAAATTAAATGGATTTCCTAGTGGAGTTTTATAAATTAAAAGGTCAAAACTGAAGCTTTTTATTTAGGCTTTTCCAAATCAAGGATA
AATATCTTACGCACGATATCTAGTGACAGAGGAGAAAGTGGAAAATGACCTCAAGGAAGCTACGGGCACAACTGGAAGCTTTGTAGAAAT
TAAACATATTCAAGGAGCAAGAAATGAACTTTCAGCAGTCTAAATTTTCTAAATAACCAATAGTTGCCAATCTAAAATGGCAGAGAAGAT
GAAATTTGATAAACTGAATTTTTTTTAAAAATCCATTTACCCTACAGGTTTGCATTTGTTTGCTGAAATTTACCTTTTTTTAGTTATATA
TATGTGTGTGTGTGTGTGTAATTTCTGCCAATAAATTCTAAATTACAAAGGTAAGAGAAAACCTAGTACATTACTAAATATATAAAGTAT
ATGTTCTGATTATGTATACTTGTTCTAGTGTCAAGTCTTTTTAAGTGGGTTTTTAAAAGTTTGTTATTGGACTTGAATGGATTTTTGAGA
CTAGGTTAATTATTTTTGAGGTCTTATCCTAAAAGGCATCTAAGGTACATGAATGGAGTATGGTGATTTTATAACATTTTTTATCAGAAT
GGAAAAAGAACTGTTTAAAAGTTTGATACTTTTAAATAGTTGGTTTTTTTGCTTACTCTGGTAATGATTTTCTACAAATACATAATAAAT
TGTTTTTTTGAGTCTATATTCTGTATGCAGTTGAATATCCATTACTTATTCTGCTGTGCTTTAATAGAATGGAATGTTTACAGGCCCTTA
AAATATTATTTTTAAAAAACCTTCTGAAGATACATACCAAAGTTTTTCCAAGAAGATTTTATAATCAATTTAATAATGTAAGGTTTATCA
GATTCTATAATAGTATAGTTATTAAGGCAATTTTATGTTAGAGACTATTTTGTAATGTAGTGAGTGGTACCTTTATAAGAAAAGTGACTG
CCAATATATTTTTATAGCTGATCTTTATAAATTCTAATGTTGAGTTTTTAATGATTATTTTAAATGTTTATATAGTTTAGTAAAATTTGC
ATCTCAAAGTATCATTTTTATATTATGGGACGTTTTCAGATTGGCTAATATTTGCATTGTAAATTTTGTATGCAGTTTATCTAAAATTCA
AAAATACTGTCAGTACACCAGCGTTTAACATCTATATTCCAATTTGTATACAGTTTAAAATTGTACTGCAAAACTATTGTGTGCTCTTAC

>In-frame_EWSR1_ENST00000414183_chr22_29683123_+_ATF1_ENST00000539132_chr12_51208063_+_1368nt
AACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCC
CAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACC
CAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGTAGAAGGGACCAGTACAGGTTAT
ACTACTCCAACTGCCCCCCAGGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACC
ACCCAGGCCTCCTATGCAGCTCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACA
AGACCGCAGGATGGAAACAAGCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAG
AGTAACTACAGTTATCCCCAGGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCT
ACACAGCCGACTAGTTATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGT
CAACAAAGCAGCTATGGGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAG
AGCAGCAGCTACGGGCAGCAGACTGCATCAGGAGATATGCAAACATATCAGATCCGAACTACACCTTCAGCTACTTCTCTGCCACAAACT
GTGGTGATGACATCTCCTGTGACTCTCACCTCTCAGACAACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAGGTTAATGAAAAAC
AGAGAAGCTGCTCGAGAATGTCGCAGAAAGAAGAAAGAATATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAATCAAAATAAA
ACTCTAATAGAAGAGTTAAAAACTTTGAAGGATCTTTATTCCAATAAAAGTGTTTGATTCCTAAGAAAGAAAATATTTTTGTGGACATGC
ATAAAAATTAAATGGATTTCCTAGTGGAGTTTTATAAATTAAAAGGTCAAAACTGAAGCTTTTTATTTAGGCTTTTCCAAATCAAGGATA
AATATCTTACGCACGATATCTAGTGACAGAGGAGAAAGTGGAAAATGACCTCAAGGAAGCTACGGGCACAACTGGAAGCTTTGTAGAAAT

>In-frame_EWSR1_ENST00000333395_chr22_29683123_+_ATF1_ENST00000262053_chr12_51208063_+_2460nt
CGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCA
GCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCA
GGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCA
GGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGC
TCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAA
GCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCA
GGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGA
TCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCA
GCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCA
GACTGCATCAGGAGATATGCAAACATATCAGATCCGAACTACACCTTCAGCTACTTCTCTGCCACAAACTGTGGTGATGACATCTCCTGT
GACTCTCACCTCTCAGACAACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAGGTTAATGAAAAACAGAGAAGCTGCTCGAGAATG
TCGCAGAAAGAAGAAAGAATATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAATCAAAATAAAACTCTAATAGAAGAGTTAAA
AACTTTGAAGGATCTTTATTCCAATAAAAGTGTTTGATTCCTAAGAAAGAAAATATTTTTGTGGACATGCATAAAAATTAAATGGATTTC
CTAGTGGAGTTTTATAAATTAAAAGGTCAAAACTGAAGCTTTTTATTTAGGCTTTTCCAAATCAAGGATAAATATCTTACGCACGATATC
TAGTGACAGAGGAGAAAGTGGAAAATGACCTCAAGGAAGCTACGGGCACAACTGGAAGCTTTGTAGAAATTAAACATATTCAAGGAGCAA
GAAATGAACTTTCAGCAGTCTAAATTTTCTAAATAACCAATAGTTGCCAATCTAAAATGGCAGAGAAGATGAAATTTGATAAACTGAATT
TTTTTTAAAAATCCATTTACCCTACAGGTTTGCATTTGTTTGCTGAAATTTACCTTTTTTTAGTTATATATATGTGTGTGTGTGTGTGTA
ATTTCTGCCAATAAATTCTAAATTACAAAGGTAAGAGAAAACCTAGTACATTACTAAATATATAAAGTATATGTTCTGATTATGTATACT
TGTTCTAGTGTCAAGTCTTTTTAAGTGGGTTTTTAAAAGTTTGTTATTGGACTTGAATGGATTTTTGAGACTAGGTTAATTATTTTTGAG
GTCTTATCCTAAAAGGCATCTAAGGTACATGAATGGAGTATGGTGATTTTATAACATTTTTTATCAGAATGGAAAAAGAACTGTTTAAAA
GTTTGATACTTTTAAATAGTTGGTTTTTTTGCTTACTCTGGTAATGATTTTCTACAAATACATAATAAATTGTTTTTTTGAGTCTATATT
CTGTATGCAGTTGAATATCCATTACTTATTCTGCTGTGCTTTAATAGAATGGAATGTTTACAGGCCCTTAAAATATTATTTTTAAAAAAC
CTTCTGAAGATACATACCAAAGTTTTTCCAAGAAGATTTTATAATCAATTTAATAATGTAAGGTTTATCAGATTCTATAATAGTATAGTT
ATTAAGGCAATTTTATGTTAGAGACTATTTTGTAATGTAGTGAGTGGTACCTTTATAAGAAAAGTGACTGCCAATATATTTTTATAGCTG
ATCTTTATAAATTCTAATGTTGAGTTTTTAATGATTATTTTAAATGTTTATATAGTTTAGTAAAATTTGCATCTCAAAGTATCATTTTTA
TATTATGGGACGTTTTCAGATTGGCTAATATTTGCATTGTAAATTTTGTATGCAGTTTATCTAAAATTCAAAAATACTGTCAGTACACCA
GCGTTTAACATCTATATTCCAATTTGTATACAGTTTAAAATTGTACTGCAAAACTATTGTGTGCTCTTACACAGTATGCATCATATTGTT

>In-frame_EWSR1_ENST00000333395_chr22_29683123_+_ATF1_ENST00000539132_chr12_51208063_+_1348nt
CGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCA
GCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCA
GGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCA
GGCATACAGCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGC
TCAGTCTGCATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGACCGCAGGATGGAAACAA
GCCCACTGAGACTAGTCAACCTCAATCTAGCACAGGGGGTTACAACCAGCCCAGCCTAGGATATGGACAGAGTAACTACAGTTATCCCCA
GGTACCTGGGAGCTACCCCATGCAGCCAGTCACTGCACCTCCATCCTACCCTCCTACCAGCTATTCCTCTACACAGCCGACTAGTTATGA
TCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATGGGCA
GCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGCAGCA
GACTGCATCAGGAGATATGCAAACATATCAGATCCGAACTACACCTTCAGCTACTTCTCTGCCACAAACTGTGGTGATGACATCTCCTGT
GACTCTCACCTCTCAGACAACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAGGTTAATGAAAAACAGAGAAGCTGCTCGAGAATG
TCGCAGAAAGAAGAAAGAATATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAATCAAAATAAAACTCTAATAGAAGAGTTAAA
AACTTTGAAGGATCTTTATTCCAATAAAAGTGTTTGATTCCTAAGAAAGAAAATATTTTTGTGGACATGCATAAAAATTAAATGGATTTC
CTAGTGGAGTTTTATAAATTAAAAGGTCAAAACTGAAGCTTTTTATTTAGGCTTTTCCAAATCAAGGATAAATATCTTACGCACGATATC

>In-frame_EWSR1_ENST00000332035_chr22_29683123_+_ATF1_ENST00000262053_chr12_51208063_+_2284nt
AAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTC
AAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGA
CCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACA
GCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTG
CATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGCTATTCCTCTACACAGCCGACTAGTT
ATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATG
GGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGC
AGCAGACTGCATCAGGAGATATGCAAACATATCAGATCCGAACTACACCTTCAGCTACTTCTCTGCCACAAACTGTGGTGATGACATCTC
CTGTGACTCTCACCTCTCAGACAACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAGGTTAATGAAAAACAGAGAAGCTGCTCGAG
AATGTCGCAGAAAGAAGAAAGAATATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAATCAAAATAAAACTCTAATAGAAGAGT
TAAAAACTTTGAAGGATCTTTATTCCAATAAAAGTGTTTGATTCCTAAGAAAGAAAATATTTTTGTGGACATGCATAAAAATTAAATGGA
TTTCCTAGTGGAGTTTTATAAATTAAAAGGTCAAAACTGAAGCTTTTTATTTAGGCTTTTCCAAATCAAGGATAAATATCTTACGCACGA
TATCTAGTGACAGAGGAGAAAGTGGAAAATGACCTCAAGGAAGCTACGGGCACAACTGGAAGCTTTGTAGAAATTAAACATATTCAAGGA
GCAAGAAATGAACTTTCAGCAGTCTAAATTTTCTAAATAACCAATAGTTGCCAATCTAAAATGGCAGAGAAGATGAAATTTGATAAACTG
AATTTTTTTTAAAAATCCATTTACCCTACAGGTTTGCATTTGTTTGCTGAAATTTACCTTTTTTTAGTTATATATATGTGTGTGTGTGTG
TGTAATTTCTGCCAATAAATTCTAAATTACAAAGGTAAGAGAAAACCTAGTACATTACTAAATATATAAAGTATATGTTCTGATTATGTA
TACTTGTTCTAGTGTCAAGTCTTTTTAAGTGGGTTTTTAAAAGTTTGTTATTGGACTTGAATGGATTTTTGAGACTAGGTTAATTATTTT
TGAGGTCTTATCCTAAAAGGCATCTAAGGTACATGAATGGAGTATGGTGATTTTATAACATTTTTTATCAGAATGGAAAAAGAACTGTTT
AAAAGTTTGATACTTTTAAATAGTTGGTTTTTTTGCTTACTCTGGTAATGATTTTCTACAAATACATAATAAATTGTTTTTTTGAGTCTA
TATTCTGTATGCAGTTGAATATCCATTACTTATTCTGCTGTGCTTTAATAGAATGGAATGTTTACAGGCCCTTAAAATATTATTTTTAAA
AAACCTTCTGAAGATACATACCAAAGTTTTTCCAAGAAGATTTTATAATCAATTTAATAATGTAAGGTTTATCAGATTCTATAATAGTAT
AGTTATTAAGGCAATTTTATGTTAGAGACTATTTTGTAATGTAGTGAGTGGTACCTTTATAAGAAAAGTGACTGCCAATATATTTTTATA
GCTGATCTTTATAAATTCTAATGTTGAGTTTTTAATGATTATTTTAAATGTTTATATAGTTTAGTAAAATTTGCATCTCAAAGTATCATT
TTTATATTATGGGACGTTTTCAGATTGGCTAATATTTGCATTGTAAATTTTGTATGCAGTTTATCTAAAATTCAAAAATACTGTCAGTAC
ACCAGCGTTTAACATCTATATTCCAATTTGTATACAGTTTAAAATTGTACTGCAAAACTATTGTGTGCTCTTACACAGTATGCATCATAT

>In-frame_EWSR1_ENST00000332035_chr22_29683123_+_ATF1_ENST00000539132_chr12_51208063_+_1172nt
AAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTC
AAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGA
CCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGGTTATACTACTCCAACTGCCCCCCAGGCATACA
GCCAGCCTGTCCAGGGGTATGGCACTGGTGCTTATGATACCACCACTGCTACAGTCACCACCACCCAGGCCTCCTATGCAGCTCAGTCTG
CATATGGCACTCAGCCTGCTTATCCAGCCTATGGGCAGCAGCCAGCAGCCACTGCACCTACAAGCTATTCCTCTACACAGCCGACTAGTT
ATGATCAGAGCAGTTACTCTCAGCAGAACACCTATGGGCAACCGAGCAGCTATGGACAGCAGAGTAGCTATGGTCAACAAAGCAGCTATG
GGCAGCAGCCTCCCACTAGTTACCCACCCCAAACTGGATCCTACAGCCAAGCTCCAAGTCAATATAGCCAACAGAGCAGCAGCTACGGGC
AGCAGACTGCATCAGGAGATATGCAAACATATCAGATCCGAACTACACCTTCAGCTACTTCTCTGCCACAAACTGTGGTGATGACATCTC
CTGTGACTCTCACCTCTCAGACAACTAAGACAGATGACCCCCAATTGAAAAGAGAAATAAGGTTAATGAAAAACAGAGAAGCTGCTCGAG
AATGTCGCAGAAAGAAGAAAGAATATGTGAAATGCCTGGAAAACCGAGTTGCAGTCCTGGAAAATCAAAATAAAACTCTAATAGAAGAGT
TAAAAACTTTGAAGGATCTTTATTCCAATAAAAGTGTTTGATTCCTAAGAAAGAAAATATTTTTGTGGACATGCATAAAAATTAAATGGA
TTTCCTAGTGGAGTTTTATAAATTAAAAGGTCAAAACTGAAGCTTTTTATTTAGGCTTTTCCAAATCAAGGATAAATATCTTACGCACGA
TATCTAGTGACAGAGGAGAAAGTGGAAAATGACCTCAAGGAAGCTACGGGCACAACTGGAAGCTTTGTAGAAATTAAACATATTCAAGGA


Top

FusionGenePPI for EWSR1_ATF1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
EWSR1PRTFDC1, ZDHHC3, MSC, SLC22A24, MYO1F, KXD1, KHDRBS2, DNAJB3, FASN, NLE1, MNS1, PRUNE2, WWP2, NDUFB1, BNIP3L, NSUN4, KRR1, WWP1, RMND5B, SLC1A1, RASL11B, DFFA, WDR37, RPS15A, CPSF6, C11orf16, YY1AP1, RNF183, MTCP1, TULP2, RBPMS, KEL, MYOZ2, FAM131C, HMGA1, NPPB, HERPUD1, CD177, RPL31, VPS72, ACTL6A, RAD23A, MAGEA11, CFDP1, DMRTB1, CXADR, ZNF165, SSBP2, TPGS2, RAB37, CETP, NDUFV1, DYNLL2, NBPF3, CEACAM5, GPBP1L1, SERP2, GNPDA1, C19orf57, ELAVL3, ELAVL4, LILRA3, BAD, CCDC7, MRPS18B, CUEDC2, CNST, TSPAN3, CCDC91, TRIM37, NINL, NTNG2, CPSF7, PGLS, EPT1, MYL6, SMAD4, TMSB4Y, TRPV5, MVK, MAPK1IP1L, MDFI, MTMR9, PLSCR1, RALYL, PDHX, C10orf12, RHOXF2, MATK, SALL2, AGT, KCNMB1, SUV39H2, SMNDC1, ARHGDIA, PUF60, GSK3B, ILK, CD2BP2, BARD1, CREBBP, BTK, SF1, SNRPC, ELK1, PTK2B, CALM1, POU4F1, EZH2, IRF3, TONSL, RFX3, HLTF, SUPT4H1, ZNF184, HIST1H2BN, BLZF1, HDAC3, FXR2, HMGN4, POLR3A, ECD, ZBTB1, SCMH1, SUZ12, E2F8, TRIM5, ZNF383, DHX9, SMN1, PCM1, RAD21, NDRG1, CEBPA, ELAVL1, SIRT7, HNRNPA1, TSG101, TP53, POLR2A, YBX1, TDRD3, CUL3, CUL4A, CUL4B, CUL5, CUL2, CUL1, COPS5, COPS6, DCUN1D1, CAND1, NEDD8, KCND3, ATN1, ATXN3, ERCC5, HBP1, HSPA2, PCBP1, USP7, SRSF5, TMEM126A, SAP30BP, GORASP2, MBD3, MRPS9, HAX1, SFXN1, ITGA5, TCIRG1, RNF168, GEMIN5, HAS1, MTCH1, NDUFA5, MCAT, MRPL57, HDAC2, ESR1, FN1, VCAM1, ITGA4, CD81, PRMT1, SF3B4, EP300, PRRC2A, EWSR1, FUS, ITGB5, NONO, TRAF3, HNRNPUL1, EPAS1, CHERP, CDK12, ITCH, WBP4, RPA3, RPA2, RPA1, HSPA5, RIOK2, TRAF1, TRAF2, SEC24D, TFG, SEC24A, SSBP3, PRR13, ATPAF2, PEF1, JUN, CUL7, OBSL1, CCDC8, RNF2, BMI1, EGFR, ABL1, SRPK1, ABCE1, PRMT8, RPS6KB2, ACAA2, ACAT1, EIF4H, ANXA2, HIP1R, PICALM, POR, NTRK1, SCARNA22, NPM1, KRT2, PRDX2, S100A9, YWHAZ, DDX17, PCLO, ANXA6, SEC24C, GIPC1, CSRP2, FHL1, HNRNPA3, CTTN, MARCKSL1, PARP1, SERPINB3, CCDC50, KIF2A, KRT6B, HIST1H1D, STK38, H2AFV, PACSIN2, U2AF1, RSL24D1, XRCC5, ESYT3, RPL29, SDF2L1, LRP1B, MSN, SEC23A, RPL7A, SNX18, PPIL1, RPS27A, IGHM, SUMO3, GTF2I, RUVBL1, KRT16, RBM8A, RPL8, SRSF9, ZC3HAV1L, GAPDH, ETV3, IGF2R, COL5A2, HNRNPD, ANP32B, WAC, TFAP2A, TTN, CBR3, ARGLU1, HNRNPAB, SRRT, ATP1B3, COPS7B, PRR12, ATF3, NOMO3, NOMO1, NOMO2, EYA3, C1orf198, MAZ, U2AF2, SSB, TRA2B, C1orf52, HMGB1, HMGB1P10, RPRD1A, HNRNPH3, EIF5A2, C1orf131, SEC13, MAPRE1, CSTF2T, SRSF3, LENG1, UPF1, HDGFRP2, RPS10P7, RPS10P11, RPS10, RPS10P13, RPS10P4, RPS10P22, DACH1, ANO1, NCOR1, MLX, SUMO1P3, SUMO1, WIZ, PFDN6, ARFIP2, ZHX3, EEF1B2, MBIP, BAG6, DENND2A, PRCC, SRSF1, EIF4ENIF1, SPTAN1, CDCA8, PLS3, API5P1, API5, PSMA4, DNTTIP1, AKAP8, NCOA3, SMTN, FBRS, SMARCE1, ERC1, WBP11, SPTBN1, NFRKB, OLA1, ZNF207, R3HDM1, TRIM33, SAFB, UBFD1, SRSF7, SRSF2, GATA6, VDAC1P1, VDAC1, IL16, GMNN, ILF2, MED4, QKI, VCL, MFAP1, SNAP29, PADI1, BCL9, BCL9L, PKM, GPATCH11, CASC3, PSMC6, CACYBP, RPL12P6, RPL12P32, RPL12P14, RPL12, RPL12P2, RPL12P35, RPL12P19, TPI1, TPI1P1, CHAF1A, MIA3, CIC, SDCBP, CA2, FKBP3, ACE, NKX2-5, CSTF2, PFDN2, UBTF, FAM207A, LOC729774, BRD8, C12orf45, C1orf35, TCF20, SOD1, SPAG7, MED8, ETS2, ALDOC, FKBP4, INCENP, CEP85, CECR2, TFE3, SUPT16HP1, SUPT16H, MAPT, HTATSF1, RPS18P12, RPS18P5, KPNA2, TMX1, CKAP4, HSPE1, COPRS, PTGES3, LAMP2, ERLIN2, CTNNBL1, TOMM22, NRBF2, C9orf78, NCOA6, MED26, RANBP1, LOC389842, LOC727803, HMGB3, CANX, PUS7, RPSAP19, RPSA, RPSAP18, RPSAP58, RPSAP15, RPSAP8, RPSAP9, RPSAP12, RPSAP29, RPSAP61, ARHGAP17, USF1, PSIP1, SNRPEP2, SNRPE, NUDT5, PPM1G, OTUB1, AHCY, COPS3, NSMCE2, SAE1, PROSER1, GRWD1, CREB5, TAF9B, RBM33, EDF1, PGK1, FAM114A2, SRRM1, RAD23B, CIAPIN1, CIAPIN1P, LRRC59, PABPN1, KMT2A, RPRD1B, GPATCH8, CCDC43, DGCR14, PPP1R2, ERICH1, EIF5A, EIF5AL1, BAG3, PCNA, SOX7, PNISR, FAM168A, MED15, SRSF11, SIRT1, RSF1, MAML1, HPRT1, SPDL1, CRTC3, CEP55, CDV3, ALYREF, RNF40, STOML2, DGCR8, NUCKS1, UBN2, PSMD7, WNT10A, HMBS, KHDRBS1, VBP1, NCSTN, CDCA2, SFSWAP, ZRANB2, DDB1, RBBP6, ZEB1, SRSF6, LOC644422, EIF2S1, RFX5, RPS19, RPS19P3, TALDO1, CWC15, CDCA5, LOC645086, C11orf58, TXN, STX12, PHRF1, BSG, TAF4, SH3GL1, LIN37, HRNR, FAM192A, RRBP1, KIAA0907, GOLGB1, PAX9, P4HB, CHMP5, LDHB, CALR, SUMO2P1, SUMO2, PDIA6, AHSA1, EN2, CCDC124, RPLP0P6, RPLP0P2, RPLP0P3, RPLP0, NIPBL, PDLIM4, PRKCSH, C15orf39, HNRNPDL, PDIA4, NUP210, RPLP2P3, RPLP2, PRDX4, DAZAP1, UBE2T, PHAX, AMOT, MARCKS, LOC284685, SMARCC1, BCORL1, RFC4, GLRX3, ANP32E, HYOU1, NPM3, ATF7IP, SARNP, TRA2A, HDGF, STIP1, PELP1, KCTD12, GLO1, PCF11, CLIC1, DNAJC8, RNF114, SLC4A1AP, FAM50A, GTF2A1, PRPF40A, CDC37, PPIAP22, PPIA, SMARCC2, MEGF11, KIAA1143, DENR, LAMP1, MYBL2, PITX1, UBE2MP1, UBE2M, CHTF8, OTX1, NACA, FNBP4, GTF2F2, GLTSCR1, GTF2E1, PQBP1, EMD, RNF113A, GPALPP1, SNRPA, RRP15, RPS25, RPS25P8, GMEB2, LNPEP, DNAJB1, IGBP1P1, IGBP1, HINT1, ARID1A, PPIB, ANXA11, MATR3, PPARGC1A, MCM2, UBASH3B, SFPQ, CAPN13, HEY1, BRCA1ATF1BRCA1, CSNK2A1, CSNK2B, CAMK2A, CREBBP, SPI1, HNF1B, GABPA, FOSL2, SRA1, CACNG2, TRPV5, TUFT1, ATF2, JUNB, CREB1, NFATC1, DNMT3L, MAPKAPK2, MAPKAPK3, RPS6KA5, CTAGE5, ARHGAP22, CCDC97, IDO2, CREBRF, CSGALNACT2, ARIH1, TFAP4, HSPA8, NFIL3, SSH1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for EWSR1_ATF1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneATF1P18846DB00852PseudoephedrineCyclic AMP-dependent transcription factor ATF-1small moleculeapproved

Top

RelatedDiseases for EWSR1_ATF1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneEWSR1C0553580Ewings sarcoma3CTD_human;HPO;ORPHANET
HgeneEWSR1C0206663Neuroectodermal Tumor, Primitive1CTD_human
TgeneATF1C0032460Polycystic Ovary Syndrome1CTD_human