FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 12227

FusionGeneSummary for EWSR1_ABR

check button Fusion gene summary
Fusion gene informationFusion gene name: EWSR1_ABR
Fusion gene ID: 12227
HgeneTgene
Gene symbol

EWSR1

ABR

Gene ID

2130

29

Gene nameEWS RNA binding protein 1ABR, RhoGEF and GTPase activating protein
SynonymsEWS|EWS-FLI1|bK984G1.4MDB
Cytomap

22q12.2

17p13.3

Type of geneprotein-codingprotein-coding
DescriptionRNA-binding protein EWSEWS RNA-binding protein variant 6Ewing sarcoma breakpoint region 1Ewings sarcoma EWS-Fli1 (type 1) oncogeneactive breakpoint cluster region-related proteinactive BCR-related
Modification date2018052720180523
UniProtAcc

Q01844

Q12979

Ensembl transtripts involved in fusion geneENST00000332050, ENST00000397938, 
ENST00000406548, ENST00000331029, 
ENST00000414183, ENST00000333395, 
ENST00000332035, 
ENST00000302538, 
ENST00000544583, ENST00000572441, 
ENST00000574437, ENST00000291107, 
ENST00000543210, ENST00000536794, 
ENST00000573895, 
Fusion gene scores* DoF score17 X 31 X 5=263514 X 13 X 8=1456
# samples 5318
** MAII scorelog2(53/2635*10)=-2.31373869707402
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(18/1456*10)=-3.01594154386902
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: EWSR1 [Title/Abstract] AND ABR [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVHNSCTCGA-CV-7421-01AEWSR1chr22

29669853

+ABRchr17

1028702

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000332050ENST00000302538EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-5UTRENST00000332050ENST00000544583EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-intronENST00000332050ENST00000572441EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-5UTRENST00000332050ENST00000574437EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-intronENST00000332050ENST00000291107EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-intronENST00000332050ENST00000543210EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-intronENST00000332050ENST00000536794EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-intronENST00000332050ENST00000573895EWSR1chr22

29669853

+ABRchr17

1028702

-
In-frameENST00000397938ENST00000302538EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-5UTRENST00000397938ENST00000544583EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-intronENST00000397938ENST00000572441EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-5UTRENST00000397938ENST00000574437EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-intronENST00000397938ENST00000291107EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-intronENST00000397938ENST00000543210EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-intronENST00000397938ENST00000536794EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-intronENST00000397938ENST00000573895EWSR1chr22

29669853

+ABRchr17

1028702

-
In-frameENST00000406548ENST00000302538EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-5UTRENST00000406548ENST00000544583EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-intronENST00000406548ENST00000572441EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-5UTRENST00000406548ENST00000574437EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-intronENST00000406548ENST00000291107EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-intronENST00000406548ENST00000543210EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-intronENST00000406548ENST00000536794EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-intronENST00000406548ENST00000573895EWSR1chr22

29669853

+ABRchr17

1028702

-
In-frameENST00000331029ENST00000302538EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-5UTRENST00000331029ENST00000544583EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-intronENST00000331029ENST00000572441EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-5UTRENST00000331029ENST00000574437EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-intronENST00000331029ENST00000291107EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-intronENST00000331029ENST00000543210EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-intronENST00000331029ENST00000536794EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-intronENST00000331029ENST00000573895EWSR1chr22

29669853

+ABRchr17

1028702

-
In-frameENST00000414183ENST00000302538EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-5UTRENST00000414183ENST00000544583EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-intronENST00000414183ENST00000572441EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-5UTRENST00000414183ENST00000574437EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-intronENST00000414183ENST00000291107EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-intronENST00000414183ENST00000543210EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-intronENST00000414183ENST00000536794EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-intronENST00000414183ENST00000573895EWSR1chr22

29669853

+ABRchr17

1028702

-
In-frameENST00000333395ENST00000302538EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-5UTRENST00000333395ENST00000544583EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-intronENST00000333395ENST00000572441EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-5UTRENST00000333395ENST00000574437EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-intronENST00000333395ENST00000291107EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-intronENST00000333395ENST00000543210EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-intronENST00000333395ENST00000536794EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-intronENST00000333395ENST00000573895EWSR1chr22

29669853

+ABRchr17

1028702

-
In-frameENST00000332035ENST00000302538EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-5UTRENST00000332035ENST00000544583EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-intronENST00000332035ENST00000572441EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-5UTRENST00000332035ENST00000574437EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-intronENST00000332035ENST00000291107EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-intronENST00000332035ENST00000543210EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-intronENST00000332035ENST00000536794EWSR1chr22

29669853

+ABRchr17

1028702

-
5CDS-intronENST00000332035ENST00000573895EWSR1chr22

29669853

+ABRchr17

1028702

-

Top

FusionProtFeatures for EWSR1_ABR


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
EWSR1

Q01844

ABR

Q12979

Might normally function as a transcriptional repressor.EWS-fusion-proteins (EFPS) may play a role in the tumorigenicprocess. They may disturb gene expression by mimicking, orinterfering with the normal function of CTD-POLII within thetranscription initiation complex. They may also contribute to anaberrant activation of the fusion protein target genes.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneEWSR1chr22:29669853chr17:1028702ENST00000332035+41617_2775601RepeatNote=2
HgeneEWSR1chr22:29669853chr17:1028702ENST00000332035+41628_3475601RepeatNote=3
HgeneEWSR1chr22:29669853chr17:1028702ENST00000332035+41635_4275601RepeatNote=4
HgeneEWSR1chr22:29669853chr17:1028702ENST00000332035+41643_5075601RepeatNote=5
HgeneEWSR1chr22:29669853chr17:1028702ENST00000332035+41651_5975601RepeatNote=6
HgeneEWSR1chr22:29669853chr17:1028702ENST00000332035+41660_6875601RepeatNote=7
HgeneEWSR1chr22:29669853chr17:1028702ENST00000332035+41669_7575601RepeatNote=8
HgeneEWSR1chr22:29669853chr17:1028702ENST00000332035+4168_1675601RepeatNote=1
HgeneEWSR1chr22:29669853chr17:1028702ENST00000333395+4917_2775355RepeatNote=2
HgeneEWSR1chr22:29669853chr17:1028702ENST00000333395+4928_3475355RepeatNote=3
HgeneEWSR1chr22:29669853chr17:1028702ENST00000333395+4935_4275355RepeatNote=4
HgeneEWSR1chr22:29669853chr17:1028702ENST00000333395+4943_5075355RepeatNote=5
HgeneEWSR1chr22:29669853chr17:1028702ENST00000333395+4951_5975355RepeatNote=6
HgeneEWSR1chr22:29669853chr17:1028702ENST00000333395+4960_6875355RepeatNote=7
HgeneEWSR1chr22:29669853chr17:1028702ENST00000333395+4969_7575355RepeatNote=8
HgeneEWSR1chr22:29669853chr17:1028702ENST00000333395+498_1675355RepeatNote=1
HgeneEWSR1chr22:29669853chr17:1028702ENST00000397938+41717_2775657RepeatNote=2
HgeneEWSR1chr22:29669853chr17:1028702ENST00000397938+41728_3475657RepeatNote=3
HgeneEWSR1chr22:29669853chr17:1028702ENST00000397938+41735_4275657RepeatNote=4
HgeneEWSR1chr22:29669853chr17:1028702ENST00000397938+41743_5075657RepeatNote=5
HgeneEWSR1chr22:29669853chr17:1028702ENST00000397938+41751_5975657RepeatNote=6
HgeneEWSR1chr22:29669853chr17:1028702ENST00000397938+41760_6875657RepeatNote=7
HgeneEWSR1chr22:29669853chr17:1028702ENST00000397938+41769_7575657RepeatNote=8
HgeneEWSR1chr22:29669853chr17:1028702ENST00000397938+4178_1675657RepeatNote=1
HgeneEWSR1chr22:29669853chr17:1028702ENST00000406548+41717_2775656RepeatNote=2
HgeneEWSR1chr22:29669853chr17:1028702ENST00000406548+41728_3475656RepeatNote=3
HgeneEWSR1chr22:29669853chr17:1028702ENST00000406548+41735_4275656RepeatNote=4
HgeneEWSR1chr22:29669853chr17:1028702ENST00000406548+41743_5075656RepeatNote=5
HgeneEWSR1chr22:29669853chr17:1028702ENST00000406548+41751_5975656RepeatNote=6
HgeneEWSR1chr22:29669853chr17:1028702ENST00000406548+41760_6875656RepeatNote=7
HgeneEWSR1chr22:29669853chr17:1028702ENST00000406548+41769_7575656RepeatNote=8
HgeneEWSR1chr22:29669853chr17:1028702ENST00000406548+4178_1675656RepeatNote=1
HgeneEWSR1chr22:29669853chr17:1028702ENST00000414183+41817_2775662RepeatNote=2
HgeneEWSR1chr22:29669853chr17:1028702ENST00000414183+41828_3475662RepeatNote=3
HgeneEWSR1chr22:29669853chr17:1028702ENST00000414183+41835_4275662RepeatNote=4
HgeneEWSR1chr22:29669853chr17:1028702ENST00000414183+41843_5075662RepeatNote=5
HgeneEWSR1chr22:29669853chr17:1028702ENST00000414183+41851_5975662RepeatNote=6
HgeneEWSR1chr22:29669853chr17:1028702ENST00000414183+41860_6875662RepeatNote=7
HgeneEWSR1chr22:29669853chr17:1028702ENST00000414183+41869_7575662RepeatNote=8
HgeneEWSR1chr22:29669853chr17:1028702ENST00000414183+4188_1675662RepeatNote=1
TgeneABRchr22:29669853chr17:1028702ENST00000291107-022417_420-11823Compositional biasNote=Poly-Leu
TgeneABRchr22:29669853chr17:1028702ENST00000302538-023417_42020860Compositional biasNote=Poly-Leu
TgeneABRchr22:29669853chr17:1028702ENST00000543210-08417_420-33311Compositional biasNote=Poly-Leu
TgeneABRchr22:29669853chr17:1028702ENST00000544583-023417_420-26814Compositional biasNote=Poly-Leu
TgeneABRchr22:29669853chr17:1028702ENST00000574437-022417_420-155814Compositional biasNote=Poly-Leu
TgeneABRchr22:29669853chr17:1028702ENST00000291107-022301_459-11823DomainPH
TgeneABRchr22:29669853chr17:1028702ENST00000291107-022463_595-11823DomainC2
TgeneABRchr22:29669853chr17:1028702ENST00000291107-022647_845-11823DomainRho-GAP
TgeneABRchr22:29669853chr17:1028702ENST00000291107-02291_284-11823DomainDH
TgeneABRchr22:29669853chr17:1028702ENST00000302538-023301_45920860DomainPH
TgeneABRchr22:29669853chr17:1028702ENST00000302538-023463_59520860DomainC2
TgeneABRchr22:29669853chr17:1028702ENST00000302538-023647_84520860DomainRho-GAP
TgeneABRchr22:29669853chr17:1028702ENST00000302538-02391_28420860DomainDH
TgeneABRchr22:29669853chr17:1028702ENST00000543210-08301_459-33311DomainPH
TgeneABRchr22:29669853chr17:1028702ENST00000543210-08463_595-33311DomainC2
TgeneABRchr22:29669853chr17:1028702ENST00000543210-08647_845-33311DomainRho-GAP
TgeneABRchr22:29669853chr17:1028702ENST00000543210-0891_284-33311DomainDH
TgeneABRchr22:29669853chr17:1028702ENST00000544583-023301_459-26814DomainPH
TgeneABRchr22:29669853chr17:1028702ENST00000544583-023463_595-26814DomainC2
TgeneABRchr22:29669853chr17:1028702ENST00000544583-023647_845-26814DomainRho-GAP
TgeneABRchr22:29669853chr17:1028702ENST00000544583-02391_284-26814DomainDH
TgeneABRchr22:29669853chr17:1028702ENST00000574437-022301_459-155814DomainPH
TgeneABRchr22:29669853chr17:1028702ENST00000574437-022463_595-155814DomainC2
TgeneABRchr22:29669853chr17:1028702ENST00000574437-022647_845-155814DomainRho-GAP
TgeneABRchr22:29669853chr17:1028702ENST00000574437-02291_284-155814DomainDH

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneEWSR1chr22:29669853chr17:1028702ENST00000332035+416300_34075601Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29669853chr17:1028702ENST00000332035+416454_51375601Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29669853chr17:1028702ENST00000332035+416559_64075601Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29669853chr17:1028702ENST00000333395+49300_34075355Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29669853chr17:1028702ENST00000333395+49454_51375355Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29669853chr17:1028702ENST00000333395+49559_64075355Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29669853chr17:1028702ENST00000397938+417300_34075657Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29669853chr17:1028702ENST00000397938+417454_51375657Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29669853chr17:1028702ENST00000397938+417559_64075657Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29669853chr17:1028702ENST00000406548+417300_34075656Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29669853chr17:1028702ENST00000406548+417454_51375656Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29669853chr17:1028702ENST00000406548+417559_64075656Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29669853chr17:1028702ENST00000414183+418300_34075662Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29669853chr17:1028702ENST00000414183+418454_51375662Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29669853chr17:1028702ENST00000414183+418559_64075662Compositional biasNote=Arg/Gly/Pro-rich
HgeneEWSR1chr22:29669853chr17:1028702ENST00000332035+416256_28575601DomainNote=IQ
HgeneEWSR1chr22:29669853chr17:1028702ENST00000332035+416361_44775601DomainRRM
HgeneEWSR1chr22:29669853chr17:1028702ENST00000333395+49256_28575355DomainNote=IQ
HgeneEWSR1chr22:29669853chr17:1028702ENST00000333395+49361_44775355DomainRRM
HgeneEWSR1chr22:29669853chr17:1028702ENST00000397938+417256_28575657DomainNote=IQ
HgeneEWSR1chr22:29669853chr17:1028702ENST00000397938+417361_44775657DomainRRM
HgeneEWSR1chr22:29669853chr17:1028702ENST00000406548+417256_28575656DomainNote=IQ
HgeneEWSR1chr22:29669853chr17:1028702ENST00000406548+417361_44775656DomainRRM
HgeneEWSR1chr22:29669853chr17:1028702ENST00000414183+418256_28575662DomainNote=IQ
HgeneEWSR1chr22:29669853chr17:1028702ENST00000414183+418361_44775662DomainRRM
HgeneEWSR1chr22:29669853chr17:1028702ENST00000332035+416639_65675601MotifNuclear localization signal
HgeneEWSR1chr22:29669853chr17:1028702ENST00000333395+49639_65675355MotifNuclear localization signal
HgeneEWSR1chr22:29669853chr17:1028702ENST00000397938+417639_65675657MotifNuclear localization signal
HgeneEWSR1chr22:29669853chr17:1028702ENST00000406548+417639_65675656MotifNuclear localization signal
HgeneEWSR1chr22:29669853chr17:1028702ENST00000414183+418639_65675662MotifNuclear localization signal
HgeneEWSR1chr22:29669853chr17:1028702ENST00000332035+4161_28575601RegionNote=EAD (Gln/Pro/Thr-rich)
HgeneEWSR1chr22:29669853chr17:1028702ENST00000332035+4168_28575601RegionNote=31 X approximate tandem repeats
HgeneEWSR1chr22:29669853chr17:1028702ENST00000333395+491_28575355RegionNote=EAD (Gln/Pro/Thr-rich)
HgeneEWSR1chr22:29669853chr17:1028702ENST00000333395+498_28575355RegionNote=31 X approximate tandem repeats
HgeneEWSR1chr22:29669853chr17:1028702ENST00000397938+4171_28575657RegionNote=EAD (Gln/Pro/Thr-rich)
HgeneEWSR1chr22:29669853chr17:1028702ENST00000397938+4178_28575657RegionNote=31 X approximate tandem repeats
HgeneEWSR1chr22:29669853chr17:1028702ENST00000406548+4171_28575656RegionNote=EAD (Gln/Pro/Thr-rich)
HgeneEWSR1chr22:29669853chr17:1028702ENST00000406548+4178_28575656RegionNote=31 X approximate tandem repeats
HgeneEWSR1chr22:29669853chr17:1028702ENST00000414183+4181_28575662RegionNote=EAD (Gln/Pro/Thr-rich)
HgeneEWSR1chr22:29669853chr17:1028702ENST00000414183+4188_28575662RegionNote=31 X approximate tandem repeats
HgeneEWSR1chr22:29669853chr17:1028702ENST00000332035+416111_11675601RepeatNote=12
HgeneEWSR1chr22:29669853chr17:1028702ENST00000332035+416117_12575601RepeatNote=13
HgeneEWSR1chr22:29669853chr17:1028702ENST00000332035+416126_15675601RepeatNote=14
HgeneEWSR1chr22:29669853chr17:1028702ENST00000332035+416157_16375601RepeatNote=15
HgeneEWSR1chr22:29669853chr17:1028702ENST00000332035+416164_17075601RepeatNote=16
HgeneEWSR1chr22:29669853chr17:1028702ENST00000332035+416171_17775601RepeatNote=17
HgeneEWSR1chr22:29669853chr17:1028702ENST00000332035+416178_18875601RepeatNote=18
HgeneEWSR1chr22:29669853chr17:1028702ENST00000332035+416189_19375601RepeatNote=19
HgeneEWSR1chr22:29669853chr17:1028702ENST00000332035+416194_20175601RepeatNote=20
HgeneEWSR1chr22:29669853chr17:1028702ENST00000332035+416202_20675601RepeatNote=21
HgeneEWSR1chr22:29669853chr17:1028702ENST00000332035+416207_21275601RepeatNote=22
HgeneEWSR1chr22:29669853chr17:1028702ENST00000332035+416213_21875601RepeatNote=23
HgeneEWSR1chr22:29669853chr17:1028702ENST00000332035+416219_22475601RepeatNote=24
HgeneEWSR1chr22:29669853chr17:1028702ENST00000332035+416225_23075601RepeatNote=25
HgeneEWSR1chr22:29669853chr17:1028702ENST00000332035+416231_23875601RepeatNote=26
HgeneEWSR1chr22:29669853chr17:1028702ENST00000332035+416239_24575601RepeatNote=27
HgeneEWSR1chr22:29669853chr17:1028702ENST00000332035+416246_25275601RepeatNote=28
HgeneEWSR1chr22:29669853chr17:1028702ENST00000332035+416253_25975601RepeatNote=29
HgeneEWSR1chr22:29669853chr17:1028702ENST00000332035+416260_27675601RepeatNote=30
HgeneEWSR1chr22:29669853chr17:1028702ENST00000332035+416277_28575601RepeatNote=31
HgeneEWSR1chr22:29669853chr17:1028702ENST00000332035+41676_8475601RepeatNote=9
HgeneEWSR1chr22:29669853chr17:1028702ENST00000332035+41685_9175601RepeatNote=10
HgeneEWSR1chr22:29669853chr17:1028702ENST00000332035+41692_11075601RepeatNote=11
HgeneEWSR1chr22:29669853chr17:1028702ENST00000333395+49111_11675355RepeatNote=12
HgeneEWSR1chr22:29669853chr17:1028702ENST00000333395+49117_12575355RepeatNote=13
HgeneEWSR1chr22:29669853chr17:1028702ENST00000333395+49126_15675355RepeatNote=14
HgeneEWSR1chr22:29669853chr17:1028702ENST00000333395+49157_16375355RepeatNote=15
HgeneEWSR1chr22:29669853chr17:1028702ENST00000333395+49164_17075355RepeatNote=16
HgeneEWSR1chr22:29669853chr17:1028702ENST00000333395+49171_17775355RepeatNote=17
HgeneEWSR1chr22:29669853chr17:1028702ENST00000333395+49178_18875355RepeatNote=18
HgeneEWSR1chr22:29669853chr17:1028702ENST00000333395+49189_19375355RepeatNote=19
HgeneEWSR1chr22:29669853chr17:1028702ENST00000333395+49194_20175355RepeatNote=20
HgeneEWSR1chr22:29669853chr17:1028702ENST00000333395+49202_20675355RepeatNote=21
HgeneEWSR1chr22:29669853chr17:1028702ENST00000333395+49207_21275355RepeatNote=22
HgeneEWSR1chr22:29669853chr17:1028702ENST00000333395+49213_21875355RepeatNote=23
HgeneEWSR1chr22:29669853chr17:1028702ENST00000333395+49219_22475355RepeatNote=24
HgeneEWSR1chr22:29669853chr17:1028702ENST00000333395+49225_23075355RepeatNote=25
HgeneEWSR1chr22:29669853chr17:1028702ENST00000333395+49231_23875355RepeatNote=26
HgeneEWSR1chr22:29669853chr17:1028702ENST00000333395+49239_24575355RepeatNote=27
HgeneEWSR1chr22:29669853chr17:1028702ENST00000333395+49246_25275355RepeatNote=28
HgeneEWSR1chr22:29669853chr17:1028702ENST00000333395+49253_25975355RepeatNote=29
HgeneEWSR1chr22:29669853chr17:1028702ENST00000333395+49260_27675355RepeatNote=30
HgeneEWSR1chr22:29669853chr17:1028702ENST00000333395+49277_28575355RepeatNote=31
HgeneEWSR1chr22:29669853chr17:1028702ENST00000333395+4976_8475355RepeatNote=9
HgeneEWSR1chr22:29669853chr17:1028702ENST00000333395+4985_9175355RepeatNote=10
HgeneEWSR1chr22:29669853chr17:1028702ENST00000333395+4992_11075355RepeatNote=11
HgeneEWSR1chr22:29669853chr17:1028702ENST00000397938+417111_11675657RepeatNote=12
HgeneEWSR1chr22:29669853chr17:1028702ENST00000397938+417117_12575657RepeatNote=13
HgeneEWSR1chr22:29669853chr17:1028702ENST00000397938+417126_15675657RepeatNote=14
HgeneEWSR1chr22:29669853chr17:1028702ENST00000397938+417157_16375657RepeatNote=15
HgeneEWSR1chr22:29669853chr17:1028702ENST00000397938+417164_17075657RepeatNote=16
HgeneEWSR1chr22:29669853chr17:1028702ENST00000397938+417171_17775657RepeatNote=17
HgeneEWSR1chr22:29669853chr17:1028702ENST00000397938+417178_18875657RepeatNote=18
HgeneEWSR1chr22:29669853chr17:1028702ENST00000397938+417189_19375657RepeatNote=19
HgeneEWSR1chr22:29669853chr17:1028702ENST00000397938+417194_20175657RepeatNote=20
HgeneEWSR1chr22:29669853chr17:1028702ENST00000397938+417202_20675657RepeatNote=21
HgeneEWSR1chr22:29669853chr17:1028702ENST00000397938+417207_21275657RepeatNote=22
HgeneEWSR1chr22:29669853chr17:1028702ENST00000397938+417213_21875657RepeatNote=23
HgeneEWSR1chr22:29669853chr17:1028702ENST00000397938+417219_22475657RepeatNote=24
HgeneEWSR1chr22:29669853chr17:1028702ENST00000397938+417225_23075657RepeatNote=25
HgeneEWSR1chr22:29669853chr17:1028702ENST00000397938+417231_23875657RepeatNote=26
HgeneEWSR1chr22:29669853chr17:1028702ENST00000397938+417239_24575657RepeatNote=27
HgeneEWSR1chr22:29669853chr17:1028702ENST00000397938+417246_25275657RepeatNote=28
HgeneEWSR1chr22:29669853chr17:1028702ENST00000397938+417253_25975657RepeatNote=29
HgeneEWSR1chr22:29669853chr17:1028702ENST00000397938+417260_27675657RepeatNote=30
HgeneEWSR1chr22:29669853chr17:1028702ENST00000397938+417277_28575657RepeatNote=31
HgeneEWSR1chr22:29669853chr17:1028702ENST00000397938+41776_8475657RepeatNote=9
HgeneEWSR1chr22:29669853chr17:1028702ENST00000397938+41785_9175657RepeatNote=10
HgeneEWSR1chr22:29669853chr17:1028702ENST00000397938+41792_11075657RepeatNote=11
HgeneEWSR1chr22:29669853chr17:1028702ENST00000406548+417111_11675656RepeatNote=12
HgeneEWSR1chr22:29669853chr17:1028702ENST00000406548+417117_12575656RepeatNote=13
HgeneEWSR1chr22:29669853chr17:1028702ENST00000406548+417126_15675656RepeatNote=14
HgeneEWSR1chr22:29669853chr17:1028702ENST00000406548+417157_16375656RepeatNote=15
HgeneEWSR1chr22:29669853chr17:1028702ENST00000406548+417164_17075656RepeatNote=16
HgeneEWSR1chr22:29669853chr17:1028702ENST00000406548+417171_17775656RepeatNote=17
HgeneEWSR1chr22:29669853chr17:1028702ENST00000406548+417178_18875656RepeatNote=18
HgeneEWSR1chr22:29669853chr17:1028702ENST00000406548+417189_19375656RepeatNote=19
HgeneEWSR1chr22:29669853chr17:1028702ENST00000406548+417194_20175656RepeatNote=20
HgeneEWSR1chr22:29669853chr17:1028702ENST00000406548+417202_20675656RepeatNote=21
HgeneEWSR1chr22:29669853chr17:1028702ENST00000406548+417207_21275656RepeatNote=22
HgeneEWSR1chr22:29669853chr17:1028702ENST00000406548+417213_21875656RepeatNote=23
HgeneEWSR1chr22:29669853chr17:1028702ENST00000406548+417219_22475656RepeatNote=24
HgeneEWSR1chr22:29669853chr17:1028702ENST00000406548+417225_23075656RepeatNote=25
HgeneEWSR1chr22:29669853chr17:1028702ENST00000406548+417231_23875656RepeatNote=26
HgeneEWSR1chr22:29669853chr17:1028702ENST00000406548+417239_24575656RepeatNote=27
HgeneEWSR1chr22:29669853chr17:1028702ENST00000406548+417246_25275656RepeatNote=28
HgeneEWSR1chr22:29669853chr17:1028702ENST00000406548+417253_25975656RepeatNote=29
HgeneEWSR1chr22:29669853chr17:1028702ENST00000406548+417260_27675656RepeatNote=30
HgeneEWSR1chr22:29669853chr17:1028702ENST00000406548+417277_28575656RepeatNote=31
HgeneEWSR1chr22:29669853chr17:1028702ENST00000406548+41776_8475656RepeatNote=9
HgeneEWSR1chr22:29669853chr17:1028702ENST00000406548+41785_9175656RepeatNote=10
HgeneEWSR1chr22:29669853chr17:1028702ENST00000406548+41792_11075656RepeatNote=11
HgeneEWSR1chr22:29669853chr17:1028702ENST00000414183+418111_11675662RepeatNote=12
HgeneEWSR1chr22:29669853chr17:1028702ENST00000414183+418117_12575662RepeatNote=13
HgeneEWSR1chr22:29669853chr17:1028702ENST00000414183+418126_15675662RepeatNote=14
HgeneEWSR1chr22:29669853chr17:1028702ENST00000414183+418157_16375662RepeatNote=15
HgeneEWSR1chr22:29669853chr17:1028702ENST00000414183+418164_17075662RepeatNote=16
HgeneEWSR1chr22:29669853chr17:1028702ENST00000414183+418171_17775662RepeatNote=17
HgeneEWSR1chr22:29669853chr17:1028702ENST00000414183+418178_18875662RepeatNote=18
HgeneEWSR1chr22:29669853chr17:1028702ENST00000414183+418189_19375662RepeatNote=19
HgeneEWSR1chr22:29669853chr17:1028702ENST00000414183+418194_20175662RepeatNote=20
HgeneEWSR1chr22:29669853chr17:1028702ENST00000414183+418202_20675662RepeatNote=21
HgeneEWSR1chr22:29669853chr17:1028702ENST00000414183+418207_21275662RepeatNote=22
HgeneEWSR1chr22:29669853chr17:1028702ENST00000414183+418213_21875662RepeatNote=23
HgeneEWSR1chr22:29669853chr17:1028702ENST00000414183+418219_22475662RepeatNote=24
HgeneEWSR1chr22:29669853chr17:1028702ENST00000414183+418225_23075662RepeatNote=25
HgeneEWSR1chr22:29669853chr17:1028702ENST00000414183+418231_23875662RepeatNote=26
HgeneEWSR1chr22:29669853chr17:1028702ENST00000414183+418239_24575662RepeatNote=27
HgeneEWSR1chr22:29669853chr17:1028702ENST00000414183+418246_25275662RepeatNote=28
HgeneEWSR1chr22:29669853chr17:1028702ENST00000414183+418253_25975662RepeatNote=29
HgeneEWSR1chr22:29669853chr17:1028702ENST00000414183+418260_27675662RepeatNote=30
HgeneEWSR1chr22:29669853chr17:1028702ENST00000414183+418277_28575662RepeatNote=31
HgeneEWSR1chr22:29669853chr17:1028702ENST00000414183+41876_8475662RepeatNote=9
HgeneEWSR1chr22:29669853chr17:1028702ENST00000414183+41885_9175662RepeatNote=10
HgeneEWSR1chr22:29669853chr17:1028702ENST00000414183+41892_11075662RepeatNote=11
HgeneEWSR1chr22:29669853chr17:1028702ENST00000332035+416518_54975601Zinc fingerRanBP2-type
HgeneEWSR1chr22:29669853chr17:1028702ENST00000333395+49518_54975355Zinc fingerRanBP2-type
HgeneEWSR1chr22:29669853chr17:1028702ENST00000397938+417518_54975657Zinc fingerRanBP2-type
HgeneEWSR1chr22:29669853chr17:1028702ENST00000406548+417518_54975656Zinc fingerRanBP2-type
HgeneEWSR1chr22:29669853chr17:1028702ENST00000414183+418518_54975662Zinc fingerRanBP2-type


Top

FusionGeneSequence for EWSR1_ABR


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_EWSR1_ENST00000332050_chr22_29669853_+_ABR_ENST00000302538_chr17_1028702_-_915aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTDFSYGTDEYDGEGNE
EQKGPPEGSETMPYIDESPTMSPQLSARSQGGGDGVSPTPPEGLAPGVEAGKGLEMRKLVLSGFLASEEIYINQLEALLLPMKPLKATAT
TSQPVLTIQQIETIFYKIQDITEIHKEFTDNLCPKVQQWDSQVTMGHLFQKLASQLGVYKAFVDNTKVALETAEKCSQSNNQFQKISEEL
KVKGPKDSKDSHTSVTMEALLYKPIDRVTRSTLVLHDLLKHTPVDHPDYPLLQDALRISQNFLSSINEDIDPRRTAVTTPKGETRQLVKD
GFLVEVSESSRKLRHVFLFTDVLLCAKLKKTSAGKHQQTDCKWYIPLADLVFPSPEESEASPQVHPFPDHELEDMKMKISALKSEIQKEK
ANKGQSRAIERLKKKMFENEFLLLLNSPTIPFRIHNRNGKSYLFLLSSDYERSEWREAIQKLQKKDLQAFVLSSVELQVLTGSCFKLRTV
HNIPVTSNKDDDESPGLTGFLHVIVHSAKGFKQSANLYCTLEVDSFGTFVSKAKTRVFRDTAEPKWDEEFEIELEGSQSLRILCTEKCTD
KTKVNKDNNEIVDKIMGKGQIQLDPQTVETKNWHTDVIEMNGIKVEFSMKFTSRDMSLKRTPSKKQTGVFGVKISVVTKRERSKVPYIVR
QCVEEVEKRGIEEVGIYRISGVATDIQALKAVFDANNKDILLMLSDMDINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKEN
CMMHLLRSLPDPNLITFLFLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRPSEVESKAHLTSAADIWSHDVMAQVQVLLYYLQHPPISF

>In-frame_EWSR1_ENST00000397938_chr22_29669853_+_ABR_ENST00000302538_chr17_1028702_-_915aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTDFSYGTDEYDGEGNE
EQKGPPEGSETMPYIDESPTMSPQLSARSQGGGDGVSPTPPEGLAPGVEAGKGLEMRKLVLSGFLASEEIYINQLEALLLPMKPLKATAT
TSQPVLTIQQIETIFYKIQDITEIHKEFTDNLCPKVQQWDSQVTMGHLFQKLASQLGVYKAFVDNTKVALETAEKCSQSNNQFQKISEEL
KVKGPKDSKDSHTSVTMEALLYKPIDRVTRSTLVLHDLLKHTPVDHPDYPLLQDALRISQNFLSSINEDIDPRRTAVTTPKGETRQLVKD
GFLVEVSESSRKLRHVFLFTDVLLCAKLKKTSAGKHQQTDCKWYIPLADLVFPSPEESEASPQVHPFPDHELEDMKMKISALKSEIQKEK
ANKGQSRAIERLKKKMFENEFLLLLNSPTIPFRIHNRNGKSYLFLLSSDYERSEWREAIQKLQKKDLQAFVLSSVELQVLTGSCFKLRTV
HNIPVTSNKDDDESPGLTGFLHVIVHSAKGFKQSANLYCTLEVDSFGTFVSKAKTRVFRDTAEPKWDEEFEIELEGSQSLRILCTEKCTD
KTKVNKDNNEIVDKIMGKGQIQLDPQTVETKNWHTDVIEMNGIKVEFSMKFTSRDMSLKRTPSKKQTGVFGVKISVVTKRERSKVPYIVR
QCVEEVEKRGIEEVGIYRISGVATDIQALKAVFDANNKDILLMLSDMDINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKEN
CMMHLLRSLPDPNLITFLFLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRPSEVESKAHLTSAADIWSHDVMAQVQVLLYYLQHPPISF

>In-frame_EWSR1_ENST00000406548_chr22_29669853_+_ABR_ENST00000302538_chr17_1028702_-_915aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTDFSYGTDEYDGEGNE
EQKGPPEGSETMPYIDESPTMSPQLSARSQGGGDGVSPTPPEGLAPGVEAGKGLEMRKLVLSGFLASEEIYINQLEALLLPMKPLKATAT
TSQPVLTIQQIETIFYKIQDITEIHKEFTDNLCPKVQQWDSQVTMGHLFQKLASQLGVYKAFVDNTKVALETAEKCSQSNNQFQKISEEL
KVKGPKDSKDSHTSVTMEALLYKPIDRVTRSTLVLHDLLKHTPVDHPDYPLLQDALRISQNFLSSINEDIDPRRTAVTTPKGETRQLVKD
GFLVEVSESSRKLRHVFLFTDVLLCAKLKKTSAGKHQQTDCKWYIPLADLVFPSPEESEASPQVHPFPDHELEDMKMKISALKSEIQKEK
ANKGQSRAIERLKKKMFENEFLLLLNSPTIPFRIHNRNGKSYLFLLSSDYERSEWREAIQKLQKKDLQAFVLSSVELQVLTGSCFKLRTV
HNIPVTSNKDDDESPGLTGFLHVIVHSAKGFKQSANLYCTLEVDSFGTFVSKAKTRVFRDTAEPKWDEEFEIELEGSQSLRILCTEKCTD
KTKVNKDNNEIVDKIMGKGQIQLDPQTVETKNWHTDVIEMNGIKVEFSMKFTSRDMSLKRTPSKKQTGVFGVKISVVTKRERSKVPYIVR
QCVEEVEKRGIEEVGIYRISGVATDIQALKAVFDANNKDILLMLSDMDINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKEN
CMMHLLRSLPDPNLITFLFLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRPSEVESKAHLTSAADIWSHDVMAQVQVLLYYLQHPPISF

>In-frame_EWSR1_ENST00000331029_chr22_29669853_+_ABR_ENST00000302538_chr17_1028702_-_915aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTDFSYGTDEYDGEGNE
EQKGPPEGSETMPYIDESPTMSPQLSARSQGGGDGVSPTPPEGLAPGVEAGKGLEMRKLVLSGFLASEEIYINQLEALLLPMKPLKATAT
TSQPVLTIQQIETIFYKIQDITEIHKEFTDNLCPKVQQWDSQVTMGHLFQKLASQLGVYKAFVDNTKVALETAEKCSQSNNQFQKISEEL
KVKGPKDSKDSHTSVTMEALLYKPIDRVTRSTLVLHDLLKHTPVDHPDYPLLQDALRISQNFLSSINEDIDPRRTAVTTPKGETRQLVKD
GFLVEVSESSRKLRHVFLFTDVLLCAKLKKTSAGKHQQTDCKWYIPLADLVFPSPEESEASPQVHPFPDHELEDMKMKISALKSEIQKEK
ANKGQSRAIERLKKKMFENEFLLLLNSPTIPFRIHNRNGKSYLFLLSSDYERSEWREAIQKLQKKDLQAFVLSSVELQVLTGSCFKLRTV
HNIPVTSNKDDDESPGLTGFLHVIVHSAKGFKQSANLYCTLEVDSFGTFVSKAKTRVFRDTAEPKWDEEFEIELEGSQSLRILCTEKCTD
KTKVNKDNNEIVDKIMGKGQIQLDPQTVETKNWHTDVIEMNGIKVEFSMKFTSRDMSLKRTPSKKQTGVFGVKISVVTKRERSKVPYIVR
QCVEEVEKRGIEEVGIYRISGVATDIQALKAVFDANNKDILLMLSDMDINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKEN
CMMHLLRSLPDPNLITFLFLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRPSEVESKAHLTSAADIWSHDVMAQVQVLLYYLQHPPISF

>In-frame_EWSR1_ENST00000414183_chr22_29669853_+_ABR_ENST00000302538_chr17_1028702_-_915aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTDFSYGTDEYDGEGNE
EQKGPPEGSETMPYIDESPTMSPQLSARSQGGGDGVSPTPPEGLAPGVEAGKGLEMRKLVLSGFLASEEIYINQLEALLLPMKPLKATAT
TSQPVLTIQQIETIFYKIQDITEIHKEFTDNLCPKVQQWDSQVTMGHLFQKLASQLGVYKAFVDNTKVALETAEKCSQSNNQFQKISEEL
KVKGPKDSKDSHTSVTMEALLYKPIDRVTRSTLVLHDLLKHTPVDHPDYPLLQDALRISQNFLSSINEDIDPRRTAVTTPKGETRQLVKD
GFLVEVSESSRKLRHVFLFTDVLLCAKLKKTSAGKHQQTDCKWYIPLADLVFPSPEESEASPQVHPFPDHELEDMKMKISALKSEIQKEK
ANKGQSRAIERLKKKMFENEFLLLLNSPTIPFRIHNRNGKSYLFLLSSDYERSEWREAIQKLQKKDLQAFVLSSVELQVLTGSCFKLRTV
HNIPVTSNKDDDESPGLTGFLHVIVHSAKGFKQSANLYCTLEVDSFGTFVSKAKTRVFRDTAEPKWDEEFEIELEGSQSLRILCTEKCTD
KTKVNKDNNEIVDKIMGKGQIQLDPQTVETKNWHTDVIEMNGIKVEFSMKFTSRDMSLKRTPSKKQTGVFGVKISVVTKRERSKVPYIVR
QCVEEVEKRGIEEVGIYRISGVATDIQALKAVFDANNKDILLMLSDMDINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKEN
CMMHLLRSLPDPNLITFLFLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRPSEVESKAHLTSAADIWSHDVMAQVQVLLYYLQHPPISF

>In-frame_EWSR1_ENST00000333395_chr22_29669853_+_ABR_ENST00000302538_chr17_1028702_-_915aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTDFSYGTDEYDGEGNE
EQKGPPEGSETMPYIDESPTMSPQLSARSQGGGDGVSPTPPEGLAPGVEAGKGLEMRKLVLSGFLASEEIYINQLEALLLPMKPLKATAT
TSQPVLTIQQIETIFYKIQDITEIHKEFTDNLCPKVQQWDSQVTMGHLFQKLASQLGVYKAFVDNTKVALETAEKCSQSNNQFQKISEEL
KVKGPKDSKDSHTSVTMEALLYKPIDRVTRSTLVLHDLLKHTPVDHPDYPLLQDALRISQNFLSSINEDIDPRRTAVTTPKGETRQLVKD
GFLVEVSESSRKLRHVFLFTDVLLCAKLKKTSAGKHQQTDCKWYIPLADLVFPSPEESEASPQVHPFPDHELEDMKMKISALKSEIQKEK
ANKGQSRAIERLKKKMFENEFLLLLNSPTIPFRIHNRNGKSYLFLLSSDYERSEWREAIQKLQKKDLQAFVLSSVELQVLTGSCFKLRTV
HNIPVTSNKDDDESPGLTGFLHVIVHSAKGFKQSANLYCTLEVDSFGTFVSKAKTRVFRDTAEPKWDEEFEIELEGSQSLRILCTEKCTD
KTKVNKDNNEIVDKIMGKGQIQLDPQTVETKNWHTDVIEMNGIKVEFSMKFTSRDMSLKRTPSKKQTGVFGVKISVVTKRERSKVPYIVR
QCVEEVEKRGIEEVGIYRISGVATDIQALKAVFDANNKDILLMLSDMDINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKEN
CMMHLLRSLPDPNLITFLFLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRPSEVESKAHLTSAADIWSHDVMAQVQVLLYYLQHPPISF

>In-frame_EWSR1_ENST00000332035_chr22_29669853_+_ABR_ENST00000302538_chr17_1028702_-_915aa
MASTDYSTTSQAAAQQGYSAYTAQPTQGTAQTTQATGQQSTGTTGQPTDVSTTQAQTTATTGQTATATSTGQPPTDFSYGTDEYDGEGNE
EQKGPPEGSETMPYIDESPTMSPQLSARSQGGGDGVSPTPPEGLAPGVEAGKGLEMRKLVLSGFLASEEIYINQLEALLLPMKPLKATAT
TSQPVLTIQQIETIFYKIQDITEIHKEFTDNLCPKVQQWDSQVTMGHLFQKLASQLGVYKAFVDNTKVALETAEKCSQSNNQFQKISEEL
KVKGPKDSKDSHTSVTMEALLYKPIDRVTRSTLVLHDLLKHTPVDHPDYPLLQDALRISQNFLSSINEDIDPRRTAVTTPKGETRQLVKD
GFLVEVSESSRKLRHVFLFTDVLLCAKLKKTSAGKHQQTDCKWYIPLADLVFPSPEESEASPQVHPFPDHELEDMKMKISALKSEIQKEK
ANKGQSRAIERLKKKMFENEFLLLLNSPTIPFRIHNRNGKSYLFLLSSDYERSEWREAIQKLQKKDLQAFVLSSVELQVLTGSCFKLRTV
HNIPVTSNKDDDESPGLTGFLHVIVHSAKGFKQSANLYCTLEVDSFGTFVSKAKTRVFRDTAEPKWDEEFEIELEGSQSLRILCTEKCTD
KTKVNKDNNEIVDKIMGKGQIQLDPQTVETKNWHTDVIEMNGIKVEFSMKFTSRDMSLKRTPSKKQTGVFGVKISVVTKRERSKVPYIVR
QCVEEVEKRGIEEVGIYRISGVATDIQALKAVFDANNKDILLMLSDMDINAIAGTLKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKEN
CMMHLLRSLPDPNLITFLFLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRPSEVESKAHLTSAADIWSHDVMAQVQVLLYYLQHPPISF


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_EWSR1_ENST00000332050_chr22_29669853_+_ABR_ENST00000302538_chr17_1028702_-_2745nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGACTTCAGCTACGGGACGGACGAGTACGACGGAGAGGGGAATGAG
GAGCAGAAGGGGCCCCCGGAGGGCTCAGAGACCATGCCGTACATCGATGAGTCGCCCACCATGTCCCCGCAGCTCAGCGCCCGCAGCCAG
GGCGGGGGGGATGGCGTCTCCCCGACTCCACCTGAGGGACTGGCTCCTGGGGTGGAAGCAGGGAAAGGCCTGGAGATGAGGAAGCTGGTT
CTCTCGGGGTTCTTGGCCAGCGAAGAGATCTACATTAACCAGCTGGAAGCCCTGTTGCTGCCCATGAAACCCCTGAAGGCCACCGCCACC
ACCTCCCAGCCCGTGCTCACCATCCAGCAGATCGAGACCATCTTCTACAAGATCCAGGACATCTATGAGATCCACAAGGAGTTCTATGAC
AACCTGTGCCCCAAGGTGCAACAGTGGGACAGCCAGGTCACCATGGGCCACCTCTTCCAGAAGCTGGCCAGCCAGCTCGGTGTGTACAAA
GCGTTTGTCGATAACTATAAAGTCGCTCTGGAGACAGCTGAGAAGTGCAGCCAGTCCAACAACCAGTTCCAGAAGATCTCAGAGGAACTC
AAAGTGAAAGGTCCCAAGGACTCCAAGGACAGCCACACGTCTGTCACCATGGAAGCTCTGCTCTACAAGCCCATTGACCGGGTCACTCGG
AGCACCCTAGTCCTACACGACCTGCTGAAGCACACACCTGTGGACCACCCCGACTACCCGCTGCTGCAGGATGCCCTCCGCATCTCCCAG
AACTTCCTGTCCAGCATCAACGAGGACATCGACCCCCGCCGGACTGCAGTGACAACGCCCAAGGGGGAGACGCGACAGCTGGTGAAGGAC
GGCTTCCTGGTGGAAGTGTCAGAGAGCTCCCGGAAGCTGCGGCACGTCTTCCTCTTTACAGATGTCCTACTGTGTGCCAAGCTGAAGAAG
ACCTCTGCAGGGAAGCACCAGCAGTATGACTGTAAGTGGTACATCCCCCTGGCCGACCTGGTGTTTCCATCCCCCGAGGAGTCTGAGGCC
AGCCCCCAGGTGCACCCCTTCCCAGACCATGAGCTGGAGGACATGAAGATGAAGATCTCTGCCCTCAAGAGTGAAATCCAGAAGGAGAAA
GCCAACAAAGGCCAGAGCCGGGCCATCGAGCGCCTGAAGAAGAAGATGTTTGAGAATGAGTTCCTGCTGCTGCTCAACTCCCCCACAATC
CCGTTCAGGATCCACAATCGGAATGGAAAGAGTTACCTGTTCCTACTGTCCTCGGACTACGAGAGGTCAGAGTGGAGAGAAGCAATTCAG
AAACTACAGAAGAAGGATCTCCAGGCCTTTGTCCTGAGCTCAGTGGAGCTCCAGGTGCTCACAGGATCCTGTTTCAAGCTTAGGACTGTA
CACAACATTCCTGTCACCAGCAATAAAGACGACGATGAGTCTCCAGGACTCTATGGCTTCCTTCATGTCATCGTCCACTCTGCCAAGGGA
TTTAAGCAATCAGCCAACCTGTACTGTACCCTGGAGGTGGATTCCTTCGGCTATTTTGTCAGCAAAGCCAAAACCAGGGTGTTCCGGGAC
ACAGCGGAGCCCAAGTGGGATGAGGAGTTTGAGATCGAGCTGGAGGGCTCCCAGTCCCTGAGGATCCTGTGCTATGAGAAGTGCTATGAC
AAGACCAAGGTCAACAAGGACAACAATGAGATCGTGGACAAGATCATGGGCAAAGGACAGATCCAGCTGGACCCACAAACCGTGGAGACC
AAGAACTGGCACACGGACGTGATTGAGATGAACGGGATCAAAGTGGAATTTTCCATGAAATTCACCAGCCGAGATATGAGCCTGAAGAGG
ACCCCGTCCAAAAAGCAGACCGGCGTCTTCGGTGTGAAGATCAGCGTGGTGACGAAGCGGGAGCGCTCCAAGGTGCCCTACATCGTCCGG
CAGTGTGTGGAGGAGGTGGAGAAGAGGGGTATCGAGGAGGTTGGCATCTACAGGATATCGGGCGTGGCCACGGACATCCAGGCGCTCAAG
GCCGTCTTCGATGCCAATAACAAGGACATCCTGCTGATGCTGAGTGACATGGACATCAACGCCATCGCCGGGACGCTCAAGCTGTACTTC
CGGGAACTGCCCGAGCCGCTCCTCACGGACCGACTCTACCCAGCCTTCATGGAGGGCATCGCCCTGTCAGACCCTGCTGCCAAGGAAAAC
TGCATGATGCACCTGCTCCGCTCCCTGCCCGACCCCAACCTCATCACCTTCCTCTTCCTGCTGGAACACTTGAAAAGGGTTGCCGAGAAG
GAGCCCATCAACAAAATGTCACTTCACAACCTGGCTACCGTGTTTGGACCCACGTTACTGAGACCCTCAGAAGTGGAGAGCAAAGCACAC
CTCACCTCGGCTGCGGACATCTGGTCCCATGACGTCATGGCGCAGGTCCAGGTCCTCCTCTACTACCTGCAGCACCCCCCCATTTCCTTC

>In-frame_EWSR1_ENST00000397938_chr22_29669853_+_ABR_ENST00000302538_chr17_1028702_-_2745nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGACTTCAGCTACGGGACGGACGAGTACGACGGAGAGGGGAATGAG
GAGCAGAAGGGGCCCCCGGAGGGCTCAGAGACCATGCCGTACATCGATGAGTCGCCCACCATGTCCCCGCAGCTCAGCGCCCGCAGCCAG
GGCGGGGGGGATGGCGTCTCCCCGACTCCACCTGAGGGACTGGCTCCTGGGGTGGAAGCAGGGAAAGGCCTGGAGATGAGGAAGCTGGTT
CTCTCGGGGTTCTTGGCCAGCGAAGAGATCTACATTAACCAGCTGGAAGCCCTGTTGCTGCCCATGAAACCCCTGAAGGCCACCGCCACC
ACCTCCCAGCCCGTGCTCACCATCCAGCAGATCGAGACCATCTTCTACAAGATCCAGGACATCTATGAGATCCACAAGGAGTTCTATGAC
AACCTGTGCCCCAAGGTGCAACAGTGGGACAGCCAGGTCACCATGGGCCACCTCTTCCAGAAGCTGGCCAGCCAGCTCGGTGTGTACAAA
GCGTTTGTCGATAACTATAAAGTCGCTCTGGAGACAGCTGAGAAGTGCAGCCAGTCCAACAACCAGTTCCAGAAGATCTCAGAGGAACTC
AAAGTGAAAGGTCCCAAGGACTCCAAGGACAGCCACACGTCTGTCACCATGGAAGCTCTGCTCTACAAGCCCATTGACCGGGTCACTCGG
AGCACCCTAGTCCTACACGACCTGCTGAAGCACACACCTGTGGACCACCCCGACTACCCGCTGCTGCAGGATGCCCTCCGCATCTCCCAG
AACTTCCTGTCCAGCATCAACGAGGACATCGACCCCCGCCGGACTGCAGTGACAACGCCCAAGGGGGAGACGCGACAGCTGGTGAAGGAC
GGCTTCCTGGTGGAAGTGTCAGAGAGCTCCCGGAAGCTGCGGCACGTCTTCCTCTTTACAGATGTCCTACTGTGTGCCAAGCTGAAGAAG
ACCTCTGCAGGGAAGCACCAGCAGTATGACTGTAAGTGGTACATCCCCCTGGCCGACCTGGTGTTTCCATCCCCCGAGGAGTCTGAGGCC
AGCCCCCAGGTGCACCCCTTCCCAGACCATGAGCTGGAGGACATGAAGATGAAGATCTCTGCCCTCAAGAGTGAAATCCAGAAGGAGAAA
GCCAACAAAGGCCAGAGCCGGGCCATCGAGCGCCTGAAGAAGAAGATGTTTGAGAATGAGTTCCTGCTGCTGCTCAACTCCCCCACAATC
CCGTTCAGGATCCACAATCGGAATGGAAAGAGTTACCTGTTCCTACTGTCCTCGGACTACGAGAGGTCAGAGTGGAGAGAAGCAATTCAG
AAACTACAGAAGAAGGATCTCCAGGCCTTTGTCCTGAGCTCAGTGGAGCTCCAGGTGCTCACAGGATCCTGTTTCAAGCTTAGGACTGTA
CACAACATTCCTGTCACCAGCAATAAAGACGACGATGAGTCTCCAGGACTCTATGGCTTCCTTCATGTCATCGTCCACTCTGCCAAGGGA
TTTAAGCAATCAGCCAACCTGTACTGTACCCTGGAGGTGGATTCCTTCGGCTATTTTGTCAGCAAAGCCAAAACCAGGGTGTTCCGGGAC
ACAGCGGAGCCCAAGTGGGATGAGGAGTTTGAGATCGAGCTGGAGGGCTCCCAGTCCCTGAGGATCCTGTGCTATGAGAAGTGCTATGAC
AAGACCAAGGTCAACAAGGACAACAATGAGATCGTGGACAAGATCATGGGCAAAGGACAGATCCAGCTGGACCCACAAACCGTGGAGACC
AAGAACTGGCACACGGACGTGATTGAGATGAACGGGATCAAAGTGGAATTTTCCATGAAATTCACCAGCCGAGATATGAGCCTGAAGAGG
ACCCCGTCCAAAAAGCAGACCGGCGTCTTCGGTGTGAAGATCAGCGTGGTGACGAAGCGGGAGCGCTCCAAGGTGCCCTACATCGTCCGG
CAGTGTGTGGAGGAGGTGGAGAAGAGGGGTATCGAGGAGGTTGGCATCTACAGGATATCGGGCGTGGCCACGGACATCCAGGCGCTCAAG
GCCGTCTTCGATGCCAATAACAAGGACATCCTGCTGATGCTGAGTGACATGGACATCAACGCCATCGCCGGGACGCTCAAGCTGTACTTC
CGGGAACTGCCCGAGCCGCTCCTCACGGACCGACTCTACCCAGCCTTCATGGAGGGCATCGCCCTGTCAGACCCTGCTGCCAAGGAAAAC
TGCATGATGCACCTGCTCCGCTCCCTGCCCGACCCCAACCTCATCACCTTCCTCTTCCTGCTGGAACACTTGAAAAGGGTTGCCGAGAAG
GAGCCCATCAACAAAATGTCACTTCACAACCTGGCTACCGTGTTTGGACCCACGTTACTGAGACCCTCAGAAGTGGAGAGCAAAGCACAC
CTCACCTCGGCTGCGGACATCTGGTCCCATGACGTCATGGCGCAGGTCCAGGTCCTCCTCTACTACCTGCAGCACCCCCCCATTTCCTTC

>In-frame_EWSR1_ENST00000406548_chr22_29669853_+_ABR_ENST00000302538_chr17_1028702_-_2745nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGACTTCAGCTACGGGACGGACGAGTACGACGGAGAGGGGAATGAG
GAGCAGAAGGGGCCCCCGGAGGGCTCAGAGACCATGCCGTACATCGATGAGTCGCCCACCATGTCCCCGCAGCTCAGCGCCCGCAGCCAG
GGCGGGGGGGATGGCGTCTCCCCGACTCCACCTGAGGGACTGGCTCCTGGGGTGGAAGCAGGGAAAGGCCTGGAGATGAGGAAGCTGGTT
CTCTCGGGGTTCTTGGCCAGCGAAGAGATCTACATTAACCAGCTGGAAGCCCTGTTGCTGCCCATGAAACCCCTGAAGGCCACCGCCACC
ACCTCCCAGCCCGTGCTCACCATCCAGCAGATCGAGACCATCTTCTACAAGATCCAGGACATCTATGAGATCCACAAGGAGTTCTATGAC
AACCTGTGCCCCAAGGTGCAACAGTGGGACAGCCAGGTCACCATGGGCCACCTCTTCCAGAAGCTGGCCAGCCAGCTCGGTGTGTACAAA
GCGTTTGTCGATAACTATAAAGTCGCTCTGGAGACAGCTGAGAAGTGCAGCCAGTCCAACAACCAGTTCCAGAAGATCTCAGAGGAACTC
AAAGTGAAAGGTCCCAAGGACTCCAAGGACAGCCACACGTCTGTCACCATGGAAGCTCTGCTCTACAAGCCCATTGACCGGGTCACTCGG
AGCACCCTAGTCCTACACGACCTGCTGAAGCACACACCTGTGGACCACCCCGACTACCCGCTGCTGCAGGATGCCCTCCGCATCTCCCAG
AACTTCCTGTCCAGCATCAACGAGGACATCGACCCCCGCCGGACTGCAGTGACAACGCCCAAGGGGGAGACGCGACAGCTGGTGAAGGAC
GGCTTCCTGGTGGAAGTGTCAGAGAGCTCCCGGAAGCTGCGGCACGTCTTCCTCTTTACAGATGTCCTACTGTGTGCCAAGCTGAAGAAG
ACCTCTGCAGGGAAGCACCAGCAGTATGACTGTAAGTGGTACATCCCCCTGGCCGACCTGGTGTTTCCATCCCCCGAGGAGTCTGAGGCC
AGCCCCCAGGTGCACCCCTTCCCAGACCATGAGCTGGAGGACATGAAGATGAAGATCTCTGCCCTCAAGAGTGAAATCCAGAAGGAGAAA
GCCAACAAAGGCCAGAGCCGGGCCATCGAGCGCCTGAAGAAGAAGATGTTTGAGAATGAGTTCCTGCTGCTGCTCAACTCCCCCACAATC
CCGTTCAGGATCCACAATCGGAATGGAAAGAGTTACCTGTTCCTACTGTCCTCGGACTACGAGAGGTCAGAGTGGAGAGAAGCAATTCAG
AAACTACAGAAGAAGGATCTCCAGGCCTTTGTCCTGAGCTCAGTGGAGCTCCAGGTGCTCACAGGATCCTGTTTCAAGCTTAGGACTGTA
CACAACATTCCTGTCACCAGCAATAAAGACGACGATGAGTCTCCAGGACTCTATGGCTTCCTTCATGTCATCGTCCACTCTGCCAAGGGA
TTTAAGCAATCAGCCAACCTGTACTGTACCCTGGAGGTGGATTCCTTCGGCTATTTTGTCAGCAAAGCCAAAACCAGGGTGTTCCGGGAC
ACAGCGGAGCCCAAGTGGGATGAGGAGTTTGAGATCGAGCTGGAGGGCTCCCAGTCCCTGAGGATCCTGTGCTATGAGAAGTGCTATGAC
AAGACCAAGGTCAACAAGGACAACAATGAGATCGTGGACAAGATCATGGGCAAAGGACAGATCCAGCTGGACCCACAAACCGTGGAGACC
AAGAACTGGCACACGGACGTGATTGAGATGAACGGGATCAAAGTGGAATTTTCCATGAAATTCACCAGCCGAGATATGAGCCTGAAGAGG
ACCCCGTCCAAAAAGCAGACCGGCGTCTTCGGTGTGAAGATCAGCGTGGTGACGAAGCGGGAGCGCTCCAAGGTGCCCTACATCGTCCGG
CAGTGTGTGGAGGAGGTGGAGAAGAGGGGTATCGAGGAGGTTGGCATCTACAGGATATCGGGCGTGGCCACGGACATCCAGGCGCTCAAG
GCCGTCTTCGATGCCAATAACAAGGACATCCTGCTGATGCTGAGTGACATGGACATCAACGCCATCGCCGGGACGCTCAAGCTGTACTTC
CGGGAACTGCCCGAGCCGCTCCTCACGGACCGACTCTACCCAGCCTTCATGGAGGGCATCGCCCTGTCAGACCCTGCTGCCAAGGAAAAC
TGCATGATGCACCTGCTCCGCTCCCTGCCCGACCCCAACCTCATCACCTTCCTCTTCCTGCTGGAACACTTGAAAAGGGTTGCCGAGAAG
GAGCCCATCAACAAAATGTCACTTCACAACCTGGCTACCGTGTTTGGACCCACGTTACTGAGACCCTCAGAAGTGGAGAGCAAAGCACAC
CTCACCTCGGCTGCGGACATCTGGTCCCATGACGTCATGGCGCAGGTCCAGGTCCTCCTCTACTACCTGCAGCACCCCCCCATTTCCTTC

>In-frame_EWSR1_ENST00000331029_chr22_29669853_+_ABR_ENST00000302538_chr17_1028702_-_2745nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGACTTCAGCTACGGGACGGACGAGTACGACGGAGAGGGGAATGAG
GAGCAGAAGGGGCCCCCGGAGGGCTCAGAGACCATGCCGTACATCGATGAGTCGCCCACCATGTCCCCGCAGCTCAGCGCCCGCAGCCAG
GGCGGGGGGGATGGCGTCTCCCCGACTCCACCTGAGGGACTGGCTCCTGGGGTGGAAGCAGGGAAAGGCCTGGAGATGAGGAAGCTGGTT
CTCTCGGGGTTCTTGGCCAGCGAAGAGATCTACATTAACCAGCTGGAAGCCCTGTTGCTGCCCATGAAACCCCTGAAGGCCACCGCCACC
ACCTCCCAGCCCGTGCTCACCATCCAGCAGATCGAGACCATCTTCTACAAGATCCAGGACATCTATGAGATCCACAAGGAGTTCTATGAC
AACCTGTGCCCCAAGGTGCAACAGTGGGACAGCCAGGTCACCATGGGCCACCTCTTCCAGAAGCTGGCCAGCCAGCTCGGTGTGTACAAA
GCGTTTGTCGATAACTATAAAGTCGCTCTGGAGACAGCTGAGAAGTGCAGCCAGTCCAACAACCAGTTCCAGAAGATCTCAGAGGAACTC
AAAGTGAAAGGTCCCAAGGACTCCAAGGACAGCCACACGTCTGTCACCATGGAAGCTCTGCTCTACAAGCCCATTGACCGGGTCACTCGG
AGCACCCTAGTCCTACACGACCTGCTGAAGCACACACCTGTGGACCACCCCGACTACCCGCTGCTGCAGGATGCCCTCCGCATCTCCCAG
AACTTCCTGTCCAGCATCAACGAGGACATCGACCCCCGCCGGACTGCAGTGACAACGCCCAAGGGGGAGACGCGACAGCTGGTGAAGGAC
GGCTTCCTGGTGGAAGTGTCAGAGAGCTCCCGGAAGCTGCGGCACGTCTTCCTCTTTACAGATGTCCTACTGTGTGCCAAGCTGAAGAAG
ACCTCTGCAGGGAAGCACCAGCAGTATGACTGTAAGTGGTACATCCCCCTGGCCGACCTGGTGTTTCCATCCCCCGAGGAGTCTGAGGCC
AGCCCCCAGGTGCACCCCTTCCCAGACCATGAGCTGGAGGACATGAAGATGAAGATCTCTGCCCTCAAGAGTGAAATCCAGAAGGAGAAA
GCCAACAAAGGCCAGAGCCGGGCCATCGAGCGCCTGAAGAAGAAGATGTTTGAGAATGAGTTCCTGCTGCTGCTCAACTCCCCCACAATC
CCGTTCAGGATCCACAATCGGAATGGAAAGAGTTACCTGTTCCTACTGTCCTCGGACTACGAGAGGTCAGAGTGGAGAGAAGCAATTCAG
AAACTACAGAAGAAGGATCTCCAGGCCTTTGTCCTGAGCTCAGTGGAGCTCCAGGTGCTCACAGGATCCTGTTTCAAGCTTAGGACTGTA
CACAACATTCCTGTCACCAGCAATAAAGACGACGATGAGTCTCCAGGACTCTATGGCTTCCTTCATGTCATCGTCCACTCTGCCAAGGGA
TTTAAGCAATCAGCCAACCTGTACTGTACCCTGGAGGTGGATTCCTTCGGCTATTTTGTCAGCAAAGCCAAAACCAGGGTGTTCCGGGAC
ACAGCGGAGCCCAAGTGGGATGAGGAGTTTGAGATCGAGCTGGAGGGCTCCCAGTCCCTGAGGATCCTGTGCTATGAGAAGTGCTATGAC
AAGACCAAGGTCAACAAGGACAACAATGAGATCGTGGACAAGATCATGGGCAAAGGACAGATCCAGCTGGACCCACAAACCGTGGAGACC
AAGAACTGGCACACGGACGTGATTGAGATGAACGGGATCAAAGTGGAATTTTCCATGAAATTCACCAGCCGAGATATGAGCCTGAAGAGG
ACCCCGTCCAAAAAGCAGACCGGCGTCTTCGGTGTGAAGATCAGCGTGGTGACGAAGCGGGAGCGCTCCAAGGTGCCCTACATCGTCCGG
CAGTGTGTGGAGGAGGTGGAGAAGAGGGGTATCGAGGAGGTTGGCATCTACAGGATATCGGGCGTGGCCACGGACATCCAGGCGCTCAAG
GCCGTCTTCGATGCCAATAACAAGGACATCCTGCTGATGCTGAGTGACATGGACATCAACGCCATCGCCGGGACGCTCAAGCTGTACTTC
CGGGAACTGCCCGAGCCGCTCCTCACGGACCGACTCTACCCAGCCTTCATGGAGGGCATCGCCCTGTCAGACCCTGCTGCCAAGGAAAAC
TGCATGATGCACCTGCTCCGCTCCCTGCCCGACCCCAACCTCATCACCTTCCTCTTCCTGCTGGAACACTTGAAAAGGGTTGCCGAGAAG
GAGCCCATCAACAAAATGTCACTTCACAACCTGGCTACCGTGTTTGGACCCACGTTACTGAGACCCTCAGAAGTGGAGAGCAAAGCACAC
CTCACCTCGGCTGCGGACATCTGGTCCCATGACGTCATGGCGCAGGTCCAGGTCCTCCTCTACTACCTGCAGCACCCCCCCATTTCCTTC

>In-frame_EWSR1_ENST00000414183_chr22_29669853_+_ABR_ENST00000302538_chr17_1028702_-_2745nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGACTTCAGCTACGGGACGGACGAGTACGACGGAGAGGGGAATGAG
GAGCAGAAGGGGCCCCCGGAGGGCTCAGAGACCATGCCGTACATCGATGAGTCGCCCACCATGTCCCCGCAGCTCAGCGCCCGCAGCCAG
GGCGGGGGGGATGGCGTCTCCCCGACTCCACCTGAGGGACTGGCTCCTGGGGTGGAAGCAGGGAAAGGCCTGGAGATGAGGAAGCTGGTT
CTCTCGGGGTTCTTGGCCAGCGAAGAGATCTACATTAACCAGCTGGAAGCCCTGTTGCTGCCCATGAAACCCCTGAAGGCCACCGCCACC
ACCTCCCAGCCCGTGCTCACCATCCAGCAGATCGAGACCATCTTCTACAAGATCCAGGACATCTATGAGATCCACAAGGAGTTCTATGAC
AACCTGTGCCCCAAGGTGCAACAGTGGGACAGCCAGGTCACCATGGGCCACCTCTTCCAGAAGCTGGCCAGCCAGCTCGGTGTGTACAAA
GCGTTTGTCGATAACTATAAAGTCGCTCTGGAGACAGCTGAGAAGTGCAGCCAGTCCAACAACCAGTTCCAGAAGATCTCAGAGGAACTC
AAAGTGAAAGGTCCCAAGGACTCCAAGGACAGCCACACGTCTGTCACCATGGAAGCTCTGCTCTACAAGCCCATTGACCGGGTCACTCGG
AGCACCCTAGTCCTACACGACCTGCTGAAGCACACACCTGTGGACCACCCCGACTACCCGCTGCTGCAGGATGCCCTCCGCATCTCCCAG
AACTTCCTGTCCAGCATCAACGAGGACATCGACCCCCGCCGGACTGCAGTGACAACGCCCAAGGGGGAGACGCGACAGCTGGTGAAGGAC
GGCTTCCTGGTGGAAGTGTCAGAGAGCTCCCGGAAGCTGCGGCACGTCTTCCTCTTTACAGATGTCCTACTGTGTGCCAAGCTGAAGAAG
ACCTCTGCAGGGAAGCACCAGCAGTATGACTGTAAGTGGTACATCCCCCTGGCCGACCTGGTGTTTCCATCCCCCGAGGAGTCTGAGGCC
AGCCCCCAGGTGCACCCCTTCCCAGACCATGAGCTGGAGGACATGAAGATGAAGATCTCTGCCCTCAAGAGTGAAATCCAGAAGGAGAAA
GCCAACAAAGGCCAGAGCCGGGCCATCGAGCGCCTGAAGAAGAAGATGTTTGAGAATGAGTTCCTGCTGCTGCTCAACTCCCCCACAATC
CCGTTCAGGATCCACAATCGGAATGGAAAGAGTTACCTGTTCCTACTGTCCTCGGACTACGAGAGGTCAGAGTGGAGAGAAGCAATTCAG
AAACTACAGAAGAAGGATCTCCAGGCCTTTGTCCTGAGCTCAGTGGAGCTCCAGGTGCTCACAGGATCCTGTTTCAAGCTTAGGACTGTA
CACAACATTCCTGTCACCAGCAATAAAGACGACGATGAGTCTCCAGGACTCTATGGCTTCCTTCATGTCATCGTCCACTCTGCCAAGGGA
TTTAAGCAATCAGCCAACCTGTACTGTACCCTGGAGGTGGATTCCTTCGGCTATTTTGTCAGCAAAGCCAAAACCAGGGTGTTCCGGGAC
ACAGCGGAGCCCAAGTGGGATGAGGAGTTTGAGATCGAGCTGGAGGGCTCCCAGTCCCTGAGGATCCTGTGCTATGAGAAGTGCTATGAC
AAGACCAAGGTCAACAAGGACAACAATGAGATCGTGGACAAGATCATGGGCAAAGGACAGATCCAGCTGGACCCACAAACCGTGGAGACC
AAGAACTGGCACACGGACGTGATTGAGATGAACGGGATCAAAGTGGAATTTTCCATGAAATTCACCAGCCGAGATATGAGCCTGAAGAGG
ACCCCGTCCAAAAAGCAGACCGGCGTCTTCGGTGTGAAGATCAGCGTGGTGACGAAGCGGGAGCGCTCCAAGGTGCCCTACATCGTCCGG
CAGTGTGTGGAGGAGGTGGAGAAGAGGGGTATCGAGGAGGTTGGCATCTACAGGATATCGGGCGTGGCCACGGACATCCAGGCGCTCAAG
GCCGTCTTCGATGCCAATAACAAGGACATCCTGCTGATGCTGAGTGACATGGACATCAACGCCATCGCCGGGACGCTCAAGCTGTACTTC
CGGGAACTGCCCGAGCCGCTCCTCACGGACCGACTCTACCCAGCCTTCATGGAGGGCATCGCCCTGTCAGACCCTGCTGCCAAGGAAAAC
TGCATGATGCACCTGCTCCGCTCCCTGCCCGACCCCAACCTCATCACCTTCCTCTTCCTGCTGGAACACTTGAAAAGGGTTGCCGAGAAG
GAGCCCATCAACAAAATGTCACTTCACAACCTGGCTACCGTGTTTGGACCCACGTTACTGAGACCCTCAGAAGTGGAGAGCAAAGCACAC
CTCACCTCGGCTGCGGACATCTGGTCCCATGACGTCATGGCGCAGGTCCAGGTCCTCCTCTACTACCTGCAGCACCCCCCCATTTCCTTC

>In-frame_EWSR1_ENST00000333395_chr22_29669853_+_ABR_ENST00000302538_chr17_1028702_-_2745nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGACTTCAGCTACGGGACGGACGAGTACGACGGAGAGGGGAATGAG
GAGCAGAAGGGGCCCCCGGAGGGCTCAGAGACCATGCCGTACATCGATGAGTCGCCCACCATGTCCCCGCAGCTCAGCGCCCGCAGCCAG
GGCGGGGGGGATGGCGTCTCCCCGACTCCACCTGAGGGACTGGCTCCTGGGGTGGAAGCAGGGAAAGGCCTGGAGATGAGGAAGCTGGTT
CTCTCGGGGTTCTTGGCCAGCGAAGAGATCTACATTAACCAGCTGGAAGCCCTGTTGCTGCCCATGAAACCCCTGAAGGCCACCGCCACC
ACCTCCCAGCCCGTGCTCACCATCCAGCAGATCGAGACCATCTTCTACAAGATCCAGGACATCTATGAGATCCACAAGGAGTTCTATGAC
AACCTGTGCCCCAAGGTGCAACAGTGGGACAGCCAGGTCACCATGGGCCACCTCTTCCAGAAGCTGGCCAGCCAGCTCGGTGTGTACAAA
GCGTTTGTCGATAACTATAAAGTCGCTCTGGAGACAGCTGAGAAGTGCAGCCAGTCCAACAACCAGTTCCAGAAGATCTCAGAGGAACTC
AAAGTGAAAGGTCCCAAGGACTCCAAGGACAGCCACACGTCTGTCACCATGGAAGCTCTGCTCTACAAGCCCATTGACCGGGTCACTCGG
AGCACCCTAGTCCTACACGACCTGCTGAAGCACACACCTGTGGACCACCCCGACTACCCGCTGCTGCAGGATGCCCTCCGCATCTCCCAG
AACTTCCTGTCCAGCATCAACGAGGACATCGACCCCCGCCGGACTGCAGTGACAACGCCCAAGGGGGAGACGCGACAGCTGGTGAAGGAC
GGCTTCCTGGTGGAAGTGTCAGAGAGCTCCCGGAAGCTGCGGCACGTCTTCCTCTTTACAGATGTCCTACTGTGTGCCAAGCTGAAGAAG
ACCTCTGCAGGGAAGCACCAGCAGTATGACTGTAAGTGGTACATCCCCCTGGCCGACCTGGTGTTTCCATCCCCCGAGGAGTCTGAGGCC
AGCCCCCAGGTGCACCCCTTCCCAGACCATGAGCTGGAGGACATGAAGATGAAGATCTCTGCCCTCAAGAGTGAAATCCAGAAGGAGAAA
GCCAACAAAGGCCAGAGCCGGGCCATCGAGCGCCTGAAGAAGAAGATGTTTGAGAATGAGTTCCTGCTGCTGCTCAACTCCCCCACAATC
CCGTTCAGGATCCACAATCGGAATGGAAAGAGTTACCTGTTCCTACTGTCCTCGGACTACGAGAGGTCAGAGTGGAGAGAAGCAATTCAG
AAACTACAGAAGAAGGATCTCCAGGCCTTTGTCCTGAGCTCAGTGGAGCTCCAGGTGCTCACAGGATCCTGTTTCAAGCTTAGGACTGTA
CACAACATTCCTGTCACCAGCAATAAAGACGACGATGAGTCTCCAGGACTCTATGGCTTCCTTCATGTCATCGTCCACTCTGCCAAGGGA
TTTAAGCAATCAGCCAACCTGTACTGTACCCTGGAGGTGGATTCCTTCGGCTATTTTGTCAGCAAAGCCAAAACCAGGGTGTTCCGGGAC
ACAGCGGAGCCCAAGTGGGATGAGGAGTTTGAGATCGAGCTGGAGGGCTCCCAGTCCCTGAGGATCCTGTGCTATGAGAAGTGCTATGAC
AAGACCAAGGTCAACAAGGACAACAATGAGATCGTGGACAAGATCATGGGCAAAGGACAGATCCAGCTGGACCCACAAACCGTGGAGACC
AAGAACTGGCACACGGACGTGATTGAGATGAACGGGATCAAAGTGGAATTTTCCATGAAATTCACCAGCCGAGATATGAGCCTGAAGAGG
ACCCCGTCCAAAAAGCAGACCGGCGTCTTCGGTGTGAAGATCAGCGTGGTGACGAAGCGGGAGCGCTCCAAGGTGCCCTACATCGTCCGG
CAGTGTGTGGAGGAGGTGGAGAAGAGGGGTATCGAGGAGGTTGGCATCTACAGGATATCGGGCGTGGCCACGGACATCCAGGCGCTCAAG
GCCGTCTTCGATGCCAATAACAAGGACATCCTGCTGATGCTGAGTGACATGGACATCAACGCCATCGCCGGGACGCTCAAGCTGTACTTC
CGGGAACTGCCCGAGCCGCTCCTCACGGACCGACTCTACCCAGCCTTCATGGAGGGCATCGCCCTGTCAGACCCTGCTGCCAAGGAAAAC
TGCATGATGCACCTGCTCCGCTCCCTGCCCGACCCCAACCTCATCACCTTCCTCTTCCTGCTGGAACACTTGAAAAGGGTTGCCGAGAAG
GAGCCCATCAACAAAATGTCACTTCACAACCTGGCTACCGTGTTTGGACCCACGTTACTGAGACCCTCAGAAGTGGAGAGCAAAGCACAC
CTCACCTCGGCTGCGGACATCTGGTCCCATGACGTCATGGCGCAGGTCCAGGTCCTCCTCTACTACCTGCAGCACCCCCCCATTTCCTTC

>In-frame_EWSR1_ENST00000332035_chr22_29669853_+_ABR_ENST00000302538_chr17_1028702_-_2745nt
ATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCA
CAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACC
TATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGACTTCAGCTACGGGACGGACGAGTACGACGGAGAGGGGAATGAG
GAGCAGAAGGGGCCCCCGGAGGGCTCAGAGACCATGCCGTACATCGATGAGTCGCCCACCATGTCCCCGCAGCTCAGCGCCCGCAGCCAG
GGCGGGGGGGATGGCGTCTCCCCGACTCCACCTGAGGGACTGGCTCCTGGGGTGGAAGCAGGGAAAGGCCTGGAGATGAGGAAGCTGGTT
CTCTCGGGGTTCTTGGCCAGCGAAGAGATCTACATTAACCAGCTGGAAGCCCTGTTGCTGCCCATGAAACCCCTGAAGGCCACCGCCACC
ACCTCCCAGCCCGTGCTCACCATCCAGCAGATCGAGACCATCTTCTACAAGATCCAGGACATCTATGAGATCCACAAGGAGTTCTATGAC
AACCTGTGCCCCAAGGTGCAACAGTGGGACAGCCAGGTCACCATGGGCCACCTCTTCCAGAAGCTGGCCAGCCAGCTCGGTGTGTACAAA
GCGTTTGTCGATAACTATAAAGTCGCTCTGGAGACAGCTGAGAAGTGCAGCCAGTCCAACAACCAGTTCCAGAAGATCTCAGAGGAACTC
AAAGTGAAAGGTCCCAAGGACTCCAAGGACAGCCACACGTCTGTCACCATGGAAGCTCTGCTCTACAAGCCCATTGACCGGGTCACTCGG
AGCACCCTAGTCCTACACGACCTGCTGAAGCACACACCTGTGGACCACCCCGACTACCCGCTGCTGCAGGATGCCCTCCGCATCTCCCAG
AACTTCCTGTCCAGCATCAACGAGGACATCGACCCCCGCCGGACTGCAGTGACAACGCCCAAGGGGGAGACGCGACAGCTGGTGAAGGAC
GGCTTCCTGGTGGAAGTGTCAGAGAGCTCCCGGAAGCTGCGGCACGTCTTCCTCTTTACAGATGTCCTACTGTGTGCCAAGCTGAAGAAG
ACCTCTGCAGGGAAGCACCAGCAGTATGACTGTAAGTGGTACATCCCCCTGGCCGACCTGGTGTTTCCATCCCCCGAGGAGTCTGAGGCC
AGCCCCCAGGTGCACCCCTTCCCAGACCATGAGCTGGAGGACATGAAGATGAAGATCTCTGCCCTCAAGAGTGAAATCCAGAAGGAGAAA
GCCAACAAAGGCCAGAGCCGGGCCATCGAGCGCCTGAAGAAGAAGATGTTTGAGAATGAGTTCCTGCTGCTGCTCAACTCCCCCACAATC
CCGTTCAGGATCCACAATCGGAATGGAAAGAGTTACCTGTTCCTACTGTCCTCGGACTACGAGAGGTCAGAGTGGAGAGAAGCAATTCAG
AAACTACAGAAGAAGGATCTCCAGGCCTTTGTCCTGAGCTCAGTGGAGCTCCAGGTGCTCACAGGATCCTGTTTCAAGCTTAGGACTGTA
CACAACATTCCTGTCACCAGCAATAAAGACGACGATGAGTCTCCAGGACTCTATGGCTTCCTTCATGTCATCGTCCACTCTGCCAAGGGA
TTTAAGCAATCAGCCAACCTGTACTGTACCCTGGAGGTGGATTCCTTCGGCTATTTTGTCAGCAAAGCCAAAACCAGGGTGTTCCGGGAC
ACAGCGGAGCCCAAGTGGGATGAGGAGTTTGAGATCGAGCTGGAGGGCTCCCAGTCCCTGAGGATCCTGTGCTATGAGAAGTGCTATGAC
AAGACCAAGGTCAACAAGGACAACAATGAGATCGTGGACAAGATCATGGGCAAAGGACAGATCCAGCTGGACCCACAAACCGTGGAGACC
AAGAACTGGCACACGGACGTGATTGAGATGAACGGGATCAAAGTGGAATTTTCCATGAAATTCACCAGCCGAGATATGAGCCTGAAGAGG
ACCCCGTCCAAAAAGCAGACCGGCGTCTTCGGTGTGAAGATCAGCGTGGTGACGAAGCGGGAGCGCTCCAAGGTGCCCTACATCGTCCGG
CAGTGTGTGGAGGAGGTGGAGAAGAGGGGTATCGAGGAGGTTGGCATCTACAGGATATCGGGCGTGGCCACGGACATCCAGGCGCTCAAG
GCCGTCTTCGATGCCAATAACAAGGACATCCTGCTGATGCTGAGTGACATGGACATCAACGCCATCGCCGGGACGCTCAAGCTGTACTTC
CGGGAACTGCCCGAGCCGCTCCTCACGGACCGACTCTACCCAGCCTTCATGGAGGGCATCGCCCTGTCAGACCCTGCTGCCAAGGAAAAC
TGCATGATGCACCTGCTCCGCTCCCTGCCCGACCCCAACCTCATCACCTTCCTCTTCCTGCTGGAACACTTGAAAAGGGTTGCCGAGAAG
GAGCCCATCAACAAAATGTCACTTCACAACCTGGCTACCGTGTTTGGACCCACGTTACTGAGACCCTCAGAAGTGGAGAGCAAAGCACAC
CTCACCTCGGCTGCGGACATCTGGTCCCATGACGTCATGGCGCAGGTCCAGGTCCTCCTCTACTACCTGCAGCACCCCCCCATTTCCTTC


* Fusion transcript sequences (Full-length transcript).
>In-frame_EWSR1_ENST00000332050_chr22_29669853_+_ABR_ENST00000302538_chr17_1028702_-_5635nt
AGAGCCAGCGGACGGAACCATTCCAAACAGCCTAGTCTCGTGCTGAGAGCCTCTCCGGTTTCACGCTGAGACCCGCTCACCCCCGCTCTG
GCCCCTTAGATGCTATTTTGGCCCGAGTGTCACGTCGGGCGCTCTTTAGAGAGGACTGGGACAAGAGTTGCGGACGCGAAGAACGAGTAA
GCGGTGGTTCATCCCTCCTGACCCCACCCCCGTGGCCTGGCCCGATGGTCGCGCCCGGGGTTGCGAGATTTGCGCCTGCGCAGTGCGGCG
CCTAGAGGGAAAGCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCA
AGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTA
TGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGG
ACAGCCTCCCACTGACTTCAGCTACGGGACGGACGAGTACGACGGAGAGGGGAATGAGGAGCAGAAGGGGCCCCCGGAGGGCTCAGAGAC
CATGCCGTACATCGATGAGTCGCCCACCATGTCCCCGCAGCTCAGCGCCCGCAGCCAGGGCGGGGGGGATGGCGTCTCCCCGACTCCACC
TGAGGGACTGGCTCCTGGGGTGGAAGCAGGGAAAGGCCTGGAGATGAGGAAGCTGGTTCTCTCGGGGTTCTTGGCCAGCGAAGAGATCTA
CATTAACCAGCTGGAAGCCCTGTTGCTGCCCATGAAACCCCTGAAGGCCACCGCCACCACCTCCCAGCCCGTGCTCACCATCCAGCAGAT
CGAGACCATCTTCTACAAGATCCAGGACATCTATGAGATCCACAAGGAGTTCTATGACAACCTGTGCCCCAAGGTGCAACAGTGGGACAG
CCAGGTCACCATGGGCCACCTCTTCCAGAAGCTGGCCAGCCAGCTCGGTGTGTACAAAGCGTTTGTCGATAACTATAAAGTCGCTCTGGA
GACAGCTGAGAAGTGCAGCCAGTCCAACAACCAGTTCCAGAAGATCTCAGAGGAACTCAAAGTGAAAGGTCCCAAGGACTCCAAGGACAG
CCACACGTCTGTCACCATGGAAGCTCTGCTCTACAAGCCCATTGACCGGGTCACTCGGAGCACCCTAGTCCTACACGACCTGCTGAAGCA
CACACCTGTGGACCACCCCGACTACCCGCTGCTGCAGGATGCCCTCCGCATCTCCCAGAACTTCCTGTCCAGCATCAACGAGGACATCGA
CCCCCGCCGGACTGCAGTGACAACGCCCAAGGGGGAGACGCGACAGCTGGTGAAGGACGGCTTCCTGGTGGAAGTGTCAGAGAGCTCCCG
GAAGCTGCGGCACGTCTTCCTCTTTACAGATGTCCTACTGTGTGCCAAGCTGAAGAAGACCTCTGCAGGGAAGCACCAGCAGTATGACTG
TAAGTGGTACATCCCCCTGGCCGACCTGGTGTTTCCATCCCCCGAGGAGTCTGAGGCCAGCCCCCAGGTGCACCCCTTCCCAGACCATGA
GCTGGAGGACATGAAGATGAAGATCTCTGCCCTCAAGAGTGAAATCCAGAAGGAGAAAGCCAACAAAGGCCAGAGCCGGGCCATCGAGCG
CCTGAAGAAGAAGATGTTTGAGAATGAGTTCCTGCTGCTGCTCAACTCCCCCACAATCCCGTTCAGGATCCACAATCGGAATGGAAAGAG
TTACCTGTTCCTACTGTCCTCGGACTACGAGAGGTCAGAGTGGAGAGAAGCAATTCAGAAACTACAGAAGAAGGATCTCCAGGCCTTTGT
CCTGAGCTCAGTGGAGCTCCAGGTGCTCACAGGATCCTGTTTCAAGCTTAGGACTGTACACAACATTCCTGTCACCAGCAATAAAGACGA
CGATGAGTCTCCAGGACTCTATGGCTTCCTTCATGTCATCGTCCACTCTGCCAAGGGATTTAAGCAATCAGCCAACCTGTACTGTACCCT
GGAGGTGGATTCCTTCGGCTATTTTGTCAGCAAAGCCAAAACCAGGGTGTTCCGGGACACAGCGGAGCCCAAGTGGGATGAGGAGTTTGA
GATCGAGCTGGAGGGCTCCCAGTCCCTGAGGATCCTGTGCTATGAGAAGTGCTATGACAAGACCAAGGTCAACAAGGACAACAATGAGAT
CGTGGACAAGATCATGGGCAAAGGACAGATCCAGCTGGACCCACAAACCGTGGAGACCAAGAACTGGCACACGGACGTGATTGAGATGAA
CGGGATCAAAGTGGAATTTTCCATGAAATTCACCAGCCGAGATATGAGCCTGAAGAGGACCCCGTCCAAAAAGCAGACCGGCGTCTTCGG
TGTGAAGATCAGCGTGGTGACGAAGCGGGAGCGCTCCAAGGTGCCCTACATCGTCCGGCAGTGTGTGGAGGAGGTGGAGAAGAGGGGTAT
CGAGGAGGTTGGCATCTACAGGATATCGGGCGTGGCCACGGACATCCAGGCGCTCAAGGCCGTCTTCGATGCCAATAACAAGGACATCCT
GCTGATGCTGAGTGACATGGACATCAACGCCATCGCCGGGACGCTCAAGCTGTACTTCCGGGAACTGCCCGAGCCGCTCCTCACGGACCG
ACTCTACCCAGCCTTCATGGAGGGCATCGCCCTGTCAGACCCTGCTGCCAAGGAAAACTGCATGATGCACCTGCTCCGCTCCCTGCCCGA
CCCCAACCTCATCACCTTCCTCTTCCTGCTGGAACACTTGAAAAGGGTTGCCGAGAAGGAGCCCATCAACAAAATGTCACTTCACAACCT
GGCTACCGTGTTTGGACCCACGTTACTGAGACCCTCAGAAGTGGAGAGCAAAGCACACCTCACCTCGGCTGCGGACATCTGGTCCCATGA
CGTCATGGCGCAGGTCCAGGTCCTCCTCTACTACCTGCAGCACCCCCCCATTTCCTTCGCAGAACTCAAGCGGAACACACTGTACTTCTC
CACCGACGTGTAGCCCGAGGCAGGGTGGCTGCGGGCGGGTGGTGGAACCAGCCCCTCCAGCCTGGGGTCCAACTCAGACTTGAAAGACTG
CAATAGAAAACTCCCAAACCCAGCACTCCAGACTCGAGGGAAGCCAGCTTCCAAGAACTGGAATGCGTACGTCTTTTGTGCCACCTTGTA
CAAAGCCGGCTGCCCAGCCCCAGCCTCACCACCGCATCCCACCTCCTGCCCTCCATACCTCTAGTTGTGTCTGATGCTCCGTGCTGTTCG
GGAATTGTTTTATGTACACTTGTCAGGCAGAAAAGGTAGTGACCGGCCCGGCGTGGGCACACAGACAGCCCGCTTTGTTCTTTCATTTCC
TCCAGCACTTTCTTTCCGCCTGAGTCCAGCCCAAGGCCTTTTATTTTGCGCTGTGTAACTGCTGCCAGCTTCTCTCTTGGCCCTGCTCCC
AGATGGCGGTCTCCTGGCAGCCTCCCCTCAGTCTTCCTCCACCCGCTCTTCCTTCCCAGCCTGCCTGCATGCATGTGCACCCTTGGTCTT
CGCTCCATCGCCTTGAAAGCTCTGAAGAGGCCCTGGGTTGCCGCGGCAGCAGTGGTCTGTTTGATGCTGCCGTTTGCCGCTGCCGGCCCC
TCCTCAGACTCCGCCTTTGGGAGCACACCTGCTTTGCCTTGCTGCCTGTGCAAATGTTGGACAAGCAGACACACTCACACTCGTCCCCAG
CTTAGCACAGAGCTGGAGCGCCCATTTCTGGAATTTTCCGTTTGGGAATCTCCACTTCTGGGGTTTACCTGTTCGGCCTCCTGTCTATCA
GTGAGGCATCTCTGACTGTTTCTTCTACTGCTTTTCAGTTCCCTTCCCTGCTGTTCTATTTCCTTTGAGTGTAAAGACTCACAGGTGACC
TGCTATCGAGATAGCCAGAGGGTCAGGAGAGAATGGGGGAGGAGGCGGTCAGGCTGCTGAGGAAACACCACAGGCTGAACGGGGGAGGAA
TGCACATGCCACGCTGGGTGTCCCGGGTCGCGGGGAGGCAGCTCAGCTCTTAGGAGCAAGTTGTGGGGGCTTTTCAAGAGGGGCCAGGCT
TCCTGGAGGGTGACTGATGTGGCCGAAGCAGGTGTCCAGGCAGGTAGGCTGCAGCCAGGAGCTCCCTGGCACCGCAGGACCTCGTGGTAC
TCTTGCCTTAGATTTTACACACACTCCACAGCCAAGCACTGCCACGGTCCTCCAGGACCTGGGAAGCAAAGGCACAGGCCCACGGTGGCC
AGCCATTGTGGTGCCGCCCCAGCTTCTGGATACAGCCTTTTGGGTAAACACTGGGAACTCCAGAAGTTGTGGGGAGAGTGGGGAATCAGA
CAGCCGCCTCTAGGGGCTGGGTTCTGCTGGGGCCTCCTTGTTGGTGCTGTAGGCACCCGCCAGGGAGCAGGGACCCGACTTGCAGACGCA
TTGCCCGGTACTAGGAAGGAGTGAGGTGTGTTCCCACCGTACACTTCCCACACGAGCTGCGGCTGCCAGCCTCGGGCCATCAGCCTAGGA
GAGCAGATGCAGCTCCAGGGGCTCGACTTATAGCCAGTTACAGCTCCCCGGCTCTTCTGTGTGGCAGAGCGTCGTTTCCGGGCCCTCAGG
GCTGGGGAGCTCAGTTCCCATTGCTTGTGCTCAGGGCTGAGTCTTAAAGAAGGGTTTGCCGGCCCTAACGCTGCAGCGCGTGCGCGGTGA
GAGGCCCTTTTTGAGCCTGTTTACTCCTGTGGCCTTGGGCAGAACAGTAAATACTCTGTGCACGGAGGAAAGACATGCCCAAGAGGAAGG
AAGTACTGACCATCGGCTGCCTGTGAGCAGCTTAGCAAGGAGCCCTTGCTCCCTGGGAAAGGCGGTGAACTTGAGTCTAAAGATGCAGTG
CCTGGCCCTTCCTAAGGTCCCTGCCTGGCATCCGAGTGTCGGTGTGTGGCACAGAAGGCTCCTGCTTGCTTCCAAAGTGATGGACAGGAA
GGGGCAGAGTGAGTCACGGCCCAGACTGGGCACCTTCGCGTCTCAGCCTCAGGGAGCCCCACAGCCCCAAGCTCGCTGAGGCAACGTGAG
AACAGGCTATGGGAAGGCTGCAAAGGCTGAGAAATGCAAAGGCTCATATTTATAAATCCCACCCCCAGAGTGGGGAGGGTCAGGTGCCAG
ACCTGGACTAAACTGCACCAAGGAAACACCCAGCAGGGTCTCCTGTGAGCCGGGGACCATGCAGCCCGAAACCTCCAGTCACTGCGCCCG
GCAGGAGTCAGGAGCCAGGGACTGTGCAGCCTGGAACCTCCAGTCACTGTGCCCAGCAGGGTGGGCTGTGCCCAGCAGGAGTCAGGCTAA
GAAACGCCAGGTCTGCCTGTTCTTGCTGGGCAATGGCTGATGGCTGCCAGTTTCTGCTGATACACAGGTAGGATGGGACCCTTCATGAAT
ATCTGACTTTAATAAGTTGGTAAGGATATATTTTTTTGTCTATGTTCTGTTTCAACTTATGTAGATTATTATAAATTGATGTAAACCACG

>In-frame_EWSR1_ENST00000397938_chr22_29669853_+_ABR_ENST00000302538_chr17_1028702_-_5626nt
GGACGGAACCATTCCAAACAGCCTAGTCTCGTGCTGAGAGCCTCTCCGGTTTCACGCTGAGACCCGCTCACCCCCGCTCTGGCCCCTTAG
ATGCTATTTTGGCCCGAGTGTCACGTCGGGCGCTCTTTAGAGAGGACTGGGACAAGAGTTGCGGACGCGAAGAACGAGTAAGCGGTGGTT
CATCCCTCCTGACCCCACCCCCGTGGCCTGGCCCGATGGTCGCGCCCGGGGTTGCGAGATTTGCGCCTGCGCAGTGCGGCGCCTAGAGGG
AAAGCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGC
GCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTA
TGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCC
CACTGACTTCAGCTACGGGACGGACGAGTACGACGGAGAGGGGAATGAGGAGCAGAAGGGGCCCCCGGAGGGCTCAGAGACCATGCCGTA
CATCGATGAGTCGCCCACCATGTCCCCGCAGCTCAGCGCCCGCAGCCAGGGCGGGGGGGATGGCGTCTCCCCGACTCCACCTGAGGGACT
GGCTCCTGGGGTGGAAGCAGGGAAAGGCCTGGAGATGAGGAAGCTGGTTCTCTCGGGGTTCTTGGCCAGCGAAGAGATCTACATTAACCA
GCTGGAAGCCCTGTTGCTGCCCATGAAACCCCTGAAGGCCACCGCCACCACCTCCCAGCCCGTGCTCACCATCCAGCAGATCGAGACCAT
CTTCTACAAGATCCAGGACATCTATGAGATCCACAAGGAGTTCTATGACAACCTGTGCCCCAAGGTGCAACAGTGGGACAGCCAGGTCAC
CATGGGCCACCTCTTCCAGAAGCTGGCCAGCCAGCTCGGTGTGTACAAAGCGTTTGTCGATAACTATAAAGTCGCTCTGGAGACAGCTGA
GAAGTGCAGCCAGTCCAACAACCAGTTCCAGAAGATCTCAGAGGAACTCAAAGTGAAAGGTCCCAAGGACTCCAAGGACAGCCACACGTC
TGTCACCATGGAAGCTCTGCTCTACAAGCCCATTGACCGGGTCACTCGGAGCACCCTAGTCCTACACGACCTGCTGAAGCACACACCTGT
GGACCACCCCGACTACCCGCTGCTGCAGGATGCCCTCCGCATCTCCCAGAACTTCCTGTCCAGCATCAACGAGGACATCGACCCCCGCCG
GACTGCAGTGACAACGCCCAAGGGGGAGACGCGACAGCTGGTGAAGGACGGCTTCCTGGTGGAAGTGTCAGAGAGCTCCCGGAAGCTGCG
GCACGTCTTCCTCTTTACAGATGTCCTACTGTGTGCCAAGCTGAAGAAGACCTCTGCAGGGAAGCACCAGCAGTATGACTGTAAGTGGTA
CATCCCCCTGGCCGACCTGGTGTTTCCATCCCCCGAGGAGTCTGAGGCCAGCCCCCAGGTGCACCCCTTCCCAGACCATGAGCTGGAGGA
CATGAAGATGAAGATCTCTGCCCTCAAGAGTGAAATCCAGAAGGAGAAAGCCAACAAAGGCCAGAGCCGGGCCATCGAGCGCCTGAAGAA
GAAGATGTTTGAGAATGAGTTCCTGCTGCTGCTCAACTCCCCCACAATCCCGTTCAGGATCCACAATCGGAATGGAAAGAGTTACCTGTT
CCTACTGTCCTCGGACTACGAGAGGTCAGAGTGGAGAGAAGCAATTCAGAAACTACAGAAGAAGGATCTCCAGGCCTTTGTCCTGAGCTC
AGTGGAGCTCCAGGTGCTCACAGGATCCTGTTTCAAGCTTAGGACTGTACACAACATTCCTGTCACCAGCAATAAAGACGACGATGAGTC
TCCAGGACTCTATGGCTTCCTTCATGTCATCGTCCACTCTGCCAAGGGATTTAAGCAATCAGCCAACCTGTACTGTACCCTGGAGGTGGA
TTCCTTCGGCTATTTTGTCAGCAAAGCCAAAACCAGGGTGTTCCGGGACACAGCGGAGCCCAAGTGGGATGAGGAGTTTGAGATCGAGCT
GGAGGGCTCCCAGTCCCTGAGGATCCTGTGCTATGAGAAGTGCTATGACAAGACCAAGGTCAACAAGGACAACAATGAGATCGTGGACAA
GATCATGGGCAAAGGACAGATCCAGCTGGACCCACAAACCGTGGAGACCAAGAACTGGCACACGGACGTGATTGAGATGAACGGGATCAA
AGTGGAATTTTCCATGAAATTCACCAGCCGAGATATGAGCCTGAAGAGGACCCCGTCCAAAAAGCAGACCGGCGTCTTCGGTGTGAAGAT
CAGCGTGGTGACGAAGCGGGAGCGCTCCAAGGTGCCCTACATCGTCCGGCAGTGTGTGGAGGAGGTGGAGAAGAGGGGTATCGAGGAGGT
TGGCATCTACAGGATATCGGGCGTGGCCACGGACATCCAGGCGCTCAAGGCCGTCTTCGATGCCAATAACAAGGACATCCTGCTGATGCT
GAGTGACATGGACATCAACGCCATCGCCGGGACGCTCAAGCTGTACTTCCGGGAACTGCCCGAGCCGCTCCTCACGGACCGACTCTACCC
AGCCTTCATGGAGGGCATCGCCCTGTCAGACCCTGCTGCCAAGGAAAACTGCATGATGCACCTGCTCCGCTCCCTGCCCGACCCCAACCT
CATCACCTTCCTCTTCCTGCTGGAACACTTGAAAAGGGTTGCCGAGAAGGAGCCCATCAACAAAATGTCACTTCACAACCTGGCTACCGT
GTTTGGACCCACGTTACTGAGACCCTCAGAAGTGGAGAGCAAAGCACACCTCACCTCGGCTGCGGACATCTGGTCCCATGACGTCATGGC
GCAGGTCCAGGTCCTCCTCTACTACCTGCAGCACCCCCCCATTTCCTTCGCAGAACTCAAGCGGAACACACTGTACTTCTCCACCGACGT
GTAGCCCGAGGCAGGGTGGCTGCGGGCGGGTGGTGGAACCAGCCCCTCCAGCCTGGGGTCCAACTCAGACTTGAAAGACTGCAATAGAAA
ACTCCCAAACCCAGCACTCCAGACTCGAGGGAAGCCAGCTTCCAAGAACTGGAATGCGTACGTCTTTTGTGCCACCTTGTACAAAGCCGG
CTGCCCAGCCCCAGCCTCACCACCGCATCCCACCTCCTGCCCTCCATACCTCTAGTTGTGTCTGATGCTCCGTGCTGTTCGGGAATTGTT
TTATGTACACTTGTCAGGCAGAAAAGGTAGTGACCGGCCCGGCGTGGGCACACAGACAGCCCGCTTTGTTCTTTCATTTCCTCCAGCACT
TTCTTTCCGCCTGAGTCCAGCCCAAGGCCTTTTATTTTGCGCTGTGTAACTGCTGCCAGCTTCTCTCTTGGCCCTGCTCCCAGATGGCGG
TCTCCTGGCAGCCTCCCCTCAGTCTTCCTCCACCCGCTCTTCCTTCCCAGCCTGCCTGCATGCATGTGCACCCTTGGTCTTCGCTCCATC
GCCTTGAAAGCTCTGAAGAGGCCCTGGGTTGCCGCGGCAGCAGTGGTCTGTTTGATGCTGCCGTTTGCCGCTGCCGGCCCCTCCTCAGAC
TCCGCCTTTGGGAGCACACCTGCTTTGCCTTGCTGCCTGTGCAAATGTTGGACAAGCAGACACACTCACACTCGTCCCCAGCTTAGCACA
GAGCTGGAGCGCCCATTTCTGGAATTTTCCGTTTGGGAATCTCCACTTCTGGGGTTTACCTGTTCGGCCTCCTGTCTATCAGTGAGGCAT
CTCTGACTGTTTCTTCTACTGCTTTTCAGTTCCCTTCCCTGCTGTTCTATTTCCTTTGAGTGTAAAGACTCACAGGTGACCTGCTATCGA
GATAGCCAGAGGGTCAGGAGAGAATGGGGGAGGAGGCGGTCAGGCTGCTGAGGAAACACCACAGGCTGAACGGGGGAGGAATGCACATGC
CACGCTGGGTGTCCCGGGTCGCGGGGAGGCAGCTCAGCTCTTAGGAGCAAGTTGTGGGGGCTTTTCAAGAGGGGCCAGGCTTCCTGGAGG
GTGACTGATGTGGCCGAAGCAGGTGTCCAGGCAGGTAGGCTGCAGCCAGGAGCTCCCTGGCACCGCAGGACCTCGTGGTACTCTTGCCTT
AGATTTTACACACACTCCACAGCCAAGCACTGCCACGGTCCTCCAGGACCTGGGAAGCAAAGGCACAGGCCCACGGTGGCCAGCCATTGT
GGTGCCGCCCCAGCTTCTGGATACAGCCTTTTGGGTAAACACTGGGAACTCCAGAAGTTGTGGGGAGAGTGGGGAATCAGACAGCCGCCT
CTAGGGGCTGGGTTCTGCTGGGGCCTCCTTGTTGGTGCTGTAGGCACCCGCCAGGGAGCAGGGACCCGACTTGCAGACGCATTGCCCGGT
ACTAGGAAGGAGTGAGGTGTGTTCCCACCGTACACTTCCCACACGAGCTGCGGCTGCCAGCCTCGGGCCATCAGCCTAGGAGAGCAGATG
CAGCTCCAGGGGCTCGACTTATAGCCAGTTACAGCTCCCCGGCTCTTCTGTGTGGCAGAGCGTCGTTTCCGGGCCCTCAGGGCTGGGGAG
CTCAGTTCCCATTGCTTGTGCTCAGGGCTGAGTCTTAAAGAAGGGTTTGCCGGCCCTAACGCTGCAGCGCGTGCGCGGTGAGAGGCCCTT
TTTGAGCCTGTTTACTCCTGTGGCCTTGGGCAGAACAGTAAATACTCTGTGCACGGAGGAAAGACATGCCCAAGAGGAAGGAAGTACTGA
CCATCGGCTGCCTGTGAGCAGCTTAGCAAGGAGCCCTTGCTCCCTGGGAAAGGCGGTGAACTTGAGTCTAAAGATGCAGTGCCTGGCCCT
TCCTAAGGTCCCTGCCTGGCATCCGAGTGTCGGTGTGTGGCACAGAAGGCTCCTGCTTGCTTCCAAAGTGATGGACAGGAAGGGGCAGAG
TGAGTCACGGCCCAGACTGGGCACCTTCGCGTCTCAGCCTCAGGGAGCCCCACAGCCCCAAGCTCGCTGAGGCAACGTGAGAACAGGCTA
TGGGAAGGCTGCAAAGGCTGAGAAATGCAAAGGCTCATATTTATAAATCCCACCCCCAGAGTGGGGAGGGTCAGGTGCCAGACCTGGACT
AAACTGCACCAAGGAAACACCCAGCAGGGTCTCCTGTGAGCCGGGGACCATGCAGCCCGAAACCTCCAGTCACTGCGCCCGGCAGGAGTC
AGGAGCCAGGGACTGTGCAGCCTGGAACCTCCAGTCACTGTGCCCAGCAGGGTGGGCTGTGCCCAGCAGGAGTCAGGCTAAGAAACGCCA
GGTCTGCCTGTTCTTGCTGGGCAATGGCTGATGGCTGCCAGTTTCTGCTGATACACAGGTAGGATGGGACCCTTCATGAATATCTGACTT
TAATAAGTTGGTAAGGATATATTTTTTTGTCTATGTTCTGTTTCAACTTATGTAGATTATTATAAATTGATGTAAACCACGTGAGAGGAA

>In-frame_EWSR1_ENST00000406548_chr22_29669853_+_ABR_ENST00000302538_chr17_1028702_-_5371nt
GCGGCGCCTAGAGGGAAAGCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTA
TAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACA
AAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTC
TTATGGACAGCCTCCCACTGACTTCAGCTACGGGACGGACGAGTACGACGGAGAGGGGAATGAGGAGCAGAAGGGGCCCCCGGAGGGCTC
AGAGACCATGCCGTACATCGATGAGTCGCCCACCATGTCCCCGCAGCTCAGCGCCCGCAGCCAGGGCGGGGGGGATGGCGTCTCCCCGAC
TCCACCTGAGGGACTGGCTCCTGGGGTGGAAGCAGGGAAAGGCCTGGAGATGAGGAAGCTGGTTCTCTCGGGGTTCTTGGCCAGCGAAGA
GATCTACATTAACCAGCTGGAAGCCCTGTTGCTGCCCATGAAACCCCTGAAGGCCACCGCCACCACCTCCCAGCCCGTGCTCACCATCCA
GCAGATCGAGACCATCTTCTACAAGATCCAGGACATCTATGAGATCCACAAGGAGTTCTATGACAACCTGTGCCCCAAGGTGCAACAGTG
GGACAGCCAGGTCACCATGGGCCACCTCTTCCAGAAGCTGGCCAGCCAGCTCGGTGTGTACAAAGCGTTTGTCGATAACTATAAAGTCGC
TCTGGAGACAGCTGAGAAGTGCAGCCAGTCCAACAACCAGTTCCAGAAGATCTCAGAGGAACTCAAAGTGAAAGGTCCCAAGGACTCCAA
GGACAGCCACACGTCTGTCACCATGGAAGCTCTGCTCTACAAGCCCATTGACCGGGTCACTCGGAGCACCCTAGTCCTACACGACCTGCT
GAAGCACACACCTGTGGACCACCCCGACTACCCGCTGCTGCAGGATGCCCTCCGCATCTCCCAGAACTTCCTGTCCAGCATCAACGAGGA
CATCGACCCCCGCCGGACTGCAGTGACAACGCCCAAGGGGGAGACGCGACAGCTGGTGAAGGACGGCTTCCTGGTGGAAGTGTCAGAGAG
CTCCCGGAAGCTGCGGCACGTCTTCCTCTTTACAGATGTCCTACTGTGTGCCAAGCTGAAGAAGACCTCTGCAGGGAAGCACCAGCAGTA
TGACTGTAAGTGGTACATCCCCCTGGCCGACCTGGTGTTTCCATCCCCCGAGGAGTCTGAGGCCAGCCCCCAGGTGCACCCCTTCCCAGA
CCATGAGCTGGAGGACATGAAGATGAAGATCTCTGCCCTCAAGAGTGAAATCCAGAAGGAGAAAGCCAACAAAGGCCAGAGCCGGGCCAT
CGAGCGCCTGAAGAAGAAGATGTTTGAGAATGAGTTCCTGCTGCTGCTCAACTCCCCCACAATCCCGTTCAGGATCCACAATCGGAATGG
AAAGAGTTACCTGTTCCTACTGTCCTCGGACTACGAGAGGTCAGAGTGGAGAGAAGCAATTCAGAAACTACAGAAGAAGGATCTCCAGGC
CTTTGTCCTGAGCTCAGTGGAGCTCCAGGTGCTCACAGGATCCTGTTTCAAGCTTAGGACTGTACACAACATTCCTGTCACCAGCAATAA
AGACGACGATGAGTCTCCAGGACTCTATGGCTTCCTTCATGTCATCGTCCACTCTGCCAAGGGATTTAAGCAATCAGCCAACCTGTACTG
TACCCTGGAGGTGGATTCCTTCGGCTATTTTGTCAGCAAAGCCAAAACCAGGGTGTTCCGGGACACAGCGGAGCCCAAGTGGGATGAGGA
GTTTGAGATCGAGCTGGAGGGCTCCCAGTCCCTGAGGATCCTGTGCTATGAGAAGTGCTATGACAAGACCAAGGTCAACAAGGACAACAA
TGAGATCGTGGACAAGATCATGGGCAAAGGACAGATCCAGCTGGACCCACAAACCGTGGAGACCAAGAACTGGCACACGGACGTGATTGA
GATGAACGGGATCAAAGTGGAATTTTCCATGAAATTCACCAGCCGAGATATGAGCCTGAAGAGGACCCCGTCCAAAAAGCAGACCGGCGT
CTTCGGTGTGAAGATCAGCGTGGTGACGAAGCGGGAGCGCTCCAAGGTGCCCTACATCGTCCGGCAGTGTGTGGAGGAGGTGGAGAAGAG
GGGTATCGAGGAGGTTGGCATCTACAGGATATCGGGCGTGGCCACGGACATCCAGGCGCTCAAGGCCGTCTTCGATGCCAATAACAAGGA
CATCCTGCTGATGCTGAGTGACATGGACATCAACGCCATCGCCGGGACGCTCAAGCTGTACTTCCGGGAACTGCCCGAGCCGCTCCTCAC
GGACCGACTCTACCCAGCCTTCATGGAGGGCATCGCCCTGTCAGACCCTGCTGCCAAGGAAAACTGCATGATGCACCTGCTCCGCTCCCT
GCCCGACCCCAACCTCATCACCTTCCTCTTCCTGCTGGAACACTTGAAAAGGGTTGCCGAGAAGGAGCCCATCAACAAAATGTCACTTCA
CAACCTGGCTACCGTGTTTGGACCCACGTTACTGAGACCCTCAGAAGTGGAGAGCAAAGCACACCTCACCTCGGCTGCGGACATCTGGTC
CCATGACGTCATGGCGCAGGTCCAGGTCCTCCTCTACTACCTGCAGCACCCCCCCATTTCCTTCGCAGAACTCAAGCGGAACACACTGTA
CTTCTCCACCGACGTGTAGCCCGAGGCAGGGTGGCTGCGGGCGGGTGGTGGAACCAGCCCCTCCAGCCTGGGGTCCAACTCAGACTTGAA
AGACTGCAATAGAAAACTCCCAAACCCAGCACTCCAGACTCGAGGGAAGCCAGCTTCCAAGAACTGGAATGCGTACGTCTTTTGTGCCAC
CTTGTACAAAGCCGGCTGCCCAGCCCCAGCCTCACCACCGCATCCCACCTCCTGCCCTCCATACCTCTAGTTGTGTCTGATGCTCCGTGC
TGTTCGGGAATTGTTTTATGTACACTTGTCAGGCAGAAAAGGTAGTGACCGGCCCGGCGTGGGCACACAGACAGCCCGCTTTGTTCTTTC
ATTTCCTCCAGCACTTTCTTTCCGCCTGAGTCCAGCCCAAGGCCTTTTATTTTGCGCTGTGTAACTGCTGCCAGCTTCTCTCTTGGCCCT
GCTCCCAGATGGCGGTCTCCTGGCAGCCTCCCCTCAGTCTTCCTCCACCCGCTCTTCCTTCCCAGCCTGCCTGCATGCATGTGCACCCTT
GGTCTTCGCTCCATCGCCTTGAAAGCTCTGAAGAGGCCCTGGGTTGCCGCGGCAGCAGTGGTCTGTTTGATGCTGCCGTTTGCCGCTGCC
GGCCCCTCCTCAGACTCCGCCTTTGGGAGCACACCTGCTTTGCCTTGCTGCCTGTGCAAATGTTGGACAAGCAGACACACTCACACTCGT
CCCCAGCTTAGCACAGAGCTGGAGCGCCCATTTCTGGAATTTTCCGTTTGGGAATCTCCACTTCTGGGGTTTACCTGTTCGGCCTCCTGT
CTATCAGTGAGGCATCTCTGACTGTTTCTTCTACTGCTTTTCAGTTCCCTTCCCTGCTGTTCTATTTCCTTTGAGTGTAAAGACTCACAG
GTGACCTGCTATCGAGATAGCCAGAGGGTCAGGAGAGAATGGGGGAGGAGGCGGTCAGGCTGCTGAGGAAACACCACAGGCTGAACGGGG
GAGGAATGCACATGCCACGCTGGGTGTCCCGGGTCGCGGGGAGGCAGCTCAGCTCTTAGGAGCAAGTTGTGGGGGCTTTTCAAGAGGGGC
CAGGCTTCCTGGAGGGTGACTGATGTGGCCGAAGCAGGTGTCCAGGCAGGTAGGCTGCAGCCAGGAGCTCCCTGGCACCGCAGGACCTCG
TGGTACTCTTGCCTTAGATTTTACACACACTCCACAGCCAAGCACTGCCACGGTCCTCCAGGACCTGGGAAGCAAAGGCACAGGCCCACG
GTGGCCAGCCATTGTGGTGCCGCCCCAGCTTCTGGATACAGCCTTTTGGGTAAACACTGGGAACTCCAGAAGTTGTGGGGAGAGTGGGGA
ATCAGACAGCCGCCTCTAGGGGCTGGGTTCTGCTGGGGCCTCCTTGTTGGTGCTGTAGGCACCCGCCAGGGAGCAGGGACCCGACTTGCA
GACGCATTGCCCGGTACTAGGAAGGAGTGAGGTGTGTTCCCACCGTACACTTCCCACACGAGCTGCGGCTGCCAGCCTCGGGCCATCAGC
CTAGGAGAGCAGATGCAGCTCCAGGGGCTCGACTTATAGCCAGTTACAGCTCCCCGGCTCTTCTGTGTGGCAGAGCGTCGTTTCCGGGCC
CTCAGGGCTGGGGAGCTCAGTTCCCATTGCTTGTGCTCAGGGCTGAGTCTTAAAGAAGGGTTTGCCGGCCCTAACGCTGCAGCGCGTGCG
CGGTGAGAGGCCCTTTTTGAGCCTGTTTACTCCTGTGGCCTTGGGCAGAACAGTAAATACTCTGTGCACGGAGGAAAGACATGCCCAAGA
GGAAGGAAGTACTGACCATCGGCTGCCTGTGAGCAGCTTAGCAAGGAGCCCTTGCTCCCTGGGAAAGGCGGTGAACTTGAGTCTAAAGAT
GCAGTGCCTGGCCCTTCCTAAGGTCCCTGCCTGGCATCCGAGTGTCGGTGTGTGGCACAGAAGGCTCCTGCTTGCTTCCAAAGTGATGGA
CAGGAAGGGGCAGAGTGAGTCACGGCCCAGACTGGGCACCTTCGCGTCTCAGCCTCAGGGAGCCCCACAGCCCCAAGCTCGCTGAGGCAA
CGTGAGAACAGGCTATGGGAAGGCTGCAAAGGCTGAGAAATGCAAAGGCTCATATTTATAAATCCCACCCCCAGAGTGGGGAGGGTCAGG
TGCCAGACCTGGACTAAACTGCACCAAGGAAACACCCAGCAGGGTCTCCTGTGAGCCGGGGACCATGCAGCCCGAAACCTCCAGTCACTG
CGCCCGGCAGGAGTCAGGAGCCAGGGACTGTGCAGCCTGGAACCTCCAGTCACTGTGCCCAGCAGGGTGGGCTGTGCCCAGCAGGAGTCA
GGCTAAGAAACGCCAGGTCTGCCTGTTCTTGCTGGGCAATGGCTGATGGCTGCCAGTTTCTGCTGATACACAGGTAGGATGGGACCCTTC
ATGAATATCTGACTTTAATAAGTTGGTAAGGATATATTTTTTTGTCTATGTTCTGTTTCAACTTATGTAGATTATTATAAATTGATGTAA

>In-frame_EWSR1_ENST00000331029_chr22_29669853_+_ABR_ENST00000302538_chr17_1028702_-_5353nt
GCGAGAGGGAGACGGACGTTGAGAGAACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCA
GCAGGGCTACAGTGCTTACACCGCCCAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGG
ACAGCCCACTGATGTCAGCTATACCCAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCAC
TGACTTCAGCTACGGGACGGACGAGTACGACGGAGAGGGGAATGAGGAGCAGAAGGGGCCCCCGGAGGGCTCAGAGACCATGCCGTACAT
CGATGAGTCGCCCACCATGTCCCCGCAGCTCAGCGCCCGCAGCCAGGGCGGGGGGGATGGCGTCTCCCCGACTCCACCTGAGGGACTGGC
TCCTGGGGTGGAAGCAGGGAAAGGCCTGGAGATGAGGAAGCTGGTTCTCTCGGGGTTCTTGGCCAGCGAAGAGATCTACATTAACCAGCT
GGAAGCCCTGTTGCTGCCCATGAAACCCCTGAAGGCCACCGCCACCACCTCCCAGCCCGTGCTCACCATCCAGCAGATCGAGACCATCTT
CTACAAGATCCAGGACATCTATGAGATCCACAAGGAGTTCTATGACAACCTGTGCCCCAAGGTGCAACAGTGGGACAGCCAGGTCACCAT
GGGCCACCTCTTCCAGAAGCTGGCCAGCCAGCTCGGTGTGTACAAAGCGTTTGTCGATAACTATAAAGTCGCTCTGGAGACAGCTGAGAA
GTGCAGCCAGTCCAACAACCAGTTCCAGAAGATCTCAGAGGAACTCAAAGTGAAAGGTCCCAAGGACTCCAAGGACAGCCACACGTCTGT
CACCATGGAAGCTCTGCTCTACAAGCCCATTGACCGGGTCACTCGGAGCACCCTAGTCCTACACGACCTGCTGAAGCACACACCTGTGGA
CCACCCCGACTACCCGCTGCTGCAGGATGCCCTCCGCATCTCCCAGAACTTCCTGTCCAGCATCAACGAGGACATCGACCCCCGCCGGAC
TGCAGTGACAACGCCCAAGGGGGAGACGCGACAGCTGGTGAAGGACGGCTTCCTGGTGGAAGTGTCAGAGAGCTCCCGGAAGCTGCGGCA
CGTCTTCCTCTTTACAGATGTCCTACTGTGTGCCAAGCTGAAGAAGACCTCTGCAGGGAAGCACCAGCAGTATGACTGTAAGTGGTACAT
CCCCCTGGCCGACCTGGTGTTTCCATCCCCCGAGGAGTCTGAGGCCAGCCCCCAGGTGCACCCCTTCCCAGACCATGAGCTGGAGGACAT
GAAGATGAAGATCTCTGCCCTCAAGAGTGAAATCCAGAAGGAGAAAGCCAACAAAGGCCAGAGCCGGGCCATCGAGCGCCTGAAGAAGAA
GATGTTTGAGAATGAGTTCCTGCTGCTGCTCAACTCCCCCACAATCCCGTTCAGGATCCACAATCGGAATGGAAAGAGTTACCTGTTCCT
ACTGTCCTCGGACTACGAGAGGTCAGAGTGGAGAGAAGCAATTCAGAAACTACAGAAGAAGGATCTCCAGGCCTTTGTCCTGAGCTCAGT
GGAGCTCCAGGTGCTCACAGGATCCTGTTTCAAGCTTAGGACTGTACACAACATTCCTGTCACCAGCAATAAAGACGACGATGAGTCTCC
AGGACTCTATGGCTTCCTTCATGTCATCGTCCACTCTGCCAAGGGATTTAAGCAATCAGCCAACCTGTACTGTACCCTGGAGGTGGATTC
CTTCGGCTATTTTGTCAGCAAAGCCAAAACCAGGGTGTTCCGGGACACAGCGGAGCCCAAGTGGGATGAGGAGTTTGAGATCGAGCTGGA
GGGCTCCCAGTCCCTGAGGATCCTGTGCTATGAGAAGTGCTATGACAAGACCAAGGTCAACAAGGACAACAATGAGATCGTGGACAAGAT
CATGGGCAAAGGACAGATCCAGCTGGACCCACAAACCGTGGAGACCAAGAACTGGCACACGGACGTGATTGAGATGAACGGGATCAAAGT
GGAATTTTCCATGAAATTCACCAGCCGAGATATGAGCCTGAAGAGGACCCCGTCCAAAAAGCAGACCGGCGTCTTCGGTGTGAAGATCAG
CGTGGTGACGAAGCGGGAGCGCTCCAAGGTGCCCTACATCGTCCGGCAGTGTGTGGAGGAGGTGGAGAAGAGGGGTATCGAGGAGGTTGG
CATCTACAGGATATCGGGCGTGGCCACGGACATCCAGGCGCTCAAGGCCGTCTTCGATGCCAATAACAAGGACATCCTGCTGATGCTGAG
TGACATGGACATCAACGCCATCGCCGGGACGCTCAAGCTGTACTTCCGGGAACTGCCCGAGCCGCTCCTCACGGACCGACTCTACCCAGC
CTTCATGGAGGGCATCGCCCTGTCAGACCCTGCTGCCAAGGAAAACTGCATGATGCACCTGCTCCGCTCCCTGCCCGACCCCAACCTCAT
CACCTTCCTCTTCCTGCTGGAACACTTGAAAAGGGTTGCCGAGAAGGAGCCCATCAACAAAATGTCACTTCACAACCTGGCTACCGTGTT
TGGACCCACGTTACTGAGACCCTCAGAAGTGGAGAGCAAAGCACACCTCACCTCGGCTGCGGACATCTGGTCCCATGACGTCATGGCGCA
GGTCCAGGTCCTCCTCTACTACCTGCAGCACCCCCCCATTTCCTTCGCAGAACTCAAGCGGAACACACTGTACTTCTCCACCGACGTGTA
GCCCGAGGCAGGGTGGCTGCGGGCGGGTGGTGGAACCAGCCCCTCCAGCCTGGGGTCCAACTCAGACTTGAAAGACTGCAATAGAAAACT
CCCAAACCCAGCACTCCAGACTCGAGGGAAGCCAGCTTCCAAGAACTGGAATGCGTACGTCTTTTGTGCCACCTTGTACAAAGCCGGCTG
CCCAGCCCCAGCCTCACCACCGCATCCCACCTCCTGCCCTCCATACCTCTAGTTGTGTCTGATGCTCCGTGCTGTTCGGGAATTGTTTTA
TGTACACTTGTCAGGCAGAAAAGGTAGTGACCGGCCCGGCGTGGGCACACAGACAGCCCGCTTTGTTCTTTCATTTCCTCCAGCACTTTC
TTTCCGCCTGAGTCCAGCCCAAGGCCTTTTATTTTGCGCTGTGTAACTGCTGCCAGCTTCTCTCTTGGCCCTGCTCCCAGATGGCGGTCT
CCTGGCAGCCTCCCCTCAGTCTTCCTCCACCCGCTCTTCCTTCCCAGCCTGCCTGCATGCATGTGCACCCTTGGTCTTCGCTCCATCGCC
TTGAAAGCTCTGAAGAGGCCCTGGGTTGCCGCGGCAGCAGTGGTCTGTTTGATGCTGCCGTTTGCCGCTGCCGGCCCCTCCTCAGACTCC
GCCTTTGGGAGCACACCTGCTTTGCCTTGCTGCCTGTGCAAATGTTGGACAAGCAGACACACTCACACTCGTCCCCAGCTTAGCACAGAG
CTGGAGCGCCCATTTCTGGAATTTTCCGTTTGGGAATCTCCACTTCTGGGGTTTACCTGTTCGGCCTCCTGTCTATCAGTGAGGCATCTC
TGACTGTTTCTTCTACTGCTTTTCAGTTCCCTTCCCTGCTGTTCTATTTCCTTTGAGTGTAAAGACTCACAGGTGACCTGCTATCGAGAT
AGCCAGAGGGTCAGGAGAGAATGGGGGAGGAGGCGGTCAGGCTGCTGAGGAAACACCACAGGCTGAACGGGGGAGGAATGCACATGCCAC
GCTGGGTGTCCCGGGTCGCGGGGAGGCAGCTCAGCTCTTAGGAGCAAGTTGTGGGGGCTTTTCAAGAGGGGCCAGGCTTCCTGGAGGGTG
ACTGATGTGGCCGAAGCAGGTGTCCAGGCAGGTAGGCTGCAGCCAGGAGCTCCCTGGCACCGCAGGACCTCGTGGTACTCTTGCCTTAGA
TTTTACACACACTCCACAGCCAAGCACTGCCACGGTCCTCCAGGACCTGGGAAGCAAAGGCACAGGCCCACGGTGGCCAGCCATTGTGGT
GCCGCCCCAGCTTCTGGATACAGCCTTTTGGGTAAACACTGGGAACTCCAGAAGTTGTGGGGAGAGTGGGGAATCAGACAGCCGCCTCTA
GGGGCTGGGTTCTGCTGGGGCCTCCTTGTTGGTGCTGTAGGCACCCGCCAGGGAGCAGGGACCCGACTTGCAGACGCATTGCCCGGTACT
AGGAAGGAGTGAGGTGTGTTCCCACCGTACACTTCCCACACGAGCTGCGGCTGCCAGCCTCGGGCCATCAGCCTAGGAGAGCAGATGCAG
CTCCAGGGGCTCGACTTATAGCCAGTTACAGCTCCCCGGCTCTTCTGTGTGGCAGAGCGTCGTTTCCGGGCCCTCAGGGCTGGGGAGCTC
AGTTCCCATTGCTTGTGCTCAGGGCTGAGTCTTAAAGAAGGGTTTGCCGGCCCTAACGCTGCAGCGCGTGCGCGGTGAGAGGCCCTTTTT
GAGCCTGTTTACTCCTGTGGCCTTGGGCAGAACAGTAAATACTCTGTGCACGGAGGAAAGACATGCCCAAGAGGAAGGAAGTACTGACCA
TCGGCTGCCTGTGAGCAGCTTAGCAAGGAGCCCTTGCTCCCTGGGAAAGGCGGTGAACTTGAGTCTAAAGATGCAGTGCCTGGCCCTTCC
TAAGGTCCCTGCCTGGCATCCGAGTGTCGGTGTGTGGCACAGAAGGCTCCTGCTTGCTTCCAAAGTGATGGACAGGAAGGGGCAGAGTGA
GTCACGGCCCAGACTGGGCACCTTCGCGTCTCAGCCTCAGGGAGCCCCACAGCCCCAAGCTCGCTGAGGCAACGTGAGAACAGGCTATGG
GAAGGCTGCAAAGGCTGAGAAATGCAAAGGCTCATATTTATAAATCCCACCCCCAGAGTGGGGAGGGTCAGGTGCCAGACCTGGACTAAA
CTGCACCAAGGAAACACCCAGCAGGGTCTCCTGTGAGCCGGGGACCATGCAGCCCGAAACCTCCAGTCACTGCGCCCGGCAGGAGTCAGG
AGCCAGGGACTGTGCAGCCTGGAACCTCCAGTCACTGTGCCCAGCAGGGTGGGCTGTGCCCAGCAGGAGTCAGGCTAAGAAACGCCAGGT
CTGCCTGTTCTTGCTGGGCAATGGCTGATGGCTGCCAGTTTCTGCTGATACACAGGTAGGATGGGACCCTTCATGAATATCTGACTTTAA
TAAGTTGGTAAGGATATATTTTTTTGTCTATGTTCTGTTTCAACTTATGTAGATTATTATAAATTGATGTAAACCACGTGAGAGGAAAAT

>In-frame_EWSR1_ENST00000414183_chr22_29669853_+_ABR_ENST00000302538_chr17_1028702_-_5328nt
AACGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCC
CAGCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACC
CAGGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGACTTCAGCTACGGGACGGACGAG
TACGACGGAGAGGGGAATGAGGAGCAGAAGGGGCCCCCGGAGGGCTCAGAGACCATGCCGTACATCGATGAGTCGCCCACCATGTCCCCG
CAGCTCAGCGCCCGCAGCCAGGGCGGGGGGGATGGCGTCTCCCCGACTCCACCTGAGGGACTGGCTCCTGGGGTGGAAGCAGGGAAAGGC
CTGGAGATGAGGAAGCTGGTTCTCTCGGGGTTCTTGGCCAGCGAAGAGATCTACATTAACCAGCTGGAAGCCCTGTTGCTGCCCATGAAA
CCCCTGAAGGCCACCGCCACCACCTCCCAGCCCGTGCTCACCATCCAGCAGATCGAGACCATCTTCTACAAGATCCAGGACATCTATGAG
ATCCACAAGGAGTTCTATGACAACCTGTGCCCCAAGGTGCAACAGTGGGACAGCCAGGTCACCATGGGCCACCTCTTCCAGAAGCTGGCC
AGCCAGCTCGGTGTGTACAAAGCGTTTGTCGATAACTATAAAGTCGCTCTGGAGACAGCTGAGAAGTGCAGCCAGTCCAACAACCAGTTC
CAGAAGATCTCAGAGGAACTCAAAGTGAAAGGTCCCAAGGACTCCAAGGACAGCCACACGTCTGTCACCATGGAAGCTCTGCTCTACAAG
CCCATTGACCGGGTCACTCGGAGCACCCTAGTCCTACACGACCTGCTGAAGCACACACCTGTGGACCACCCCGACTACCCGCTGCTGCAG
GATGCCCTCCGCATCTCCCAGAACTTCCTGTCCAGCATCAACGAGGACATCGACCCCCGCCGGACTGCAGTGACAACGCCCAAGGGGGAG
ACGCGACAGCTGGTGAAGGACGGCTTCCTGGTGGAAGTGTCAGAGAGCTCCCGGAAGCTGCGGCACGTCTTCCTCTTTACAGATGTCCTA
CTGTGTGCCAAGCTGAAGAAGACCTCTGCAGGGAAGCACCAGCAGTATGACTGTAAGTGGTACATCCCCCTGGCCGACCTGGTGTTTCCA
TCCCCCGAGGAGTCTGAGGCCAGCCCCCAGGTGCACCCCTTCCCAGACCATGAGCTGGAGGACATGAAGATGAAGATCTCTGCCCTCAAG
AGTGAAATCCAGAAGGAGAAAGCCAACAAAGGCCAGAGCCGGGCCATCGAGCGCCTGAAGAAGAAGATGTTTGAGAATGAGTTCCTGCTG
CTGCTCAACTCCCCCACAATCCCGTTCAGGATCCACAATCGGAATGGAAAGAGTTACCTGTTCCTACTGTCCTCGGACTACGAGAGGTCA
GAGTGGAGAGAAGCAATTCAGAAACTACAGAAGAAGGATCTCCAGGCCTTTGTCCTGAGCTCAGTGGAGCTCCAGGTGCTCACAGGATCC
TGTTTCAAGCTTAGGACTGTACACAACATTCCTGTCACCAGCAATAAAGACGACGATGAGTCTCCAGGACTCTATGGCTTCCTTCATGTC
ATCGTCCACTCTGCCAAGGGATTTAAGCAATCAGCCAACCTGTACTGTACCCTGGAGGTGGATTCCTTCGGCTATTTTGTCAGCAAAGCC
AAAACCAGGGTGTTCCGGGACACAGCGGAGCCCAAGTGGGATGAGGAGTTTGAGATCGAGCTGGAGGGCTCCCAGTCCCTGAGGATCCTG
TGCTATGAGAAGTGCTATGACAAGACCAAGGTCAACAAGGACAACAATGAGATCGTGGACAAGATCATGGGCAAAGGACAGATCCAGCTG
GACCCACAAACCGTGGAGACCAAGAACTGGCACACGGACGTGATTGAGATGAACGGGATCAAAGTGGAATTTTCCATGAAATTCACCAGC
CGAGATATGAGCCTGAAGAGGACCCCGTCCAAAAAGCAGACCGGCGTCTTCGGTGTGAAGATCAGCGTGGTGACGAAGCGGGAGCGCTCC
AAGGTGCCCTACATCGTCCGGCAGTGTGTGGAGGAGGTGGAGAAGAGGGGTATCGAGGAGGTTGGCATCTACAGGATATCGGGCGTGGCC
ACGGACATCCAGGCGCTCAAGGCCGTCTTCGATGCCAATAACAAGGACATCCTGCTGATGCTGAGTGACATGGACATCAACGCCATCGCC
GGGACGCTCAAGCTGTACTTCCGGGAACTGCCCGAGCCGCTCCTCACGGACCGACTCTACCCAGCCTTCATGGAGGGCATCGCCCTGTCA
GACCCTGCTGCCAAGGAAAACTGCATGATGCACCTGCTCCGCTCCCTGCCCGACCCCAACCTCATCACCTTCCTCTTCCTGCTGGAACAC
TTGAAAAGGGTTGCCGAGAAGGAGCCCATCAACAAAATGTCACTTCACAACCTGGCTACCGTGTTTGGACCCACGTTACTGAGACCCTCA
GAAGTGGAGAGCAAAGCACACCTCACCTCGGCTGCGGACATCTGGTCCCATGACGTCATGGCGCAGGTCCAGGTCCTCCTCTACTACCTG
CAGCACCCCCCCATTTCCTTCGCAGAACTCAAGCGGAACACACTGTACTTCTCCACCGACGTGTAGCCCGAGGCAGGGTGGCTGCGGGCG
GGTGGTGGAACCAGCCCCTCCAGCCTGGGGTCCAACTCAGACTTGAAAGACTGCAATAGAAAACTCCCAAACCCAGCACTCCAGACTCGA
GGGAAGCCAGCTTCCAAGAACTGGAATGCGTACGTCTTTTGTGCCACCTTGTACAAAGCCGGCTGCCCAGCCCCAGCCTCACCACCGCAT
CCCACCTCCTGCCCTCCATACCTCTAGTTGTGTCTGATGCTCCGTGCTGTTCGGGAATTGTTTTATGTACACTTGTCAGGCAGAAAAGGT
AGTGACCGGCCCGGCGTGGGCACACAGACAGCCCGCTTTGTTCTTTCATTTCCTCCAGCACTTTCTTTCCGCCTGAGTCCAGCCCAAGGC
CTTTTATTTTGCGCTGTGTAACTGCTGCCAGCTTCTCTCTTGGCCCTGCTCCCAGATGGCGGTCTCCTGGCAGCCTCCCCTCAGTCTTCC
TCCACCCGCTCTTCCTTCCCAGCCTGCCTGCATGCATGTGCACCCTTGGTCTTCGCTCCATCGCCTTGAAAGCTCTGAAGAGGCCCTGGG
TTGCCGCGGCAGCAGTGGTCTGTTTGATGCTGCCGTTTGCCGCTGCCGGCCCCTCCTCAGACTCCGCCTTTGGGAGCACACCTGCTTTGC
CTTGCTGCCTGTGCAAATGTTGGACAAGCAGACACACTCACACTCGTCCCCAGCTTAGCACAGAGCTGGAGCGCCCATTTCTGGAATTTT
CCGTTTGGGAATCTCCACTTCTGGGGTTTACCTGTTCGGCCTCCTGTCTATCAGTGAGGCATCTCTGACTGTTTCTTCTACTGCTTTTCA
GTTCCCTTCCCTGCTGTTCTATTTCCTTTGAGTGTAAAGACTCACAGGTGACCTGCTATCGAGATAGCCAGAGGGTCAGGAGAGAATGGG
GGAGGAGGCGGTCAGGCTGCTGAGGAAACACCACAGGCTGAACGGGGGAGGAATGCACATGCCACGCTGGGTGTCCCGGGTCGCGGGGAG
GCAGCTCAGCTCTTAGGAGCAAGTTGTGGGGGCTTTTCAAGAGGGGCCAGGCTTCCTGGAGGGTGACTGATGTGGCCGAAGCAGGTGTCC
AGGCAGGTAGGCTGCAGCCAGGAGCTCCCTGGCACCGCAGGACCTCGTGGTACTCTTGCCTTAGATTTTACACACACTCCACAGCCAAGC
ACTGCCACGGTCCTCCAGGACCTGGGAAGCAAAGGCACAGGCCCACGGTGGCCAGCCATTGTGGTGCCGCCCCAGCTTCTGGATACAGCC
TTTTGGGTAAACACTGGGAACTCCAGAAGTTGTGGGGAGAGTGGGGAATCAGACAGCCGCCTCTAGGGGCTGGGTTCTGCTGGGGCCTCC
TTGTTGGTGCTGTAGGCACCCGCCAGGGAGCAGGGACCCGACTTGCAGACGCATTGCCCGGTACTAGGAAGGAGTGAGGTGTGTTCCCAC
CGTACACTTCCCACACGAGCTGCGGCTGCCAGCCTCGGGCCATCAGCCTAGGAGAGCAGATGCAGCTCCAGGGGCTCGACTTATAGCCAG
TTACAGCTCCCCGGCTCTTCTGTGTGGCAGAGCGTCGTTTCCGGGCCCTCAGGGCTGGGGAGCTCAGTTCCCATTGCTTGTGCTCAGGGC
TGAGTCTTAAAGAAGGGTTTGCCGGCCCTAACGCTGCAGCGCGTGCGCGGTGAGAGGCCCTTTTTGAGCCTGTTTACTCCTGTGGCCTTG
GGCAGAACAGTAAATACTCTGTGCACGGAGGAAAGACATGCCCAAGAGGAAGGAAGTACTGACCATCGGCTGCCTGTGAGCAGCTTAGCA
AGGAGCCCTTGCTCCCTGGGAAAGGCGGTGAACTTGAGTCTAAAGATGCAGTGCCTGGCCCTTCCTAAGGTCCCTGCCTGGCATCCGAGT
GTCGGTGTGTGGCACAGAAGGCTCCTGCTTGCTTCCAAAGTGATGGACAGGAAGGGGCAGAGTGAGTCACGGCCCAGACTGGGCACCTTC
GCGTCTCAGCCTCAGGGAGCCCCACAGCCCCAAGCTCGCTGAGGCAACGTGAGAACAGGCTATGGGAAGGCTGCAAAGGCTGAGAAATGC
AAAGGCTCATATTTATAAATCCCACCCCCAGAGTGGGGAGGGTCAGGTGCCAGACCTGGACTAAACTGCACCAAGGAAACACCCAGCAGG
GTCTCCTGTGAGCCGGGGACCATGCAGCCCGAAACCTCCAGTCACTGCGCCCGGCAGGAGTCAGGAGCCAGGGACTGTGCAGCCTGGAAC
CTCCAGTCACTGTGCCCAGCAGGGTGGGCTGTGCCCAGCAGGAGTCAGGCTAAGAAACGCCAGGTCTGCCTGTTCTTGCTGGGCAATGGC
TGATGGCTGCCAGTTTCTGCTGATACACAGGTAGGATGGGACCCTTCATGAATATCTGACTTTAATAAGTTGGTAAGGATATATTTTTTT
GTCTATGTTCTGTTTCAACTTATGTAGATTATTATAAATTGATGTAAACCACGTGAGAGGAAAATGTTAATAAAAAATGCAAAGCCCCAT

>In-frame_EWSR1_ENST00000333395_chr22_29669853_+_ABR_ENST00000302538_chr17_1028702_-_5326nt
CGAGGAGGAAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCA
GCCCACTCAAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCA
GGCTCAGACCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGACTTCAGCTACGGGACGGACGAGTA
CGACGGAGAGGGGAATGAGGAGCAGAAGGGGCCCCCGGAGGGCTCAGAGACCATGCCGTACATCGATGAGTCGCCCACCATGTCCCCGCA
GCTCAGCGCCCGCAGCCAGGGCGGGGGGGATGGCGTCTCCCCGACTCCACCTGAGGGACTGGCTCCTGGGGTGGAAGCAGGGAAAGGCCT
GGAGATGAGGAAGCTGGTTCTCTCGGGGTTCTTGGCCAGCGAAGAGATCTACATTAACCAGCTGGAAGCCCTGTTGCTGCCCATGAAACC
CCTGAAGGCCACCGCCACCACCTCCCAGCCCGTGCTCACCATCCAGCAGATCGAGACCATCTTCTACAAGATCCAGGACATCTATGAGAT
CCACAAGGAGTTCTATGACAACCTGTGCCCCAAGGTGCAACAGTGGGACAGCCAGGTCACCATGGGCCACCTCTTCCAGAAGCTGGCCAG
CCAGCTCGGTGTGTACAAAGCGTTTGTCGATAACTATAAAGTCGCTCTGGAGACAGCTGAGAAGTGCAGCCAGTCCAACAACCAGTTCCA
GAAGATCTCAGAGGAACTCAAAGTGAAAGGTCCCAAGGACTCCAAGGACAGCCACACGTCTGTCACCATGGAAGCTCTGCTCTACAAGCC
CATTGACCGGGTCACTCGGAGCACCCTAGTCCTACACGACCTGCTGAAGCACACACCTGTGGACCACCCCGACTACCCGCTGCTGCAGGA
TGCCCTCCGCATCTCCCAGAACTTCCTGTCCAGCATCAACGAGGACATCGACCCCCGCCGGACTGCAGTGACAACGCCCAAGGGGGAGAC
GCGACAGCTGGTGAAGGACGGCTTCCTGGTGGAAGTGTCAGAGAGCTCCCGGAAGCTGCGGCACGTCTTCCTCTTTACAGATGTCCTACT
GTGTGCCAAGCTGAAGAAGACCTCTGCAGGGAAGCACCAGCAGTATGACTGTAAGTGGTACATCCCCCTGGCCGACCTGGTGTTTCCATC
CCCCGAGGAGTCTGAGGCCAGCCCCCAGGTGCACCCCTTCCCAGACCATGAGCTGGAGGACATGAAGATGAAGATCTCTGCCCTCAAGAG
TGAAATCCAGAAGGAGAAAGCCAACAAAGGCCAGAGCCGGGCCATCGAGCGCCTGAAGAAGAAGATGTTTGAGAATGAGTTCCTGCTGCT
GCTCAACTCCCCCACAATCCCGTTCAGGATCCACAATCGGAATGGAAAGAGTTACCTGTTCCTACTGTCCTCGGACTACGAGAGGTCAGA
GTGGAGAGAAGCAATTCAGAAACTACAGAAGAAGGATCTCCAGGCCTTTGTCCTGAGCTCAGTGGAGCTCCAGGTGCTCACAGGATCCTG
TTTCAAGCTTAGGACTGTACACAACATTCCTGTCACCAGCAATAAAGACGACGATGAGTCTCCAGGACTCTATGGCTTCCTTCATGTCAT
CGTCCACTCTGCCAAGGGATTTAAGCAATCAGCCAACCTGTACTGTACCCTGGAGGTGGATTCCTTCGGCTATTTTGTCAGCAAAGCCAA
AACCAGGGTGTTCCGGGACACAGCGGAGCCCAAGTGGGATGAGGAGTTTGAGATCGAGCTGGAGGGCTCCCAGTCCCTGAGGATCCTGTG
CTATGAGAAGTGCTATGACAAGACCAAGGTCAACAAGGACAACAATGAGATCGTGGACAAGATCATGGGCAAAGGACAGATCCAGCTGGA
CCCACAAACCGTGGAGACCAAGAACTGGCACACGGACGTGATTGAGATGAACGGGATCAAAGTGGAATTTTCCATGAAATTCACCAGCCG
AGATATGAGCCTGAAGAGGACCCCGTCCAAAAAGCAGACCGGCGTCTTCGGTGTGAAGATCAGCGTGGTGACGAAGCGGGAGCGCTCCAA
GGTGCCCTACATCGTCCGGCAGTGTGTGGAGGAGGTGGAGAAGAGGGGTATCGAGGAGGTTGGCATCTACAGGATATCGGGCGTGGCCAC
GGACATCCAGGCGCTCAAGGCCGTCTTCGATGCCAATAACAAGGACATCCTGCTGATGCTGAGTGACATGGACATCAACGCCATCGCCGG
GACGCTCAAGCTGTACTTCCGGGAACTGCCCGAGCCGCTCCTCACGGACCGACTCTACCCAGCCTTCATGGAGGGCATCGCCCTGTCAGA
CCCTGCTGCCAAGGAAAACTGCATGATGCACCTGCTCCGCTCCCTGCCCGACCCCAACCTCATCACCTTCCTCTTCCTGCTGGAACACTT
GAAAAGGGTTGCCGAGAAGGAGCCCATCAACAAAATGTCACTTCACAACCTGGCTACCGTGTTTGGACCCACGTTACTGAGACCCTCAGA
AGTGGAGAGCAAAGCACACCTCACCTCGGCTGCGGACATCTGGTCCCATGACGTCATGGCGCAGGTCCAGGTCCTCCTCTACTACCTGCA
GCACCCCCCCATTTCCTTCGCAGAACTCAAGCGGAACACACTGTACTTCTCCACCGACGTGTAGCCCGAGGCAGGGTGGCTGCGGGCGGG
TGGTGGAACCAGCCCCTCCAGCCTGGGGTCCAACTCAGACTTGAAAGACTGCAATAGAAAACTCCCAAACCCAGCACTCCAGACTCGAGG
GAAGCCAGCTTCCAAGAACTGGAATGCGTACGTCTTTTGTGCCACCTTGTACAAAGCCGGCTGCCCAGCCCCAGCCTCACCACCGCATCC
CACCTCCTGCCCTCCATACCTCTAGTTGTGTCTGATGCTCCGTGCTGTTCGGGAATTGTTTTATGTACACTTGTCAGGCAGAAAAGGTAG
TGACCGGCCCGGCGTGGGCACACAGACAGCCCGCTTTGTTCTTTCATTTCCTCCAGCACTTTCTTTCCGCCTGAGTCCAGCCCAAGGCCT
TTTATTTTGCGCTGTGTAACTGCTGCCAGCTTCTCTCTTGGCCCTGCTCCCAGATGGCGGTCTCCTGGCAGCCTCCCCTCAGTCTTCCTC
CACCCGCTCTTCCTTCCCAGCCTGCCTGCATGCATGTGCACCCTTGGTCTTCGCTCCATCGCCTTGAAAGCTCTGAAGAGGCCCTGGGTT
GCCGCGGCAGCAGTGGTCTGTTTGATGCTGCCGTTTGCCGCTGCCGGCCCCTCCTCAGACTCCGCCTTTGGGAGCACACCTGCTTTGCCT
TGCTGCCTGTGCAAATGTTGGACAAGCAGACACACTCACACTCGTCCCCAGCTTAGCACAGAGCTGGAGCGCCCATTTCTGGAATTTTCC
GTTTGGGAATCTCCACTTCTGGGGTTTACCTGTTCGGCCTCCTGTCTATCAGTGAGGCATCTCTGACTGTTTCTTCTACTGCTTTTCAGT
TCCCTTCCCTGCTGTTCTATTTCCTTTGAGTGTAAAGACTCACAGGTGACCTGCTATCGAGATAGCCAGAGGGTCAGGAGAGAATGGGGG
AGGAGGCGGTCAGGCTGCTGAGGAAACACCACAGGCTGAACGGGGGAGGAATGCACATGCCACGCTGGGTGTCCCGGGTCGCGGGGAGGC
AGCTCAGCTCTTAGGAGCAAGTTGTGGGGGCTTTTCAAGAGGGGCCAGGCTTCCTGGAGGGTGACTGATGTGGCCGAAGCAGGTGTCCAG
GCAGGTAGGCTGCAGCCAGGAGCTCCCTGGCACCGCAGGACCTCGTGGTACTCTTGCCTTAGATTTTACACACACTCCACAGCCAAGCAC
TGCCACGGTCCTCCAGGACCTGGGAAGCAAAGGCACAGGCCCACGGTGGCCAGCCATTGTGGTGCCGCCCCAGCTTCTGGATACAGCCTT
TTGGGTAAACACTGGGAACTCCAGAAGTTGTGGGGAGAGTGGGGAATCAGACAGCCGCCTCTAGGGGCTGGGTTCTGCTGGGGCCTCCTT
GTTGGTGCTGTAGGCACCCGCCAGGGAGCAGGGACCCGACTTGCAGACGCATTGCCCGGTACTAGGAAGGAGTGAGGTGTGTTCCCACCG
TACACTTCCCACACGAGCTGCGGCTGCCAGCCTCGGGCCATCAGCCTAGGAGAGCAGATGCAGCTCCAGGGGCTCGACTTATAGCCAGTT
ACAGCTCCCCGGCTCTTCTGTGTGGCAGAGCGTCGTTTCCGGGCCCTCAGGGCTGGGGAGCTCAGTTCCCATTGCTTGTGCTCAGGGCTG
AGTCTTAAAGAAGGGTTTGCCGGCCCTAACGCTGCAGCGCGTGCGCGGTGAGAGGCCCTTTTTGAGCCTGTTTACTCCTGTGGCCTTGGG
CAGAACAGTAAATACTCTGTGCACGGAGGAAAGACATGCCCAAGAGGAAGGAAGTACTGACCATCGGCTGCCTGTGAGCAGCTTAGCAAG
GAGCCCTTGCTCCCTGGGAAAGGCGGTGAACTTGAGTCTAAAGATGCAGTGCCTGGCCCTTCCTAAGGTCCCTGCCTGGCATCCGAGTGT
CGGTGTGTGGCACAGAAGGCTCCTGCTTGCTTCCAAAGTGATGGACAGGAAGGGGCAGAGTGAGTCACGGCCCAGACTGGGCACCTTCGC
GTCTCAGCCTCAGGGAGCCCCACAGCCCCAAGCTCGCTGAGGCAACGTGAGAACAGGCTATGGGAAGGCTGCAAAGGCTGAGAAATGCAA
AGGCTCATATTTATAAATCCCACCCCCAGAGTGGGGAGGGTCAGGTGCCAGACCTGGACTAAACTGCACCAAGGAAACACCCAGCAGGGT
CTCCTGTGAGCCGGGGACCATGCAGCCCGAAACCTCCAGTCACTGCGCCCGGCAGGAGTCAGGAGCCAGGGACTGTGCAGCCTGGAACCT
CCAGTCACTGTGCCCAGCAGGGTGGGCTGTGCCCAGCAGGAGTCAGGCTAAGAAACGCCAGGTCTGCCTGTTCTTGCTGGGCAATGGCTG
ATGGCTGCCAGTTTCTGCTGATACACAGGTAGGATGGGACCCTTCATGAATATCTGACTTTAATAAGTTGGTAAGGATATATTTTTTTGT
CTATGTTCTGTTTCAACTTATGTAGATTATTATAAATTGATGTAAACCACGTGAGAGGAAAATGTTAATAAAAAATGCAAAGCCCCATCA

>In-frame_EWSR1_ENST00000332035_chr22_29669853_+_ABR_ENST00000302538_chr17_1028702_-_5318nt
AAGGAGAGAAAATGGCGTCCACGGATTACAGTACCTATAGCCAAGCTGCAGCGCAGCAGGGCTACAGTGCTTACACCGCCCAGCCCACTC
AAGGATATGCACAGACCACCCAGGCATATGGGCAACAAAGCTATGGAACCTATGGACAGCCCACTGATGTCAGCTATACCCAGGCTCAGA
CCACTGCAACCTATGGGCAGACCGCCTATGCAACTTCTTATGGACAGCCTCCCACTGACTTCAGCTACGGGACGGACGAGTACGACGGAG
AGGGGAATGAGGAGCAGAAGGGGCCCCCGGAGGGCTCAGAGACCATGCCGTACATCGATGAGTCGCCCACCATGTCCCCGCAGCTCAGCG
CCCGCAGCCAGGGCGGGGGGGATGGCGTCTCCCCGACTCCACCTGAGGGACTGGCTCCTGGGGTGGAAGCAGGGAAAGGCCTGGAGATGA
GGAAGCTGGTTCTCTCGGGGTTCTTGGCCAGCGAAGAGATCTACATTAACCAGCTGGAAGCCCTGTTGCTGCCCATGAAACCCCTGAAGG
CCACCGCCACCACCTCCCAGCCCGTGCTCACCATCCAGCAGATCGAGACCATCTTCTACAAGATCCAGGACATCTATGAGATCCACAAGG
AGTTCTATGACAACCTGTGCCCCAAGGTGCAACAGTGGGACAGCCAGGTCACCATGGGCCACCTCTTCCAGAAGCTGGCCAGCCAGCTCG
GTGTGTACAAAGCGTTTGTCGATAACTATAAAGTCGCTCTGGAGACAGCTGAGAAGTGCAGCCAGTCCAACAACCAGTTCCAGAAGATCT
CAGAGGAACTCAAAGTGAAAGGTCCCAAGGACTCCAAGGACAGCCACACGTCTGTCACCATGGAAGCTCTGCTCTACAAGCCCATTGACC
GGGTCACTCGGAGCACCCTAGTCCTACACGACCTGCTGAAGCACACACCTGTGGACCACCCCGACTACCCGCTGCTGCAGGATGCCCTCC
GCATCTCCCAGAACTTCCTGTCCAGCATCAACGAGGACATCGACCCCCGCCGGACTGCAGTGACAACGCCCAAGGGGGAGACGCGACAGC
TGGTGAAGGACGGCTTCCTGGTGGAAGTGTCAGAGAGCTCCCGGAAGCTGCGGCACGTCTTCCTCTTTACAGATGTCCTACTGTGTGCCA
AGCTGAAGAAGACCTCTGCAGGGAAGCACCAGCAGTATGACTGTAAGTGGTACATCCCCCTGGCCGACCTGGTGTTTCCATCCCCCGAGG
AGTCTGAGGCCAGCCCCCAGGTGCACCCCTTCCCAGACCATGAGCTGGAGGACATGAAGATGAAGATCTCTGCCCTCAAGAGTGAAATCC
AGAAGGAGAAAGCCAACAAAGGCCAGAGCCGGGCCATCGAGCGCCTGAAGAAGAAGATGTTTGAGAATGAGTTCCTGCTGCTGCTCAACT
CCCCCACAATCCCGTTCAGGATCCACAATCGGAATGGAAAGAGTTACCTGTTCCTACTGTCCTCGGACTACGAGAGGTCAGAGTGGAGAG
AAGCAATTCAGAAACTACAGAAGAAGGATCTCCAGGCCTTTGTCCTGAGCTCAGTGGAGCTCCAGGTGCTCACAGGATCCTGTTTCAAGC
TTAGGACTGTACACAACATTCCTGTCACCAGCAATAAAGACGACGATGAGTCTCCAGGACTCTATGGCTTCCTTCATGTCATCGTCCACT
CTGCCAAGGGATTTAAGCAATCAGCCAACCTGTACTGTACCCTGGAGGTGGATTCCTTCGGCTATTTTGTCAGCAAAGCCAAAACCAGGG
TGTTCCGGGACACAGCGGAGCCCAAGTGGGATGAGGAGTTTGAGATCGAGCTGGAGGGCTCCCAGTCCCTGAGGATCCTGTGCTATGAGA
AGTGCTATGACAAGACCAAGGTCAACAAGGACAACAATGAGATCGTGGACAAGATCATGGGCAAAGGACAGATCCAGCTGGACCCACAAA
CCGTGGAGACCAAGAACTGGCACACGGACGTGATTGAGATGAACGGGATCAAAGTGGAATTTTCCATGAAATTCACCAGCCGAGATATGA
GCCTGAAGAGGACCCCGTCCAAAAAGCAGACCGGCGTCTTCGGTGTGAAGATCAGCGTGGTGACGAAGCGGGAGCGCTCCAAGGTGCCCT
ACATCGTCCGGCAGTGTGTGGAGGAGGTGGAGAAGAGGGGTATCGAGGAGGTTGGCATCTACAGGATATCGGGCGTGGCCACGGACATCC
AGGCGCTCAAGGCCGTCTTCGATGCCAATAACAAGGACATCCTGCTGATGCTGAGTGACATGGACATCAACGCCATCGCCGGGACGCTCA
AGCTGTACTTCCGGGAACTGCCCGAGCCGCTCCTCACGGACCGACTCTACCCAGCCTTCATGGAGGGCATCGCCCTGTCAGACCCTGCTG
CCAAGGAAAACTGCATGATGCACCTGCTCCGCTCCCTGCCCGACCCCAACCTCATCACCTTCCTCTTCCTGCTGGAACACTTGAAAAGGG
TTGCCGAGAAGGAGCCCATCAACAAAATGTCACTTCACAACCTGGCTACCGTGTTTGGACCCACGTTACTGAGACCCTCAGAAGTGGAGA
GCAAAGCACACCTCACCTCGGCTGCGGACATCTGGTCCCATGACGTCATGGCGCAGGTCCAGGTCCTCCTCTACTACCTGCAGCACCCCC
CCATTTCCTTCGCAGAACTCAAGCGGAACACACTGTACTTCTCCACCGACGTGTAGCCCGAGGCAGGGTGGCTGCGGGCGGGTGGTGGAA
CCAGCCCCTCCAGCCTGGGGTCCAACTCAGACTTGAAAGACTGCAATAGAAAACTCCCAAACCCAGCACTCCAGACTCGAGGGAAGCCAG
CTTCCAAGAACTGGAATGCGTACGTCTTTTGTGCCACCTTGTACAAAGCCGGCTGCCCAGCCCCAGCCTCACCACCGCATCCCACCTCCT
GCCCTCCATACCTCTAGTTGTGTCTGATGCTCCGTGCTGTTCGGGAATTGTTTTATGTACACTTGTCAGGCAGAAAAGGTAGTGACCGGC
CCGGCGTGGGCACACAGACAGCCCGCTTTGTTCTTTCATTTCCTCCAGCACTTTCTTTCCGCCTGAGTCCAGCCCAAGGCCTTTTATTTT
GCGCTGTGTAACTGCTGCCAGCTTCTCTCTTGGCCCTGCTCCCAGATGGCGGTCTCCTGGCAGCCTCCCCTCAGTCTTCCTCCACCCGCT
CTTCCTTCCCAGCCTGCCTGCATGCATGTGCACCCTTGGTCTTCGCTCCATCGCCTTGAAAGCTCTGAAGAGGCCCTGGGTTGCCGCGGC
AGCAGTGGTCTGTTTGATGCTGCCGTTTGCCGCTGCCGGCCCCTCCTCAGACTCCGCCTTTGGGAGCACACCTGCTTTGCCTTGCTGCCT
GTGCAAATGTTGGACAAGCAGACACACTCACACTCGTCCCCAGCTTAGCACAGAGCTGGAGCGCCCATTTCTGGAATTTTCCGTTTGGGA
ATCTCCACTTCTGGGGTTTACCTGTTCGGCCTCCTGTCTATCAGTGAGGCATCTCTGACTGTTTCTTCTACTGCTTTTCAGTTCCCTTCC
CTGCTGTTCTATTTCCTTTGAGTGTAAAGACTCACAGGTGACCTGCTATCGAGATAGCCAGAGGGTCAGGAGAGAATGGGGGAGGAGGCG
GTCAGGCTGCTGAGGAAACACCACAGGCTGAACGGGGGAGGAATGCACATGCCACGCTGGGTGTCCCGGGTCGCGGGGAGGCAGCTCAGC
TCTTAGGAGCAAGTTGTGGGGGCTTTTCAAGAGGGGCCAGGCTTCCTGGAGGGTGACTGATGTGGCCGAAGCAGGTGTCCAGGCAGGTAG
GCTGCAGCCAGGAGCTCCCTGGCACCGCAGGACCTCGTGGTACTCTTGCCTTAGATTTTACACACACTCCACAGCCAAGCACTGCCACGG
TCCTCCAGGACCTGGGAAGCAAAGGCACAGGCCCACGGTGGCCAGCCATTGTGGTGCCGCCCCAGCTTCTGGATACAGCCTTTTGGGTAA
ACACTGGGAACTCCAGAAGTTGTGGGGAGAGTGGGGAATCAGACAGCCGCCTCTAGGGGCTGGGTTCTGCTGGGGCCTCCTTGTTGGTGC
TGTAGGCACCCGCCAGGGAGCAGGGACCCGACTTGCAGACGCATTGCCCGGTACTAGGAAGGAGTGAGGTGTGTTCCCACCGTACACTTC
CCACACGAGCTGCGGCTGCCAGCCTCGGGCCATCAGCCTAGGAGAGCAGATGCAGCTCCAGGGGCTCGACTTATAGCCAGTTACAGCTCC
CCGGCTCTTCTGTGTGGCAGAGCGTCGTTTCCGGGCCCTCAGGGCTGGGGAGCTCAGTTCCCATTGCTTGTGCTCAGGGCTGAGTCTTAA
AGAAGGGTTTGCCGGCCCTAACGCTGCAGCGCGTGCGCGGTGAGAGGCCCTTTTTGAGCCTGTTTACTCCTGTGGCCTTGGGCAGAACAG
TAAATACTCTGTGCACGGAGGAAAGACATGCCCAAGAGGAAGGAAGTACTGACCATCGGCTGCCTGTGAGCAGCTTAGCAAGGAGCCCTT
GCTCCCTGGGAAAGGCGGTGAACTTGAGTCTAAAGATGCAGTGCCTGGCCCTTCCTAAGGTCCCTGCCTGGCATCCGAGTGTCGGTGTGT
GGCACAGAAGGCTCCTGCTTGCTTCCAAAGTGATGGACAGGAAGGGGCAGAGTGAGTCACGGCCCAGACTGGGCACCTTCGCGTCTCAGC
CTCAGGGAGCCCCACAGCCCCAAGCTCGCTGAGGCAACGTGAGAACAGGCTATGGGAAGGCTGCAAAGGCTGAGAAATGCAAAGGCTCAT
ATTTATAAATCCCACCCCCAGAGTGGGGAGGGTCAGGTGCCAGACCTGGACTAAACTGCACCAAGGAAACACCCAGCAGGGTCTCCTGTG
AGCCGGGGACCATGCAGCCCGAAACCTCCAGTCACTGCGCCCGGCAGGAGTCAGGAGCCAGGGACTGTGCAGCCTGGAACCTCCAGTCAC
TGTGCCCAGCAGGGTGGGCTGTGCCCAGCAGGAGTCAGGCTAAGAAACGCCAGGTCTGCCTGTTCTTGCTGGGCAATGGCTGATGGCTGC
CAGTTTCTGCTGATACACAGGTAGGATGGGACCCTTCATGAATATCTGACTTTAATAAGTTGGTAAGGATATATTTTTTTGTCTATGTTC
TGTTTCAACTTATGTAGATTATTATAAATTGATGTAAACCACGTGAGAGGAAAATGTTAATAAAAAATGCAAAGCCCCATCATTTGCACA


Top

FusionGenePPI for EWSR1_ABR


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
EWSR1PRTFDC1, ZDHHC3, MSC, SLC22A24, MYO1F, KXD1, KHDRBS2, DNAJB3, FASN, NLE1, MNS1, PRUNE2, WWP2, NDUFB1, BNIP3L, NSUN4, KRR1, WWP1, RMND5B, SLC1A1, RASL11B, DFFA, WDR37, RPS15A, CPSF6, C11orf16, YY1AP1, RNF183, MTCP1, TULP2, RBPMS, KEL, MYOZ2, FAM131C, HMGA1, NPPB, HERPUD1, CD177, RPL31, VPS72, ACTL6A, RAD23A, MAGEA11, CFDP1, DMRTB1, CXADR, ZNF165, SSBP2, TPGS2, RAB37, CETP, NDUFV1, DYNLL2, NBPF3, CEACAM5, GPBP1L1, SERP2, GNPDA1, C19orf57, ELAVL3, ELAVL4, LILRA3, BAD, CCDC7, MRPS18B, CUEDC2, CNST, TSPAN3, CCDC91, TRIM37, NINL, NTNG2, CPSF7, PGLS, EPT1, MYL6, SMAD4, TMSB4Y, TRPV5, MVK, MAPK1IP1L, MDFI, MTMR9, PLSCR1, RALYL, PDHX, C10orf12, RHOXF2, MATK, SALL2, AGT, KCNMB1, SUV39H2, SMNDC1, ARHGDIA, PUF60, GSK3B, ILK, CD2BP2, BARD1, CREBBP, BTK, SF1, SNRPC, ELK1, PTK2B, CALM1, POU4F1, EZH2, IRF3, TONSL, RFX3, HLTF, SUPT4H1, ZNF184, HIST1H2BN, BLZF1, HDAC3, FXR2, HMGN4, POLR3A, ECD, ZBTB1, SCMH1, SUZ12, E2F8, TRIM5, ZNF383, DHX9, SMN1, PCM1, RAD21, NDRG1, CEBPA, ELAVL1, SIRT7, HNRNPA1, TSG101, TP53, POLR2A, YBX1, TDRD3, CUL3, CUL4A, CUL4B, CUL5, CUL2, CUL1, COPS5, COPS6, DCUN1D1, CAND1, NEDD8, KCND3, ATN1, ATXN3, ERCC5, HBP1, HSPA2, PCBP1, USP7, SRSF5, TMEM126A, SAP30BP, GORASP2, MBD3, MRPS9, HAX1, SFXN1, ITGA5, TCIRG1, RNF168, GEMIN5, HAS1, MTCH1, NDUFA5, MCAT, MRPL57, HDAC2, ESR1, FN1, VCAM1, ITGA4, CD81, PRMT1, SF3B4, EP300, PRRC2A, EWSR1, FUS, ITGB5, NONO, TRAF3, HNRNPUL1, EPAS1, CHERP, CDK12, ITCH, WBP4, RPA3, RPA2, RPA1, HSPA5, RIOK2, TRAF1, TRAF2, SEC24D, TFG, SEC24A, SSBP3, PRR13, ATPAF2, PEF1, JUN, CUL7, OBSL1, CCDC8, RNF2, BMI1, EGFR, ABL1, SRPK1, ABCE1, PRMT8, RPS6KB2, ACAA2, ACAT1, EIF4H, ANXA2, HIP1R, PICALM, POR, NTRK1, SCARNA22, NPM1, KRT2, PRDX2, S100A9, YWHAZ, DDX17, PCLO, ANXA6, SEC24C, GIPC1, CSRP2, FHL1, HNRNPA3, CTTN, MARCKSL1, PARP1, SERPINB3, CCDC50, KIF2A, KRT6B, HIST1H1D, STK38, H2AFV, PACSIN2, U2AF1, RSL24D1, XRCC5, ESYT3, RPL29, SDF2L1, LRP1B, MSN, SEC23A, RPL7A, SNX18, PPIL1, RPS27A, IGHM, SUMO3, GTF2I, RUVBL1, KRT16, RBM8A, RPL8, SRSF9, ZC3HAV1L, GAPDH, ETV3, IGF2R, COL5A2, HNRNPD, ANP32B, WAC, TFAP2A, TTN, CBR3, ARGLU1, HNRNPAB, SRRT, ATP1B3, COPS7B, PRR12, ATF3, NOMO3, NOMO1, NOMO2, EYA3, C1orf198, MAZ, U2AF2, SSB, TRA2B, C1orf52, HMGB1, HMGB1P10, RPRD1A, HNRNPH3, EIF5A2, C1orf131, SEC13, MAPRE1, CSTF2T, SRSF3, LENG1, UPF1, HDGFRP2, RPS10P7, RPS10P11, RPS10, RPS10P13, RPS10P4, RPS10P22, DACH1, ANO1, NCOR1, MLX, SUMO1P3, SUMO1, WIZ, PFDN6, ARFIP2, ZHX3, EEF1B2, MBIP, BAG6, DENND2A, PRCC, SRSF1, EIF4ENIF1, SPTAN1, CDCA8, PLS3, API5P1, API5, PSMA4, DNTTIP1, AKAP8, NCOA3, SMTN, FBRS, SMARCE1, ERC1, WBP11, SPTBN1, NFRKB, OLA1, ZNF207, R3HDM1, TRIM33, SAFB, UBFD1, SRSF7, SRSF2, GATA6, VDAC1P1, VDAC1, IL16, GMNN, ILF2, MED4, QKI, VCL, MFAP1, SNAP29, PADI1, BCL9, BCL9L, PKM, GPATCH11, CASC3, PSMC6, CACYBP, RPL12P6, RPL12P32, RPL12P14, RPL12, RPL12P2, RPL12P35, RPL12P19, TPI1, TPI1P1, CHAF1A, MIA3, CIC, SDCBP, CA2, FKBP3, ACE, NKX2-5, CSTF2, PFDN2, UBTF, FAM207A, LOC729774, BRD8, C12orf45, C1orf35, TCF20, SOD1, SPAG7, MED8, ETS2, ALDOC, FKBP4, INCENP, CEP85, CECR2, TFE3, SUPT16HP1, SUPT16H, MAPT, HTATSF1, RPS18P12, RPS18P5, KPNA2, TMX1, CKAP4, HSPE1, COPRS, PTGES3, LAMP2, ERLIN2, CTNNBL1, TOMM22, NRBF2, C9orf78, NCOA6, MED26, RANBP1, LOC389842, LOC727803, HMGB3, CANX, PUS7, RPSAP19, RPSA, RPSAP18, RPSAP58, RPSAP15, RPSAP8, RPSAP9, RPSAP12, RPSAP29, RPSAP61, ARHGAP17, USF1, PSIP1, SNRPEP2, SNRPE, NUDT5, PPM1G, OTUB1, AHCY, COPS3, NSMCE2, SAE1, PROSER1, GRWD1, CREB5, TAF9B, RBM33, EDF1, PGK1, FAM114A2, SRRM1, RAD23B, CIAPIN1, CIAPIN1P, LRRC59, PABPN1, KMT2A, RPRD1B, GPATCH8, CCDC43, DGCR14, PPP1R2, ERICH1, EIF5A, EIF5AL1, BAG3, PCNA, SOX7, PNISR, FAM168A, MED15, SRSF11, SIRT1, RSF1, MAML1, HPRT1, SPDL1, CRTC3, CEP55, CDV3, ALYREF, RNF40, STOML2, DGCR8, NUCKS1, UBN2, PSMD7, WNT10A, HMBS, KHDRBS1, VBP1, NCSTN, CDCA2, SFSWAP, ZRANB2, DDB1, RBBP6, ZEB1, SRSF6, LOC644422, EIF2S1, RFX5, RPS19, RPS19P3, TALDO1, CWC15, CDCA5, LOC645086, C11orf58, TXN, STX12, PHRF1, BSG, TAF4, SH3GL1, LIN37, HRNR, FAM192A, RRBP1, KIAA0907, GOLGB1, PAX9, P4HB, CHMP5, LDHB, CALR, SUMO2P1, SUMO2, PDIA6, AHSA1, EN2, CCDC124, RPLP0P6, RPLP0P2, RPLP0P3, RPLP0, NIPBL, PDLIM4, PRKCSH, C15orf39, HNRNPDL, PDIA4, NUP210, RPLP2P3, RPLP2, PRDX4, DAZAP1, UBE2T, PHAX, AMOT, MARCKS, LOC284685, SMARCC1, BCORL1, RFC4, GLRX3, ANP32E, HYOU1, NPM3, ATF7IP, SARNP, TRA2A, HDGF, STIP1, PELP1, KCTD12, GLO1, PCF11, CLIC1, DNAJC8, RNF114, SLC4A1AP, FAM50A, GTF2A1, PRPF40A, CDC37, PPIAP22, PPIA, SMARCC2, MEGF11, KIAA1143, DENR, LAMP1, MYBL2, PITX1, UBE2MP1, UBE2M, CHTF8, OTX1, NACA, FNBP4, GTF2F2, GLTSCR1, GTF2E1, PQBP1, EMD, RNF113A, GPALPP1, SNRPA, RRP15, RPS25, RPS25P8, GMEB2, LNPEP, DNAJB1, IGBP1P1, IGBP1, HINT1, ARID1A, PPIB, ANXA11, MATR3, PPARGC1A, MCM2, UBASH3B, SFPQ, CAPN13, HEY1, BRCA1ABRLNX1, APP, ECT2, ERBB2IP, AURKB, CDKN1A, CEP250, CEP57, CEP76, TP53, MOV10, NXF1, HERC2, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for EWSR1_ABR


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for EWSR1_ABR


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneEWSR1C0553580Ewings sarcoma3CTD_human;HPO;ORPHANET
HgeneEWSR1C0206663Neuroectodermal Tumor, Primitive1CTD_human
TgeneABRC0033578Prostatic Neoplasms1CTD_human