FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 1193

FusionGeneSummary for AHCYL2_SND1

check button Fusion gene summary
Fusion gene informationFusion gene name: AHCYL2_SND1
Fusion gene ID: 1193
HgeneTgene
Gene symbol

AHCYL2

SND1

Gene ID

23382

27044

Gene nameadenosylhomocysteinase like 2staphylococcal nuclease and tudor domain containing 1
SynonymsADOHCYASE3|IRBIT2TDRD11|Tudor-SN|p100
Cytomap

7q32.1

7q32.1

Type of geneprotein-codingprotein-coding
Descriptionadenosylhomocysteinase 3IP(3)Rs binding protein released with IP(3) 2S-adenosyl-L-homocysteine hydrolase 3S-adenosylhomocysteine hydrolase-like 2long-IRBITputative adenosylhomocysteinase 3staphylococcal nuclease domain-containing protein 1EBNA2 coactivator p100testis tissue sperm-binding protein Li 82Ptudor domain-containing protein 11
Modification date2018052320180523
UniProtAcc

Q96HN2

Q7KZF4

Ensembl transtripts involved in fusion geneENST00000325006, ENST00000446544, 
ENST00000531335, ENST00000474594, 
ENST00000446212, ENST00000490911, 
ENST00000472554, 
ENST00000354725, 
ENST00000467238, 
Fusion gene scores* DoF score4 X 4 X 3=4820 X 15 X 10=3000
# samples 621
** MAII scorelog2(6/48*10)=0.321928094887362
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
log2(21/3000*10)=-3.83650126771712
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: AHCYL2 [Title/Abstract] AND SND1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPRADTCGA-EJ-A46G-01AAHCYL2chr7

128865280

+SND1chr7

127714554

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000325006ENST00000354725AHCYL2chr7

128865280

+SND1chr7

127714554

+
5CDS-intronENST00000325006ENST00000467238AHCYL2chr7

128865280

+SND1chr7

127714554

+
In-frameENST00000446544ENST00000354725AHCYL2chr7

128865280

+SND1chr7

127714554

+
5CDS-intronENST00000446544ENST00000467238AHCYL2chr7

128865280

+SND1chr7

127714554

+
intron-3CDSENST00000531335ENST00000354725AHCYL2chr7

128865280

+SND1chr7

127714554

+
intron-intronENST00000531335ENST00000467238AHCYL2chr7

128865280

+SND1chr7

127714554

+
intron-3CDSENST00000474594ENST00000354725AHCYL2chr7

128865280

+SND1chr7

127714554

+
intron-intronENST00000474594ENST00000467238AHCYL2chr7

128865280

+SND1chr7

127714554

+
intron-3CDSENST00000446212ENST00000354725AHCYL2chr7

128865280

+SND1chr7

127714554

+
intron-intronENST00000446212ENST00000467238AHCYL2chr7

128865280

+SND1chr7

127714554

+
intron-3CDSENST00000490911ENST00000354725AHCYL2chr7

128865280

+SND1chr7

127714554

+
intron-intronENST00000490911ENST00000467238AHCYL2chr7

128865280

+SND1chr7

127714554

+
intron-3CDSENST00000472554ENST00000354725AHCYL2chr7

128865280

+SND1chr7

127714554

+
intron-intronENST00000472554ENST00000467238AHCYL2chr7

128865280

+SND1chr7

127714554

+

Top

FusionProtFeatures for AHCYL2_SND1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
AHCYL2

Q96HN2

SND1

Q7KZF4

May regulate the electrogenic sodium/bicarbonatecotransporter SLC4A4 activity and Mg(2+)-sensitivity. On thecontrary of its homolog AHCYL1, does not regulate ITPR1sensitivity to inositol 1,4,5-trisphosphate (PubMed:19220705).{ECO:0000250|UniProtKB:A6QLP2, ECO:0000269|PubMed:19220705}. Functions as a bridging factor between STAT6 and thebasal transcription factor. Plays a role in PIM1 regulation of MYBactivity. Functions as a transcriptional coactivator for theEpstein-Barr virus nuclear antigen 2 (EBNA2).{ECO:0000269|PubMed:7651391}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneSND1chr7:128865280chr7:127714554ENST00000354725+1524729_787593911DomainTudor

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneAHCYL2chr7:128865280chr7:127714554ENST00000325006+117336_338121612Nucleotide bindingNAD
HgeneAHCYL2chr7:128865280chr7:127714554ENST00000325006+117401_406121612Nucleotide bindingNAD
HgeneAHCYL2chr7:128865280chr7:127714554ENST00000325006+117478_479121612Nucleotide bindingNAD
HgeneAHCYL2chr7:128865280chr7:127714554ENST00000446544+117336_338121611Nucleotide bindingNAD
HgeneAHCYL2chr7:128865280chr7:127714554ENST00000446544+117401_406121611Nucleotide bindingNAD
HgeneAHCYL2chr7:128865280chr7:127714554ENST00000446544+117478_479121611Nucleotide bindingNAD
HgeneAHCYL2chr7:128865280chr7:127714554ENST00000474594+117336_338-118509Nucleotide bindingNAD
HgeneAHCYL2chr7:128865280chr7:127714554ENST00000474594+117401_406-118509Nucleotide bindingNAD
HgeneAHCYL2chr7:128865280chr7:127714554ENST00000474594+117478_479-118509Nucleotide bindingNAD
HgeneAHCYL2chr7:128865280chr7:127714554ENST00000490911+117336_338-76509Nucleotide bindingNAD
HgeneAHCYL2chr7:128865280chr7:127714554ENST00000490911+117401_406-76509Nucleotide bindingNAD
HgeneAHCYL2chr7:128865280chr7:127714554ENST00000490911+117478_479-76509Nucleotide bindingNAD
TgeneSND1chr7:128865280chr7:127714554ENST00000354725+152418_166593911DomainTNase-like 1
TgeneSND1chr7:128865280chr7:127714554ENST00000354725+1524193_328593911DomainTNase-like 2
TgeneSND1chr7:128865280chr7:127714554ENST00000354725+1524341_496593911DomainTNase-like 3
TgeneSND1chr7:128865280chr7:127714554ENST00000354725+1524525_660593911DomainTNase-like 4
TgeneSND1chr7:128865280chr7:127714554ENST00000354725+1524321_325593911MotifNuclear localization signal
TgeneSND1chr7:128865280chr7:127714554ENST00000354725+1524388_392593911MotifNuclear localization signal


Top

FusionGeneSequence for AHCYL2_SND1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_AHCYL2_ENST00000325006_chr7_128865280_+_SND1_ENST00000354725_chr7_127714554_+_439aa
MSVQVVSAAAAAKVPEVELKDLSPSEAESQLGLSTAAVGAMAPPAGGGDPEAPAPAAERPPVPGPGSGPAAALSPAAGKVPQASAMKRSD
PHHQHQRHRDGGEALVSPDGTVTEAPRTVKKVEVEVESMDKAGNFIGWLHIDGANLSVLLVEHALSKVHFTAERSSYYKSLLSAEEAAKQ
KKEKVWAHYEEQPVEEVMPVLEEKERSASYKPVFVTEITDDLHFYVQDVETGTQLEKLMENMRNDIASHPPVEGSYAPRRGEFCIAKFVD
GEWYRARVEKVESPAKIHVFYIDYGNREVLPSTRLGTLSPAFSTRVLPAQATEYAFAFIQVPQDDDARTDAVDSVVRDIQNTQCLLNVEH

>In-frame_AHCYL2_ENST00000446544_chr7_128865280_+_SND1_ENST00000354725_chr7_127714554_+_439aa
MSVQVVSAAAAAKVPEVELKDLSPSEAESQLGLSTAAVGAMAPPAGGGDPEAPAPAAERPPVPGPGSGPAAALSPAAGKVPQASAMKRSD
PHHQHQRHRDGGEALVSPDGTVTEAPRTVKKVEVEVESMDKAGNFIGWLHIDGANLSVLLVEHALSKVHFTAERSSYYKSLLSAEEAAKQ
KKEKVWAHYEEQPVEEVMPVLEEKERSASYKPVFVTEITDDLHFYVQDVETGTQLEKLMENMRNDIASHPPVEGSYAPRRGEFCIAKFVD
GEWYRARVEKVESPAKIHVFYIDYGNREVLPSTRLGTLSPAFSTRVLPAQATEYAFAFIQVPQDDDARTDAVDSVVRDIQNTQCLLNVEH


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_AHCYL2_ENST00000325006_chr7_128865280_+_SND1_ENST00000354725_chr7_127714554_+_1317nt
ATGTCGGTGCAGGTTGTGTCAGCCGCGGCTGCCGCCAAGGTGCCTGAGGTGGAGCTGAAGGACCTGAGCCCCTCCGAGGCGGAGTCGCAA
CTAGGACTGAGCACGGCCGCCGTGGGCGCCATGGCCCCCCCGGCGGGCGGTGGAGACCCTGAGGCTCCAGCTCCCGCCGCGGAGCGGCCC
CCGGTCCCCGGCCCGGGCTCGGGGCCCGCCGCCGCTCTCAGCCCCGCCGCCGGGAAGGTGCCTCAGGCGTCGGCCATGAAGCGGAGCGAC
CCACATCACCAGCACCAGCGGCACCGCGACGGCGGCGAGGCCCTGGTCAGCCCCGACGGCACCGTCACCGAGGCGCCGCGCACAGTCAAG
AAGGTGGAGGTGGAGGTGGAGAGCATGGACAAGGCCGGCAACTTTATCGGCTGGCTGCACATCGACGGTGCCAACCTGTCCGTCCTGCTG
GTGGAGCACGCGCTCTCCAAGGTCCACTTCACCGCCGAACGCAGCTCCTACTACAAGTCCCTGCTGTCTGCCGAGGAGGCCGCAAAGCAG
AAGAAAGAGAAGGTCTGGGCCCACTATGAGGAGCAGCCCGTGGAGGAGGTGATGCCAGTGCTGGAGGAGAAGGAGCGATCTGCTAGCTAC
AAGCCCGTGTTTGTGACTGAGATCACTGATGACCTGCACTTCTACGTGCAGGATGTGGAGACCGGCACCCAGTTGGAGAAGCTGATGGAG
AACATGCGCAATGACATTGCCAGTCACCCCCCTGTAGAGGGCTCCTATGCCCCCCGCAGGGGAGAGTTCTGCATTGCCAAATTTGTAGAT
GGAGAATGGTACCGTGCCCGAGTAGAGAAAGTCGAGTCTCCTGCCAAAATACATGTCTTCTACATTGACTACGGCAACAGAGAGGTCCTG
CCATCCACCCGCCTGGGTACCCTATCACCTGCCTTCAGCACTCGGGTGCTGCCAGCTCAAGCCACGGAGTATGCCTTCGCCTTCATCCAG
GTGCCCCAAGATGATGATGCCCGCACGGACGCCGTGGACAGCGTAGTTCGGGATATCCAGAACACTCAGTGCCTGCTCAACGTGGAACAC
CTGAGTGCCGGCTGCCCCCATGTCACCCTGCAGTTTGCAGATTCCAAGGGCGATGTGGGGCTGGGCTTGGTGAAGGAAGGGCTGGTCATG
GTGGAGGTGCGCAAGGAGAAACAGTTCCAGAAAGTGATCACAGAATACCTGAATGCCCAAGAGTCAGCCAAGAGCGCCAGGCTGAACCTG

>In-frame_AHCYL2_ENST00000446544_chr7_128865280_+_SND1_ENST00000354725_chr7_127714554_+_1317nt
ATGTCGGTGCAGGTTGTGTCAGCCGCGGCTGCCGCCAAGGTGCCTGAGGTGGAGCTGAAGGACCTGAGCCCCTCCGAGGCGGAGTCGCAA
CTAGGACTGAGCACGGCCGCCGTGGGCGCCATGGCCCCCCCGGCGGGCGGTGGAGACCCTGAGGCTCCAGCTCCCGCCGCGGAGCGGCCC
CCGGTCCCCGGCCCGGGCTCGGGGCCCGCCGCCGCTCTCAGCCCCGCCGCCGGGAAGGTGCCTCAGGCGTCGGCCATGAAGCGGAGCGAC
CCACATCACCAGCACCAGCGGCACCGCGACGGCGGCGAGGCCCTGGTCAGCCCCGACGGCACCGTCACCGAGGCGCCGCGCACAGTCAAG
AAGGTGGAGGTGGAGGTGGAGAGCATGGACAAGGCCGGCAACTTTATCGGCTGGCTGCACATCGACGGTGCCAACCTGTCCGTCCTGCTG
GTGGAGCACGCGCTCTCCAAGGTCCACTTCACCGCCGAACGCAGCTCCTACTACAAGTCCCTGCTGTCTGCCGAGGAGGCCGCAAAGCAG
AAGAAAGAGAAGGTCTGGGCCCACTATGAGGAGCAGCCCGTGGAGGAGGTGATGCCAGTGCTGGAGGAGAAGGAGCGATCTGCTAGCTAC
AAGCCCGTGTTTGTGACTGAGATCACTGATGACCTGCACTTCTACGTGCAGGATGTGGAGACCGGCACCCAGTTGGAGAAGCTGATGGAG
AACATGCGCAATGACATTGCCAGTCACCCCCCTGTAGAGGGCTCCTATGCCCCCCGCAGGGGAGAGTTCTGCATTGCCAAATTTGTAGAT
GGAGAATGGTACCGTGCCCGAGTAGAGAAAGTCGAGTCTCCTGCCAAAATACATGTCTTCTACATTGACTACGGCAACAGAGAGGTCCTG
CCATCCACCCGCCTGGGTACCCTATCACCTGCCTTCAGCACTCGGGTGCTGCCAGCTCAAGCCACGGAGTATGCCTTCGCCTTCATCCAG
GTGCCCCAAGATGATGATGCCCGCACGGACGCCGTGGACAGCGTAGTTCGGGATATCCAGAACACTCAGTGCCTGCTCAACGTGGAACAC
CTGAGTGCCGGCTGCCCCCATGTCACCCTGCAGTTTGCAGATTCCAAGGGCGATGTGGGGCTGGGCTTGGTGAAGGAAGGGCTGGTCATG
GTGGAGGTGCGCAAGGAGAAACAGTTCCAGAAAGTGATCACAGAATACCTGAATGCCCAAGAGTCAGCCAAGAGCGCCAGGCTGAACCTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_AHCYL2_ENST00000325006_chr7_128865280_+_SND1_ENST00000354725_chr7_127714554_+_1920nt
GCCGACCAAGAGCAGGAGCTGGAGTCTGAGCCGGTGGTTGCAGCGGAGGCGGTGATGTCGGTGCAGGTTGTGTCAGCCGCGGCTGCCGCC
AAGGTGCCTGAGGTGGAGCTGAAGGACCTGAGCCCCTCCGAGGCGGAGTCGCAACTAGGACTGAGCACGGCCGCCGTGGGCGCCATGGCC
CCCCCGGCGGGCGGTGGAGACCCTGAGGCTCCAGCTCCCGCCGCGGAGCGGCCCCCGGTCCCCGGCCCGGGCTCGGGGCCCGCCGCCGCT
CTCAGCCCCGCCGCCGGGAAGGTGCCTCAGGCGTCGGCCATGAAGCGGAGCGACCCACATCACCAGCACCAGCGGCACCGCGACGGCGGC
GAGGCCCTGGTCAGCCCCGACGGCACCGTCACCGAGGCGCCGCGCACAGTCAAGAAGGTGGAGGTGGAGGTGGAGAGCATGGACAAGGCC
GGCAACTTTATCGGCTGGCTGCACATCGACGGTGCCAACCTGTCCGTCCTGCTGGTGGAGCACGCGCTCTCCAAGGTCCACTTCACCGCC
GAACGCAGCTCCTACTACAAGTCCCTGCTGTCTGCCGAGGAGGCCGCAAAGCAGAAGAAAGAGAAGGTCTGGGCCCACTATGAGGAGCAG
CCCGTGGAGGAGGTGATGCCAGTGCTGGAGGAGAAGGAGCGATCTGCTAGCTACAAGCCCGTGTTTGTGACTGAGATCACTGATGACCTG
CACTTCTACGTGCAGGATGTGGAGACCGGCACCCAGTTGGAGAAGCTGATGGAGAACATGCGCAATGACATTGCCAGTCACCCCCCTGTA
GAGGGCTCCTATGCCCCCCGCAGGGGAGAGTTCTGCATTGCCAAATTTGTAGATGGAGAATGGTACCGTGCCCGAGTAGAGAAAGTCGAG
TCTCCTGCCAAAATACATGTCTTCTACATTGACTACGGCAACAGAGAGGTCCTGCCATCCACCCGCCTGGGTACCCTATCACCTGCCTTC
AGCACTCGGGTGCTGCCAGCTCAAGCCACGGAGTATGCCTTCGCCTTCATCCAGGTGCCCCAAGATGATGATGCCCGCACGGACGCCGTG
GACAGCGTAGTTCGGGATATCCAGAACACTCAGTGCCTGCTCAACGTGGAACACCTGAGTGCCGGCTGCCCCCATGTCACCCTGCAGTTT
GCAGATTCCAAGGGCGATGTGGGGCTGGGCTTGGTGAAGGAAGGGCTGGTCATGGTGGAGGTGCGCAAGGAGAAACAGTTCCAGAAAGTG
ATCACAGAATACCTGAATGCCCAAGAGTCAGCCAAGAGCGCCAGGCTGAACCTGTGGCGCTATGGAGACTTTCGAGCTGATGATGCAGAC
GAATTTGGCTACAGCCGCTAAGGAGGGGATCGGGTTTGGCCCCCAGCCCCGCTCACGCCAGTCCCTCTTCCTCTGCCGGGAGGGTGTTTT
CAACTCCAAACCCCAGAGAGGGGTTGTAGATTGGGTCCAGCTTTGCTTCAGTGTGTGGAAATGTCTCGTGGGGTGGCATCGGGGCTGCGG
GGTGGGGACCCCAAGGCTTTCTGGGGCAGACCCTTGTCCTCTGGGATGATGGGCACTGCTATCCACAGTCTCTGCCAGTTGGTTTTATTT
GGAGGTTTGTGGGCTTTTTTTAAAAAAAAAAAGTCCTCAAATCAGGAAGAAACATCAAAGACTATGTCCTAGTGGAGGGAGTAATCCTAA
CACCCAGGCTGGCCGCCAGCTGGCACCTGCCTCTATCCCAGACTGCCCTCGTCCCAGCTCTCTGTCCAACTGTTGATTATGTGATTTTTC
TGATACGTCCATTCTCAAATGCCAGTGTGTTCACATCTTCGCTCTGGCCAGCCCATTCTGTATTTAAAGCTTTTGAGGCCCAATAAAATA

>In-frame_AHCYL2_ENST00000446544_chr7_128865280_+_SND1_ENST00000354725_chr7_127714554_+_1893nt
GAGCCGGTGGTTGCAGCGGAGGCGGTGATGTCGGTGCAGGTTGTGTCAGCCGCGGCTGCCGCCAAGGTGCCTGAGGTGGAGCTGAAGGAC
CTGAGCCCCTCCGAGGCGGAGTCGCAACTAGGACTGAGCACGGCCGCCGTGGGCGCCATGGCCCCCCCGGCGGGCGGTGGAGACCCTGAG
GCTCCAGCTCCCGCCGCGGAGCGGCCCCCGGTCCCCGGCCCGGGCTCGGGGCCCGCCGCCGCTCTCAGCCCCGCCGCCGGGAAGGTGCCT
CAGGCGTCGGCCATGAAGCGGAGCGACCCACATCACCAGCACCAGCGGCACCGCGACGGCGGCGAGGCCCTGGTCAGCCCCGACGGCACC
GTCACCGAGGCGCCGCGCACAGTCAAGAAGGTGGAGGTGGAGGTGGAGAGCATGGACAAGGCCGGCAACTTTATCGGCTGGCTGCACATC
GACGGTGCCAACCTGTCCGTCCTGCTGGTGGAGCACGCGCTCTCCAAGGTCCACTTCACCGCCGAACGCAGCTCCTACTACAAGTCCCTG
CTGTCTGCCGAGGAGGCCGCAAAGCAGAAGAAAGAGAAGGTCTGGGCCCACTATGAGGAGCAGCCCGTGGAGGAGGTGATGCCAGTGCTG
GAGGAGAAGGAGCGATCTGCTAGCTACAAGCCCGTGTTTGTGACTGAGATCACTGATGACCTGCACTTCTACGTGCAGGATGTGGAGACC
GGCACCCAGTTGGAGAAGCTGATGGAGAACATGCGCAATGACATTGCCAGTCACCCCCCTGTAGAGGGCTCCTATGCCCCCCGCAGGGGA
GAGTTCTGCATTGCCAAATTTGTAGATGGAGAATGGTACCGTGCCCGAGTAGAGAAAGTCGAGTCTCCTGCCAAAATACATGTCTTCTAC
ATTGACTACGGCAACAGAGAGGTCCTGCCATCCACCCGCCTGGGTACCCTATCACCTGCCTTCAGCACTCGGGTGCTGCCAGCTCAAGCC
ACGGAGTATGCCTTCGCCTTCATCCAGGTGCCCCAAGATGATGATGCCCGCACGGACGCCGTGGACAGCGTAGTTCGGGATATCCAGAAC
ACTCAGTGCCTGCTCAACGTGGAACACCTGAGTGCCGGCTGCCCCCATGTCACCCTGCAGTTTGCAGATTCCAAGGGCGATGTGGGGCTG
GGCTTGGTGAAGGAAGGGCTGGTCATGGTGGAGGTGCGCAAGGAGAAACAGTTCCAGAAAGTGATCACAGAATACCTGAATGCCCAAGAG
TCAGCCAAGAGCGCCAGGCTGAACCTGTGGCGCTATGGAGACTTTCGAGCTGATGATGCAGACGAATTTGGCTACAGCCGCTAAGGAGGG
GATCGGGTTTGGCCCCCAGCCCCGCTCACGCCAGTCCCTCTTCCTCTGCCGGGAGGGTGTTTTCAACTCCAAACCCCAGAGAGGGGTTGT
AGATTGGGTCCAGCTTTGCTTCAGTGTGTGGAAATGTCTCGTGGGGTGGCATCGGGGCTGCGGGGTGGGGACCCCAAGGCTTTCTGGGGC
AGACCCTTGTCCTCTGGGATGATGGGCACTGCTATCCACAGTCTCTGCCAGTTGGTTTTATTTGGAGGTTTGTGGGCTTTTTTTAAAAAA
AAAAAGTCCTCAAATCAGGAAGAAACATCAAAGACTATGTCCTAGTGGAGGGAGTAATCCTAACACCCAGGCTGGCCGCCAGCTGGCACC
TGCCTCTATCCCAGACTGCCCTCGTCCCAGCTCTCTGTCCAACTGTTGATTATGTGATTTTTCTGATACGTCCATTCTCAAATGCCAGTG
TGTTCACATCTTCGCTCTGGCCAGCCCATTCTGTATTTAAAGCTTTTGAGGCCCAATAAAATAGTACGTGCTGTCTGCAGCCCTTATTGA


Top

FusionGenePPI for AHCYL2_SND1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
AHCYL2BAP1, JOSD2, WDR48, CLK4, CSNK1E, HOXC9, DHX8, UNKL, ZC3H3, DOK4, PITX2, MSL1, VSX2, GRN, RBM23, SYT6, ZNF444, FAM13C, ZBTB44, ANP32B, ANP32E, RPL17, PSMD4, RPS8, XPO1, AHCYL1, PIP4K2A, CAMKV, ZIC2, FOXK2, HEXIM2, ABCF2, ZNF263, RASL10B, NFKBIL1, PIP4K2C, FOXK1, DUSP11, TGIF2LY, CEP72, HOXB6, FAM19A3, BANP, PIP4K2B, KIF18B, FBXW11, FOXD4, HOXB9, PLCD3, ARRB2, NUAK2, ZNHIT6, EEF1D, CAB39, SNX20, PIP5K1A, ZNF414, C4orf26, CLK3, WDR33, PDCD2L, ARSI, JUN, SOST, PTPN21SND1IKBKE, SNW1, RBPJ, GTF2E2, GTF2E1, MYB, PIM1, STAT6, POLR2A, USP22, PDPK1, PRKAA1, UBA5, LZTR1, DHX9, CREBBP, RBM39, SIRT7, CUL3, CDK2, CAND1, APP, RPS3, HNRNPM, TOMM22, RPL19, MYBBP1A, SMNDC1, RPS20, NENF, RPL4, VDAC2, ILF2, SRSF3, HNRNPU, RPN1, HNRNPR, SSR3, FN1, VCAM1, CSNK2A1, ITGA4, G3BP1, PRPF8, RNU1-1, RNU2-1, RNU4-1, RNU6-1, RNU5A-1, MAK, TARDBP, EIF3CL, RPS11, RPS2, RPS6, RPS9, DDX3X, RPL23A, RPL35, RPS16, RPS26, RPS27, RPS3A, SHFM1, LIN28A, HUWE1, RAPGEF2, MDM2, CUL7, OBSL1, CCDC8, UBE2I, ESR1, MMP28, TDRD3, TXNDC5, NTRK1, NPM1, RPL10, CNOT1, MCM2, U2AF2, CDH1, PTP4A1, MTDH, PA2G4, TRAP1, ANXA5, SNRPB2, EIF5B, GPI, IDH2, PDIA3, UBE2N, MRPL12, CRNN, ZNF207, CPNE3, CS, PYGL, SF3A3, DNAJC8, PLS3, CPSF6, NANS, SF3A1, ECHS1, SRP68, MYL12B, AIMP1, CYLD, DLD, DLST, PDHA1, SOD1, TRIM25, BRCA1, YAP1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for AHCYL2_SND1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for AHCYL2_SND1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneAHCYL2C0033578Prostatic Neoplasms1CTD_human
TgeneSND1C0004352Autistic Disorder1CTD_human
TgeneSND1C0024121Lung Neoplasms1CTD_human