FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 12140

FusionGeneSummary for ETHE1_PLAUR

check button Fusion gene summary
Fusion gene informationFusion gene name: ETHE1_PLAUR
Fusion gene ID: 12140
HgeneTgene
Gene symbol

ETHE1

PLAUR

Gene ID

23474

5329

Gene nameETHE1, persulfide dioxygenaseplasminogen activator, urokinase receptor
SynonymsHSCO|YF13H12CD87|U-PAR|UPAR|URKR
Cytomap

19q13.31

19q13.31

Type of geneprotein-codingprotein-coding
Descriptionpersulfide dioxygenase ETHE1, mitochondrialethylmalonic encephalopathy 1hepatoma subtracted clone one proteinprotein ETHE1, mitochondrialsulfur dioxygenase ETHE1urokinase plasminogen activator surface receptormonocyte activation antigen Mo3u-plasminogen activator receptor form 2urokinase-type plasminogen activator (uPA) receptor
Modification date2018052320180523
UniProtAcc

O95571

Q03405

Ensembl transtripts involved in fusion geneENST00000292147, ENST00000600651, 
ENST00000339082, ENST00000601723, 
ENST00000340093, ENST00000221264, 
Fusion gene scores* DoF score8 X 5 X 7=2804 X 2 X 4=32
# samples 84
** MAII scorelog2(8/280*10)=-1.8073549220576
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/32*10)=0.321928094887362
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: ETHE1 [Title/Abstract] AND PLAUR [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneETHE1

GO:0006749

glutathione metabolic process

23144459

HgeneETHE1

GO:0070813

hydrogen sulfide metabolic process

23144459

TgenePLAUR

GO:0043388

positive regulation of DNA binding

22984561


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVESCATCGA-L5-A8NI-01AETHE1chr19

44030667

-PLAURchr19

44159725

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000292147ENST00000339082ETHE1chr19

44030667

-PLAURchr19

44159725

-
In-frameENST00000292147ENST00000601723ETHE1chr19

44030667

-PLAURchr19

44159725

-
In-frameENST00000292147ENST00000340093ETHE1chr19

44030667

-PLAURchr19

44159725

-
5CDS-intronENST00000292147ENST00000221264ETHE1chr19

44030667

-PLAURchr19

44159725

-
In-frameENST00000600651ENST00000339082ETHE1chr19

44030667

-PLAURchr19

44159725

-
In-frameENST00000600651ENST00000601723ETHE1chr19

44030667

-PLAURchr19

44159725

-
In-frameENST00000600651ENST00000340093ETHE1chr19

44030667

-PLAURchr19

44159725

-
5CDS-intronENST00000600651ENST00000221264ETHE1chr19

44030667

-PLAURchr19

44159725

-

Top

FusionProtFeatures for ETHE1_PLAUR


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ETHE1

O95571

PLAUR

Q03405

Sulfur dioxygenase that plays an essential role inhydrogen sulfide catabolism in the mitochondrial matrix. Hydrogensulfide (H(2)S) is first oxidized by SQRDL, giving rise tocysteine persulfide residues. ETHE1 consumes molecular oxygen tocatalyze the oxidation of the persulfide, once it has beentransferred to a thiophilic acceptor, such as glutathione (R-SSH).Plays an important role in metabolic homeostasis in mitochondriaby metabolizing hydrogen sulfide and preventing the accumulationof supraphysiological H(2)S levels that have toxic effects, due tothe inhibition of cytochrome c oxidase. First described as aprotein that can shuttle between the nucleus and the cytoplasm andsuppress p53-induced apoptosis by sequestering the transcriptionfactor RELA/NFKB3 in the cytoplasm and preventing its accumulationin the nucleus (PubMed:12398897). {ECO:0000269|PubMed:12398897,ECO:0000269|PubMed:14732903, ECO:0000269|PubMed:19136963,ECO:0000269|PubMed:23144459}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgenePLAURchr19:44030667chr19:44159725ENST00000221264-06115_213-143291DomainNote=UPAR/Ly6 2
TgenePLAURchr19:44030667chr19:44159725ENST00000221264-06214_305-143291DomainNote=UPAR/Ly6 3
TgenePLAURchr19:44030667chr19:44159725ENST00000221264-0623_114-143291DomainNote=UPAR/Ly6 1
TgenePLAURchr19:44030667chr19:44159725ENST00000339082-37214_305157282DomainNote=UPAR/Ly6 3
TgenePLAURchr19:44030667chr19:44159725ENST00000340093-37214_305157336DomainNote=UPAR/Ly6 3

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgenePLAURchr19:44030667chr19:44159725ENST00000339082-37115_213157282DomainNote=UPAR/Ly6 2
TgenePLAURchr19:44030667chr19:44159725ENST00000339082-3723_114157282DomainNote=UPAR/Ly6 1
TgenePLAURchr19:44030667chr19:44159725ENST00000340093-37115_213157336DomainNote=UPAR/Ly6 2
TgenePLAURchr19:44030667chr19:44159725ENST00000340093-3723_114157336DomainNote=UPAR/Ly6 1


Top

FusionGeneSequence for ETHE1_PLAUR


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ETHE1_ENST00000292147_chr19_44030667_-_PLAUR_ENST00000339082_chr19_44159725_-_200aa
MAEAVLRVARRQLSQRGGSGAPILLRQMFEPVSCTFTYLLGDRESREAVLIDPVLETAPRDAQLIKELGLRLLTAGRPKDDRHLRGCGYL
PGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHERSLWGSWLPC

>In-frame_ETHE1_ENST00000292147_chr19_44030667_-_PLAUR_ENST00000601723_chr19_44159725_-_205aa
MAEAVLRVARRQLSQRGGSGAPILLRQMFEPVSCTFTYLLGDRESREAVLIDPVLETAPRDAQLIKELGLRLLTAGRPKDDRHLRGCGYL
PGCPGSNGFHNNDTFHFLKCCNTTKCNEGPKPKNQSTMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSGAAPQPG

>In-frame_ETHE1_ENST00000292147_chr19_44030667_-_PLAUR_ENST00000340093_chr19_44159725_-_254aa
MAEAVLRVARRQLSQRGGSGAPILLRQMFEPVSCTFTYLLGDRESREAVLIDPVLETAPRDAQLIKELGLRLLTAGRPKDDRHLRGCGYL
PGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSTMVRG

>In-frame_ETHE1_ENST00000600651_chr19_44030667_-_PLAUR_ENST00000339082_chr19_44159725_-_200aa
MAEAVLRVARRQLSQRGGSGAPILLRQMFEPVSCTFTYLLGDRESREAVLIDPVLETAPRDAQLIKELGLRLLTAGRPKDDRHLRGCGYL
PGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHERSLWGSWLPC

>In-frame_ETHE1_ENST00000600651_chr19_44030667_-_PLAUR_ENST00000601723_chr19_44159725_-_205aa
MAEAVLRVARRQLSQRGGSGAPILLRQMFEPVSCTFTYLLGDRESREAVLIDPVLETAPRDAQLIKELGLRLLTAGRPKDDRHLRGCGYL
PGCPGSNGFHNNDTFHFLKCCNTTKCNEGPKPKNQSTMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSGAAPQPG

>In-frame_ETHE1_ENST00000600651_chr19_44030667_-_PLAUR_ENST00000340093_chr19_44159725_-_254aa
MAEAVLRVARRQLSQRGGSGAPILLRQMFEPVSCTFTYLLGDRESREAVLIDPVLETAPRDAQLIKELGLRLLTAGRPKDDRHLRGCGYL
PGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSTMVRG


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ETHE1_ENST00000292147_chr19_44030667_-_PLAUR_ENST00000339082_chr19_44159725_-_600nt
ATGGCGGAGGCTGTACTGAGGGTCGCCCGGCGGCAGCTGAGCCAGCGCGGCGGGTCTGGAGCCCCCATCCTCCTGCGGCAGATGTTCGAG
CCTGTGAGCTGCACCTTCACGTACCTGCTGGGTGACAGAGAGTCCCGGGAGGCCGTTCTGATCGACCCAGTCCTGGAAACAGCGCCTCGG
GATGCCCAGCTGATCAAGGAGCTGGGGCTGCGGCTGCTCTATGCTGGGCGTCCAAAGGATGACCGCCACCTCCGTGGCTGTGGCTACCTT
CCCGGCTGCCCGGGCTCCAATGGTTTCCACAACAACGACACCTTCCACTTCCTGAAATGCTGCAACACCACCAAATGCAACGAGGGCCCA
ATCCTGGAGCTTGAAAATCTGCCGCAGAATGGCCGCCAGTGTTACAGCTGCAAGGGGAACAGCACCCATGGATGCTCCTCTGAAGAGACT
TTCCTCATTGACTGCCGAGGCCCCATGAATCAATGTCTGGTAGCCACCGGCACTCACGAACGCTCACTCTGGGGAAGCTGGTTGCCATGT

>In-frame_ETHE1_ENST00000292147_chr19_44030667_-_PLAUR_ENST00000601723_chr19_44159725_-_615nt
ATGGCGGAGGCTGTACTGAGGGTCGCCCGGCGGCAGCTGAGCCAGCGCGGCGGGTCTGGAGCCCCCATCCTCCTGCGGCAGATGTTCGAG
CCTGTGAGCTGCACCTTCACGTACCTGCTGGGTGACAGAGAGTCCCGGGAGGCCGTTCTGATCGACCCAGTCCTGGAAACAGCGCCTCGG
GATGCCCAGCTGATCAAGGAGCTGGGGCTGCGGCTGCTCTATGCTGGGCGTCCAAAGGATGACCGCCACCTCCGTGGCTGTGGCTACCTT
CCCGGCTGCCCGGGCTCCAATGGTTTCCACAACAACGACACCTTCCACTTCCTGAAATGCTGCAACACCACCAAATGCAACGAGGGCCCA
AAACCGAAAAACCAAAGCTATATGGTAAGAGGCTGTGCAACCGCCTCAATGTGCCAACATGCCCACCTGGGTGACGCCTTCAGCATGAAC
CACATTGATGTCTCCTGCTGTACTAAAAGTGGCTGTAACCACCCAGACCTGGATGTCCAGTACCGCAGTGGGGCTGCTCCTCAGCCTGGC

>In-frame_ETHE1_ENST00000292147_chr19_44030667_-_PLAUR_ENST00000340093_chr19_44159725_-_762nt
ATGGCGGAGGCTGTACTGAGGGTCGCCCGGCGGCAGCTGAGCCAGCGCGGCGGGTCTGGAGCCCCCATCCTCCTGCGGCAGATGTTCGAG
CCTGTGAGCTGCACCTTCACGTACCTGCTGGGTGACAGAGAGTCCCGGGAGGCCGTTCTGATCGACCCAGTCCTGGAAACAGCGCCTCGG
GATGCCCAGCTGATCAAGGAGCTGGGGCTGCGGCTGCTCTATGCTGGGCGTCCAAAGGATGACCGCCACCTCCGTGGCTGTGGCTACCTT
CCCGGCTGCCCGGGCTCCAATGGTTTCCACAACAACGACACCTTCCACTTCCTGAAATGCTGCAACACCACCAAATGCAACGAGGGCCCA
ATCCTGGAGCTTGAAAATCTGCCGCAGAATGGCCGCCAGTGTTACAGCTGCAAGGGGAACAGCACCCATGGATGCTCCTCTGAAGAGACT
TTCCTCATTGACTGCCGAGGCCCCATGAATCAATGTCTGGTAGCCACCGGCACTCACGAACCGAAAAACCAAAGCTATATGGTAAGAGGC
TGTGCAACCGCCTCAATGTGCCAACATGCCCACCTGGGTGACGCCTTCAGCATGAACCACATTGATGTCTCCTGCTGTACTAAAAGTGGC
TGTAACCACCCAGACCTGGATGTCCAGTACCGCAGTGGGGCTGCTCCTCAGCCTGGCCCTGCCCATCTCAGCCTCACCATCACCCTGCTA

>In-frame_ETHE1_ENST00000600651_chr19_44030667_-_PLAUR_ENST00000339082_chr19_44159725_-_600nt
ATGGCGGAGGCTGTACTGAGGGTCGCCCGGCGGCAGCTGAGCCAGCGCGGCGGGTCTGGAGCCCCCATCCTCCTGCGGCAGATGTTCGAG
CCTGTGAGCTGCACCTTCACGTACCTGCTGGGTGACAGAGAGTCCCGGGAGGCCGTTCTGATCGACCCAGTCCTGGAAACAGCGCCTCGG
GATGCCCAGCTGATCAAGGAGCTGGGGCTGCGGCTGCTCTATGCTGGGCGTCCAAAGGATGACCGCCACCTCCGTGGCTGTGGCTACCTT
CCCGGCTGCCCGGGCTCCAATGGTTTCCACAACAACGACACCTTCCACTTCCTGAAATGCTGCAACACCACCAAATGCAACGAGGGCCCA
ATCCTGGAGCTTGAAAATCTGCCGCAGAATGGCCGCCAGTGTTACAGCTGCAAGGGGAACAGCACCCATGGATGCTCCTCTGAAGAGACT
TTCCTCATTGACTGCCGAGGCCCCATGAATCAATGTCTGGTAGCCACCGGCACTCACGAACGCTCACTCTGGGGAAGCTGGTTGCCATGT

>In-frame_ETHE1_ENST00000600651_chr19_44030667_-_PLAUR_ENST00000601723_chr19_44159725_-_615nt
ATGGCGGAGGCTGTACTGAGGGTCGCCCGGCGGCAGCTGAGCCAGCGCGGCGGGTCTGGAGCCCCCATCCTCCTGCGGCAGATGTTCGAG
CCTGTGAGCTGCACCTTCACGTACCTGCTGGGTGACAGAGAGTCCCGGGAGGCCGTTCTGATCGACCCAGTCCTGGAAACAGCGCCTCGG
GATGCCCAGCTGATCAAGGAGCTGGGGCTGCGGCTGCTCTATGCTGGGCGTCCAAAGGATGACCGCCACCTCCGTGGCTGTGGCTACCTT
CCCGGCTGCCCGGGCTCCAATGGTTTCCACAACAACGACACCTTCCACTTCCTGAAATGCTGCAACACCACCAAATGCAACGAGGGCCCA
AAACCGAAAAACCAAAGCTATATGGTAAGAGGCTGTGCAACCGCCTCAATGTGCCAACATGCCCACCTGGGTGACGCCTTCAGCATGAAC
CACATTGATGTCTCCTGCTGTACTAAAAGTGGCTGTAACCACCCAGACCTGGATGTCCAGTACCGCAGTGGGGCTGCTCCTCAGCCTGGC

>In-frame_ETHE1_ENST00000600651_chr19_44030667_-_PLAUR_ENST00000340093_chr19_44159725_-_762nt
ATGGCGGAGGCTGTACTGAGGGTCGCCCGGCGGCAGCTGAGCCAGCGCGGCGGGTCTGGAGCCCCCATCCTCCTGCGGCAGATGTTCGAG
CCTGTGAGCTGCACCTTCACGTACCTGCTGGGTGACAGAGAGTCCCGGGAGGCCGTTCTGATCGACCCAGTCCTGGAAACAGCGCCTCGG
GATGCCCAGCTGATCAAGGAGCTGGGGCTGCGGCTGCTCTATGCTGGGCGTCCAAAGGATGACCGCCACCTCCGTGGCTGTGGCTACCTT
CCCGGCTGCCCGGGCTCCAATGGTTTCCACAACAACGACACCTTCCACTTCCTGAAATGCTGCAACACCACCAAATGCAACGAGGGCCCA
ATCCTGGAGCTTGAAAATCTGCCGCAGAATGGCCGCCAGTGTTACAGCTGCAAGGGGAACAGCACCCATGGATGCTCCTCTGAAGAGACT
TTCCTCATTGACTGCCGAGGCCCCATGAATCAATGTCTGGTAGCCACCGGCACTCACGAACCGAAAAACCAAAGCTATATGGTAAGAGGC
TGTGCAACCGCCTCAATGTGCCAACATGCCCACCTGGGTGACGCCTTCAGCATGAACCACATTGATGTCTCCTGCTGTACTAAAAGTGGC
TGTAACCACCCAGACCTGGATGTCCAGTACCGCAGTGGGGCTGCTCCTCAGCCTGGCCCTGCCCATCTCAGCCTCACCATCACCCTGCTA


* Fusion transcript sequences (Full-length transcript).
>In-frame_ETHE1_ENST00000292147_chr19_44030667_-_PLAUR_ENST00000339082_chr19_44159725_-_1029nt
AGTGCCGTAGCGCCCGGCTCCTGCAGGCGCTCGGCCTCCGCTCATTCCTGACCCCGCAGTGGGCGCGATGGCGGAGGCTGTACTGAGGGT
CGCCCGGCGGCAGCTGAGCCAGCGCGGCGGGTCTGGAGCCCCCATCCTCCTGCGGCAGATGTTCGAGCCTGTGAGCTGCACCTTCACGTA
CCTGCTGGGTGACAGAGAGTCCCGGGAGGCCGTTCTGATCGACCCAGTCCTGGAAACAGCGCCTCGGGATGCCCAGCTGATCAAGGAGCT
GGGGCTGCGGCTGCTCTATGCTGGGCGTCCAAAGGATGACCGCCACCTCCGTGGCTGTGGCTACCTTCCCGGCTGCCCGGGCTCCAATGG
TTTCCACAACAACGACACCTTCCACTTCCTGAAATGCTGCAACACCACCAAATGCAACGAGGGCCCAATCCTGGAGCTTGAAAATCTGCC
GCAGAATGGCCGCCAGTGTTACAGCTGCAAGGGGAACAGCACCCATGGATGCTCCTCTGAAGAGACTTTCCTCATTGACTGCCGAGGCCC
CATGAATCAATGTCTGGTAGCCACCGGCACTCACGAACGCTCACTCTGGGGAAGCTGGTTGCCATGTAAAAGTACTACTGCCCTGAGACC
ACCATGCTGTGAGGAAGCCCAAGCTACTCATGTATAAATGCCATGTGGAGATAGAGCCCCAGATGTTTCAGCCATCTCAGCCCAGGCACC
AGACAAGTGGGTGAAGAAGCCACCTTGGACATGTAGCCCCAGCAGATGTGATATAGAGAAGAAACAGGAAACTTGGCTATATTAGTTTCC
TAGGGCTGCCTGTGATAAATTATTACAAACTTTATAAACTAACACATTGTGTGCCTATATCAAAACATCATGGAAGGACAGGCACAGTGG
CTCATGCCTGTAGTCCTAGCACTTTGGGAGGGTGAGAAAGGAAGATCTCTTGAGCTCAGGAGTTCAAGATCAGCCTGGGCAACACAGTGA

>In-frame_ETHE1_ENST00000292147_chr19_44030667_-_PLAUR_ENST00000601723_chr19_44159725_-_993nt
AGTGCCGTAGCGCCCGGCTCCTGCAGGCGCTCGGCCTCCGCTCATTCCTGACCCCGCAGTGGGCGCGATGGCGGAGGCTGTACTGAGGGT
CGCCCGGCGGCAGCTGAGCCAGCGCGGCGGGTCTGGAGCCCCCATCCTCCTGCGGCAGATGTTCGAGCCTGTGAGCTGCACCTTCACGTA
CCTGCTGGGTGACAGAGAGTCCCGGGAGGCCGTTCTGATCGACCCAGTCCTGGAAACAGCGCCTCGGGATGCCCAGCTGATCAAGGAGCT
GGGGCTGCGGCTGCTCTATGCTGGGCGTCCAAAGGATGACCGCCACCTCCGTGGCTGTGGCTACCTTCCCGGCTGCCCGGGCTCCAATGG
TTTCCACAACAACGACACCTTCCACTTCCTGAAATGCTGCAACACCACCAAATGCAACGAGGGCCCAAAACCGAAAAACCAAAGCTATAT
GGTAAGAGGCTGTGCAACCGCCTCAATGTGCCAACATGCCCACCTGGGTGACGCCTTCAGCATGAACCACATTGATGTCTCCTGCTGTAC
TAAAAGTGGCTGTAACCACCCAGACCTGGATGTCCAGTACCGCAGTGGGGCTGCTCCTCAGCCTGGCCCTGCCCATCTCAGCCTCACCAT
CACCCTGCTAATGACTGCCAGACTGTGGGGAGGCACTCTCCTCTGGACCTAAACCTGAAATCCCCCTCTCTGCCCTGGCTGGATCCGGGG
GACCCCTTTGCCCTTCCCTCGGCTCCCAGCCCTACAGACTTGCTGTGTGACCTCAGGCCAGTGTGCCGACCTCTCTGGGCCTCAGTTTTC
CCAGCTATGAAAACAGCTATCTCACAAAGTTGTGTGAAGCAGAAGAGAAAAGCTGGAGGAAGGCCGTGGGCCAATGGGAGAGCTCTTGTT
ATTATTAATATTGTTGCCGCTGTTGTGTTGTTGTTATTAATTAATATTCATATTATTTATTTTATACTTACATAAAGATTTTGTACCAGT

>In-frame_ETHE1_ENST00000292147_chr19_44030667_-_PLAUR_ENST00000340093_chr19_44159725_-_1139nt
AGTGCCGTAGCGCCCGGCTCCTGCAGGCGCTCGGCCTCCGCTCATTCCTGACCCCGCAGTGGGCGCGATGGCGGAGGCTGTACTGAGGGT
CGCCCGGCGGCAGCTGAGCCAGCGCGGCGGGTCTGGAGCCCCCATCCTCCTGCGGCAGATGTTCGAGCCTGTGAGCTGCACCTTCACGTA
CCTGCTGGGTGACAGAGAGTCCCGGGAGGCCGTTCTGATCGACCCAGTCCTGGAAACAGCGCCTCGGGATGCCCAGCTGATCAAGGAGCT
GGGGCTGCGGCTGCTCTATGCTGGGCGTCCAAAGGATGACCGCCACCTCCGTGGCTGTGGCTACCTTCCCGGCTGCCCGGGCTCCAATGG
TTTCCACAACAACGACACCTTCCACTTCCTGAAATGCTGCAACACCACCAAATGCAACGAGGGCCCAATCCTGGAGCTTGAAAATCTGCC
GCAGAATGGCCGCCAGTGTTACAGCTGCAAGGGGAACAGCACCCATGGATGCTCCTCTGAAGAGACTTTCCTCATTGACTGCCGAGGCCC
CATGAATCAATGTCTGGTAGCCACCGGCACTCACGAACCGAAAAACCAAAGCTATATGGTAAGAGGCTGTGCAACCGCCTCAATGTGCCA
ACATGCCCACCTGGGTGACGCCTTCAGCATGAACCACATTGATGTCTCCTGCTGTACTAAAAGTGGCTGTAACCACCCAGACCTGGATGT
CCAGTACCGCAGTGGGGCTGCTCCTCAGCCTGGCCCTGCCCATCTCAGCCTCACCATCACCCTGCTAATGACTGCCAGACTGTGGGGAGG
CACTCTCCTCTGGACCTAAACCTGAAATCCCCCTCTCTGCCCTGGCTGGATCCGGGGGACCCCTTTGCCCTTCCCTCGGCTCCCAGCCCT
ACAGACTTGCTGTGTGACCTCAGGCCAGTGTGCCGACCTCTCTGGGCCTCAGTTTTCCCAGCTATGAAAACAGCTATCTCACAAAGTTGT
GTGAAGCAGAAGAGAAAAGCTGGAGGAAGGCCGTGGGCCAATGGGAGAGCTCTTGTTATTATTAATATTGTTGCCGCTGTTGTGTTGTTG

>In-frame_ETHE1_ENST00000600651_chr19_44030667_-_PLAUR_ENST00000339082_chr19_44159725_-_986nt
ATTCCTGACCCCGCAGTGGGCGCGATGGCGGAGGCTGTACTGAGGGTCGCCCGGCGGCAGCTGAGCCAGCGCGGCGGGTCTGGAGCCCCC
ATCCTCCTGCGGCAGATGTTCGAGCCTGTGAGCTGCACCTTCACGTACCTGCTGGGTGACAGAGAGTCCCGGGAGGCCGTTCTGATCGAC
CCAGTCCTGGAAACAGCGCCTCGGGATGCCCAGCTGATCAAGGAGCTGGGGCTGCGGCTGCTCTATGCTGGGCGTCCAAAGGATGACCGC
CACCTCCGTGGCTGTGGCTACCTTCCCGGCTGCCCGGGCTCCAATGGTTTCCACAACAACGACACCTTCCACTTCCTGAAATGCTGCAAC
ACCACCAAATGCAACGAGGGCCCAATCCTGGAGCTTGAAAATCTGCCGCAGAATGGCCGCCAGTGTTACAGCTGCAAGGGGAACAGCACC
CATGGATGCTCCTCTGAAGAGACTTTCCTCATTGACTGCCGAGGCCCCATGAATCAATGTCTGGTAGCCACCGGCACTCACGAACGCTCA
CTCTGGGGAAGCTGGTTGCCATGTAAAAGTACTACTGCCCTGAGACCACCATGCTGTGAGGAAGCCCAAGCTACTCATGTATAAATGCCA
TGTGGAGATAGAGCCCCAGATGTTTCAGCCATCTCAGCCCAGGCACCAGACAAGTGGGTGAAGAAGCCACCTTGGACATGTAGCCCCAGC
AGATGTGATATAGAGAAGAAACAGGAAACTTGGCTATATTAGTTTCCTAGGGCTGCCTGTGATAAATTATTACAAACTTTATAAACTAAC
ACATTGTGTGCCTATATCAAAACATCATGGAAGGACAGGCACAGTGGCTCATGCCTGTAGTCCTAGCACTTTGGGAGGGTGAGAAAGGAA

>In-frame_ETHE1_ENST00000600651_chr19_44030667_-_PLAUR_ENST00000601723_chr19_44159725_-_950nt
ATTCCTGACCCCGCAGTGGGCGCGATGGCGGAGGCTGTACTGAGGGTCGCCCGGCGGCAGCTGAGCCAGCGCGGCGGGTCTGGAGCCCCC
ATCCTCCTGCGGCAGATGTTCGAGCCTGTGAGCTGCACCTTCACGTACCTGCTGGGTGACAGAGAGTCCCGGGAGGCCGTTCTGATCGAC
CCAGTCCTGGAAACAGCGCCTCGGGATGCCCAGCTGATCAAGGAGCTGGGGCTGCGGCTGCTCTATGCTGGGCGTCCAAAGGATGACCGC
CACCTCCGTGGCTGTGGCTACCTTCCCGGCTGCCCGGGCTCCAATGGTTTCCACAACAACGACACCTTCCACTTCCTGAAATGCTGCAAC
ACCACCAAATGCAACGAGGGCCCAAAACCGAAAAACCAAAGCTATATGGTAAGAGGCTGTGCAACCGCCTCAATGTGCCAACATGCCCAC
CTGGGTGACGCCTTCAGCATGAACCACATTGATGTCTCCTGCTGTACTAAAAGTGGCTGTAACCACCCAGACCTGGATGTCCAGTACCGC
AGTGGGGCTGCTCCTCAGCCTGGCCCTGCCCATCTCAGCCTCACCATCACCCTGCTAATGACTGCCAGACTGTGGGGAGGCACTCTCCTC
TGGACCTAAACCTGAAATCCCCCTCTCTGCCCTGGCTGGATCCGGGGGACCCCTTTGCCCTTCCCTCGGCTCCCAGCCCTACAGACTTGC
TGTGTGACCTCAGGCCAGTGTGCCGACCTCTCTGGGCCTCAGTTTTCCCAGCTATGAAAACAGCTATCTCACAAAGTTGTGTGAAGCAGA
AGAGAAAAGCTGGAGGAAGGCCGTGGGCCAATGGGAGAGCTCTTGTTATTATTAATATTGTTGCCGCTGTTGTGTTGTTGTTATTAATTA

>In-frame_ETHE1_ENST00000600651_chr19_44030667_-_PLAUR_ENST00000340093_chr19_44159725_-_1096nt
ATTCCTGACCCCGCAGTGGGCGCGATGGCGGAGGCTGTACTGAGGGTCGCCCGGCGGCAGCTGAGCCAGCGCGGCGGGTCTGGAGCCCCC
ATCCTCCTGCGGCAGATGTTCGAGCCTGTGAGCTGCACCTTCACGTACCTGCTGGGTGACAGAGAGTCCCGGGAGGCCGTTCTGATCGAC
CCAGTCCTGGAAACAGCGCCTCGGGATGCCCAGCTGATCAAGGAGCTGGGGCTGCGGCTGCTCTATGCTGGGCGTCCAAAGGATGACCGC
CACCTCCGTGGCTGTGGCTACCTTCCCGGCTGCCCGGGCTCCAATGGTTTCCACAACAACGACACCTTCCACTTCCTGAAATGCTGCAAC
ACCACCAAATGCAACGAGGGCCCAATCCTGGAGCTTGAAAATCTGCCGCAGAATGGCCGCCAGTGTTACAGCTGCAAGGGGAACAGCACC
CATGGATGCTCCTCTGAAGAGACTTTCCTCATTGACTGCCGAGGCCCCATGAATCAATGTCTGGTAGCCACCGGCACTCACGAACCGAAA
AACCAAAGCTATATGGTAAGAGGCTGTGCAACCGCCTCAATGTGCCAACATGCCCACCTGGGTGACGCCTTCAGCATGAACCACATTGAT
GTCTCCTGCTGTACTAAAAGTGGCTGTAACCACCCAGACCTGGATGTCCAGTACCGCAGTGGGGCTGCTCCTCAGCCTGGCCCTGCCCAT
CTCAGCCTCACCATCACCCTGCTAATGACTGCCAGACTGTGGGGAGGCACTCTCCTCTGGACCTAAACCTGAAATCCCCCTCTCTGCCCT
GGCTGGATCCGGGGGACCCCTTTGCCCTTCCCTCGGCTCCCAGCCCTACAGACTTGCTGTGTGACCTCAGGCCAGTGTGCCGACCTCTCT
GGGCCTCAGTTTTCCCAGCTATGAAAACAGCTATCTCACAAAGTTGTGTGAAGCAGAAGAGAAAAGCTGGAGGAAGGCCGTGGGCCAATG
GGAGAGCTCTTGTTATTATTAATATTGTTGCCGCTGTTGTGTTGTTGTTATTAATTAATATTCATATTATTTATTTTATACTTACATAAA


Top

FusionGenePPI for ETHE1_PLAUR


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ETHE1IGSF21, LRIF1, RELA, TP53, HDAC1, APP, FGL1, IDH1, NDUFS7PLAURITGB2, KNG1, EEF1A1, PFN2, FAP, ITGAM, PLAU, IGF2R, LRP1, JAK1, TYK2, PSAP, OXCT1, CTSA, CTTN, SELENBP1, SCAF4, VMA21, HDLBP, SDHAF2, UBQLN2, WDHD1, NOTCH2, TXNDC17, TBCA, ELAVL1, LYN, TEX101, TUBB3, GYLTL1B, LARGE, PKN1, PXDN, ZNF146, MBTPS1, DNA2, TAZ, LAMB2, POGLUT1, POMGNT2, ARSA, GALNS, EXT1, CHSY1, CHSY3, DDX11, DDX11L8, TUBA1A, LOXL2, ADCK1, MAN2A1, SPCS2, EOGT, NAGLU, DNAJB9, NDST2, NDST1, SGSH, ARSK, FUT11, DARS2, CNTNAP3B, MAN1A1, MGAT4B, PI4K2B, PCYOX1, FASTKD3, PCSK5, CDYL, MGAT5, LEPREL2, RPUSD3, GCLM, GALNT18, ARSB, HUS1, MELK, EMILIN3, TATDN2, CERCAM, DHFRL1, TRMT11, KIAA0391, HOXD13, DHRS4, MANEA, CCRN4L, PLTP, NR2F2, ST3GAL4, UBE3A, PPOX, MAN2A2, NEK4, EGFL7, PCYOX1L, XRCC3, MCM9, TOP2B, GLB1, TUBA4A, BMP8B, TXNDC16


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ETHE1_PLAUR


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgenePLAURQ03405DB00009AlteplaseUrokinase plasminogen activator surface receptorbiotechapproved
TgenePLAURQ03405DB00029AnistreplaseUrokinase plasminogen activator surface receptorbiotechapproved
TgenePLAURQ03405DB00031TenecteplaseUrokinase plasminogen activator surface receptorbiotechapproved
TgenePLAURQ03405DB00015ReteplaseUrokinase plasminogen activator surface receptorbiotechapproved|investigational
TgenePLAURQ03405DB00013UrokinaseUrokinase plasminogen activator surface receptorbiotechapproved|investigational|withdrawn

Top

RelatedDiseases for ETHE1_PLAUR


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneETHE1C1865349Ethylmalonic encephalopathy2CTD_human;ORPHANET;UNIPROT
TgenePLAURC0004352Autistic Disorder2CTD_human
TgenePLAURC0021368Inflammation1CTD_human
TgenePLAURC0027626Neoplasm Invasiveness1CTD_human
TgenePLAURC0027627Neoplasm Metastasis1CTD_human
TgenePLAURC0033578Prostatic Neoplasms1CTD_human
TgenePLAURC3495559Juvenile arthritis1CTD_human