FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 11909

FusionGeneSummary for ERBB2_MED1

check button Fusion gene summary
Fusion gene informationFusion gene name: ERBB2_MED1
Fusion gene ID: 11909
HgeneTgene
Gene symbol

ERBB2

MED1

Gene ID

2064

8930

Gene nameerb-b2 receptor tyrosine kinase 2methyl-CpG binding domain 4, DNA glycosylase
SynonymsCD340|HER-2|HER-2/neu|HER2|MLN 19|NEU|NGL|TKR1MED1
Cytomap

17q12

3q21.3

Type of geneprotein-codingprotein-coding
Descriptionreceptor tyrosine-protein kinase erbB-2c-erb B2/neu proteinherstatinhuman epidermal growth factor receptor 2metastatic lymph node gene 19 proteinneuro/glioblastoma derived oncogene homologneuroblastoma/glioblastoma derived oncogene homologp185erbB2methyl-CpG-binding domain protein 43,N(4)-ethenocytosine glycosylaseG/5-fluorouracil mismatch glycosylase with biphasic kineticsG/T mismatch glycosylaseG/U mismatch glycosylasemethyl-CpG binding domain protein 4methyl-CpG-binding endonuclease 1meth
Modification date2018052720180523
UniProtAcc

P04626

Q15648

Ensembl transtripts involved in fusion geneENST00000584601, ENST00000406381, 
ENST00000541774, ENST00000445658, 
ENST00000540147, ENST00000584450, 
ENST00000269571, ENST00000578199, 
ENST00000540042, ENST00000584888, 
ENST00000394287, ENST00000300651, 
Fusion gene scores* DoF score27 X 20 X 14=75607 X 6 X 5=210
# samples 467
** MAII scorelog2(46/7560*10)=-4.03868046816406
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(7/210*10)=-1.58496250072116
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ERBB2 [Title/Abstract] AND MED1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneERBB2

GO:0007165

signal transduction

10572067

HgeneERBB2

GO:0007166

cell surface receptor signaling pathway

9685399

HgeneERBB2

GO:0007169

transmembrane receptor protein tyrosine kinase signaling pathway

7514177

HgeneERBB2

GO:0014065

phosphatidylinositol 3-kinase signaling

7556068

HgeneERBB2

GO:0032886

regulation of microtubule-based process

20937854

HgeneERBB2

GO:0042060

wound healing

12646923

HgeneERBB2

GO:0043406

positive regulation of MAP kinase activity

10572067

HgeneERBB2

GO:0045785

positive regulation of cell adhesion

7556068

HgeneERBB2

GO:0045945

positive regulation of transcription by RNA polymerase III

19372587

HgeneERBB2

GO:0046777

protein autophosphorylation

7556068

HgeneERBB2

GO:0050679

positive regulation of epithelial cell proliferation

10572067

HgeneERBB2

GO:0071363

cellular response to growth factor stimulus

20010870

HgeneERBB2

GO:0090314

positive regulation of protein targeting to membrane

20010870


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-D8-A1XJ-01AERBB2chr17

37873733

+MED1chr17

37571592

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000584601ENST00000394287ERBB2chr17

37873733

+MED1chr17

37571592

-
Frame-shitENST00000584601ENST00000300651ERBB2chr17

37873733

+MED1chr17

37571592

-
Frame-shitENST00000406381ENST00000394287ERBB2chr17

37873733

+MED1chr17

37571592

-
Frame-shitENST00000406381ENST00000300651ERBB2chr17

37873733

+MED1chr17

37571592

-
Frame-shitENST00000541774ENST00000394287ERBB2chr17

37873733

+MED1chr17

37571592

-
Frame-shitENST00000541774ENST00000300651ERBB2chr17

37873733

+MED1chr17

37571592

-
Frame-shitENST00000445658ENST00000394287ERBB2chr17

37873733

+MED1chr17

37571592

-
Frame-shitENST00000445658ENST00000300651ERBB2chr17

37873733

+MED1chr17

37571592

-
Frame-shitENST00000540147ENST00000394287ERBB2chr17

37873733

+MED1chr17

37571592

-
Frame-shitENST00000540147ENST00000300651ERBB2chr17

37873733

+MED1chr17

37571592

-
Frame-shitENST00000584450ENST00000394287ERBB2chr17

37873733

+MED1chr17

37571592

-
Frame-shitENST00000584450ENST00000300651ERBB2chr17

37873733

+MED1chr17

37571592

-
Frame-shitENST00000269571ENST00000394287ERBB2chr17

37873733

+MED1chr17

37571592

-
Frame-shitENST00000269571ENST00000300651ERBB2chr17

37873733

+MED1chr17

37571592

-
Frame-shitENST00000578199ENST00000394287ERBB2chr17

37873733

+MED1chr17

37571592

-
Frame-shitENST00000578199ENST00000300651ERBB2chr17

37873733

+MED1chr17

37571592

-
In-frameENST00000540042ENST00000394287ERBB2chr17

37873733

+MED1chr17

37571592

-
In-frameENST00000540042ENST00000300651ERBB2chr17

37873733

+MED1chr17

37571592

-
intron-3CDSENST00000584888ENST00000394287ERBB2chr17

37873733

+MED1chr17

37571592

-
intron-3CDSENST00000584888ENST00000300651ERBB2chr17

37873733

+MED1chr17

37571592

-

Top

FusionProtFeatures for ERBB2_MED1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ERBB2

P04626

MED1

Q15648

Protein tyrosine kinase that is part of several cellsurface receptor complexes, but that apparently needs a coreceptorfor ligand binding. Essential component of a neuregulin-receptorcomplex, although neuregulins do not interact with it alone. GP30is a potential ligand for this receptor. Regulates outgrowth andstabilization of peripheral microtubules (MTs). Upon ERBB2activation, the MEMO1-RHOA-DIAPH1 signaling pathway elicits thephosphorylation and thus the inhibition of GSK3B at cell membrane.This prevents the phosphorylation of APC and CLASP2, allowing itsassociation with the cell membrane. In turn, membrane-bound APCallows the localization of MACF1 to the cell membrane, which isrequired for microtubule capture and stabilization. {ECO:0000305}. In the nucleus is involved in transcriptionalregulation. Associates with the 5'-TCAAATTC-3' sequence in thePTGS2/COX-2 promoter and activates its transcription. Implicatedin transcriptional activation of CDKN1A; the function involvesSTAT3 and SRC. Involved in the transcription of rRNA genes by RNAPol I and enhances protein synthesis and cell growth.{ECO:0000269|PubMed:10358079, ECO:0000269|PubMed:15380516,ECO:0000269|PubMed:21555369}. Component of the Mediator complex, a coactivatorinvolved in the regulated transcription of nearly all RNApolymerase II-dependent genes. Mediator functions as a bridge toconvey information from gene-specific regulatory proteins to thebasal RNA polymerase II transcription machinery. Mediator isrecruited to promoters by direct interactions with regulatoryproteins and serves as a scaffold for the assembly of a functionalpreinitiation complex with RNA polymerase II and the generaltranscription factors (PubMed:10406464, PubMed:11867769,PubMed:12037571, PubMed:12218053, PubMed:12556447,PubMed:14636573, PubMed:15340084, PubMed:15471764,PubMed:15989967, PubMed:16574658, PubMed:9653119). Acts as acoactivator for GATA1-mediated transcriptional activation duringerythroid differentiation of K562 erythroleukemia cells(PubMed:24245781). {ECO:0000269|PubMed:10406464,ECO:0000269|PubMed:11867769, ECO:0000269|PubMed:12037571,ECO:0000269|PubMed:12218053, ECO:0000269|PubMed:12556447,ECO:0000269|PubMed:14636573, ECO:0000269|PubMed:15340084,ECO:0000269|PubMed:15471764, ECO:0000269|PubMed:15989967,ECO:0000269|PubMed:16574658, ECO:0000269|PubMed:24245781,ECO:0000269|PubMed:9653119}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for ERBB2_MED1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ERBB2_ENST00000540042_chr17_37873733_+_MED1_ENST00000394287_chr17_37571592_-_785aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQECVEECRVLQGLPRETVNARHCLPCHPECQPQ
NGSVTCFGPEADQCVACAHTKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGACQPCPINCTHS_VQRSFLQKGGLSFQGSFWGSYTKRGP
TLPLSTLVSDDKNNTLLKL_N_NMKTKLMPTSPGLLQFEVCPLSESRFSVSFQHPVNDSLVCVVMDVQDSTHVSCKLYKGLSDALICTDD

>In-frame_ERBB2_ENST00000540042_chr17_37873733_+_MED1_ENST00000300651_chr17_37571592_-_1810aa
MKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVRGTQLFEDNTALAVLDNG
DPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLIDTNRSRACHPCSPMCKGSRCWGESSE
DCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRTTFGASCVTACP
YNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCTGLGMEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTA
PLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQNLQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTV
PWDQLFRNPHQALLHTANRPEDECVGEGLACHQLCARGHCWGPGPTQCVNCSQFLRGQECVEECRVLQGLPRETVNARHCLPCHPECQPQ
NGSVTCFGPEADQCVACAHTKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGACQPCPINCTHS_VQRSFLQKGGLSFQGSFWGSYTKRGP
TLPLSTLVSDDKNNTLLKL_N_NMKTKLMPTSPGLLQFEVCPLSESRFSVSFQHPVNDSLVCVVMDVQDSTHVSCKLYKGLSDALICTDD
FIAKVVQRCMSIPVTMRAIRRKAETIQADTPALSLIAETVEDMVKKNLPPASSPGTGMTTGNNPMSGTTTPTNTFPGGPITTLFNMSMSI
KDRHESVGHGEDFSKVSQNPILTSLLQITGNGGSTIGSSPTPPHHTPPPVSSMAGNTKNHPMLMNLLKDNPAQDFSTLTGSSPLERQNSS
SGSPRMEICSGSNKTKKKKSSRLPPEKPKHQTEDDFQRELFSMDVDSQNPIFDVNMTADTLDTPHITPAPSQCSTPPTTYPQPVPHPQPS
IQRMVRLSSSDSIGPDVTDILSDIAEEASKLPSTSDDCPAIGTPLRDSSSSGHSQSTLFDSDVFQTNNNENPYTDPADLIADAAGSPSSD
SPTNHFFHDGVDFNPDLLNSQSQSGFGEETFDESSQSGDNDDFKGFASQALNTLGVPMLGGDNGETKFKGNNQADTVDFSIISVAGKALA
PADLMEHHSGSQGPLLTTGDLGKEKTQKRVKEGNGTSNSTLSGPGLDSKPGKRSRTPSNDGKSKDKPPKRKKADTEGKSPSHSSSNRPFT
PPTSTGGSKSPGSAGRSQTPPGVATPPIPKITIQIPKGTVMVGKPSSHSQTTSSGSVSSSGSKSHHSHSSSSSSSASTSGKMKSSKSEGS
SSSKLSSSMTSSQGSSGSSQSKNSSQSGGKPGSSPITKHGLSSGSSSTKMKPQGKPSSLMNPSLSKPNISPSHSRPPGGSDKLASPMKPV
PGTPPSSKAKSPISSGSGGSHMSGTSSSSGMKSSSGLGSSGSLSQKTPPSSNSCTASSSSFSSSGSSMSSSQNQHGSSKGKSPSRNKKPS
LTAVIDKLKHGVVTSGPGGEDPLDGQMGVSTNSSSHPMSSKHNMSGGEFQGKREKSDKDKSKVSTSGSSVDSSKKTSESKNVGSTGVAKI
IISKHDGGSPSIKAKVTLQKPGESSGEGLRPQMASSKNTGSPLISGSTPKHERGSPSHSKSPATTPQNLDSESESGSSIAEKSTQNSPSS
DDGIRPLPEYSTEKHKKHKKEKKKVKDKDRDRDRDKDRDKKKSHSIKPESWSKSPISSDQSLSMTSNTILSADRPSRLSPDFMIGEEDDD


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ERBB2_ENST00000540042_chr17_37873733_+_MED1_ENST00000394287_chr17_37571592_-_2355nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGTGGGCGAGGGCCTGGCC
TGCCACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGC
GTGGAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAG
AATGGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGC
CCCAGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGC
ACCCACTCGTGAGTCCAACGGTCTTTTCTGCAGAAAGGAGGACTTTCCTTTCAGGGGTCTTTCTGGGGCTCTTACTATAAAAGGGGACCA
ACTCTCCCTTTGTCATATCTTGTTTCTGATGACAAAAATAACACATTGTTAAAATTGTAAAATTAAAACATGAAATATAAATTAATGCCC
TATTCTCCTGGGCTTCTCCAATTTGAAGTGTGTCCTCTCTCAGAGTCTCGTTTCAGCGTATCTTTTCAGCACCCTGTGAATGACTCCCTG
GTGTGTGTGGTAATGGATGTGCAGGACTCAACACATGTGAGCTGTAAACTCTACAAAGGGCTGTCGGATGCACTGATCTGCACAGATGAC
TTCATTGCCAAAGTTGTTCAAAGATGTATGTCCATCCCTGTGACGATGAGGGCTATTCGGAGGAAAGCTGAAACCATTCAAGCCGACACC
CCAGCACTGTCCCTCATTGCAGAGACAGTTGAAGACATGGTGAAAAAGAACCTGCCCCCGGCTAGCAGCCCAGGATCAAAGAATCCCGAG

>In-frame_ERBB2_ENST00000540042_chr17_37873733_+_MED1_ENST00000300651_chr17_37571592_-_5430nt
ATGAAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTG
GAACTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAA
GTGAGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGA
GACCCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAA
GGAGGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCT
CTCACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAG
GATTGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGT
GCTGCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCC
CTGGTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCC
TACAACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGG
TGTGAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAAT
ATCCAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCC
CCGCTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCT
GACCTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATC
AGCTGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTG
CCCTGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGTGGGCGAGGGCCTGGCC
TGCCACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGC
GTGGAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAG
AATGGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGC
CCCAGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGC
ACCCACTCGTGAGTCCAACGGTCTTTTCTGCAGAAAGGAGGACTTTCCTTTCAGGGGTCTTTCTGGGGCTCTTACTATAAAAGGGGACCA
ACTCTCCCTTTGTCATATCTTGTTTCTGATGACAAAAATAACACATTGTTAAAATTGTAAAATTAAAACATGAAATATAAATTAATGCCC
TATTCTCCTGGGCTTCTCCAATTTGAAGTGTGTCCTCTCTCAGAGTCTCGTTTCAGCGTATCTTTTCAGCACCCTGTGAATGACTCCCTG
GTGTGTGTGGTAATGGATGTGCAGGACTCAACACATGTGAGCTGTAAACTCTACAAAGGGCTGTCGGATGCACTGATCTGCACAGATGAC
TTCATTGCCAAAGTTGTTCAAAGATGTATGTCCATCCCTGTGACGATGAGGGCTATTCGGAGGAAAGCTGAAACCATTCAAGCCGACACC
CCAGCACTGTCCCTCATTGCAGAGACAGTTGAAGACATGGTGAAAAAGAACCTGCCCCCGGCTAGCAGCCCAGGGTATGGCATGACCACA
GGCAACAACCCAATGAGTGGTACCACTACACCAACCAACACCTTTCCGGGGGGTCCCATTACCACCTTGTTTAATATGAGCATGAGCATC
AAAGATCGGCATGAGTCGGTGGGCCATGGGGAGGACTTCAGCAAGGTGTCTCAGAACCCAATTCTTACCAGTTTGTTGCAAATCACAGGG
AACGGGGGGTCTACCATTGGCTCGAGTCCGACCCCTCCTCATCACACGCCGCCACCTGTCTCTTCGATGGCCGGCAACACCAAGAACCAC
CCGATGCTCATGAACCTTCTTAAAGATAATCCTGCCCAGGATTTCTCAACCCTTTATGGAAGCAGCCCTTTAGAAAGGCAGAACTCCTCT
TCCGGCTCACCCCGCATGGAAATATGCTCGGGGAGCAACAAGACCAAGAAAAAGAAGTCATCAAGATTACCACCTGAGAAACCAAAGCAC
CAGACTGAAGATGACTTTCAGAGGGAGCTATTTTCAATGGATGTTGACTCACAGAACCCTATCTTTGATGTCAACATGACAGCTGACACG
CTGGATACGCCACACATCACTCCAGCTCCAAGCCAGTGTAGCACTCCCCCAACAACTTACCCACAACCAGTACCTCACCCCCAACCCAGT
ATTCAAAGGATGGTCCGACTATCCAGTTCAGACAGCATTGGCCCAGATGTAACTGACATCCTTTCAGACATTGCAGAAGAAGCTTCTAAA
CTTCCCAGCACTAGTGATGATTGCCCAGCCATTGGCACCCCTCTTCGAGATTCTTCAAGCTCTGGGCATTCTCAGAGTACCCTGTTTGAC
TCTGATGTCTTTCAAACTAACAATAATGAAAATCCATACACTGATCCAGCTGATCTTATTGCAGATGCTGCTGGAAGCCCCAGTAGTGAC
TCTCCTACCAATCATTTTTTTCATGATGGAGTAGATTTCAATCCTGATTTATTGAACAGCCAGAGCCAAAGTGGTTTTGGAGAAGAATAT
TTTGATGAAAGCAGCCAAAGTGGGGATAATGATGATTTCAAAGGATTTGCATCTCAGGCACTAAATACTTTGGGGGTGCCAATGCTTGGA
GGTGATAATGGGGAGACCAAGTTTAAGGGCAATAACCAAGCCGACACAGTTGATTTCAGTATTATTTCAGTAGCCGGCAAAGCTTTAGCT
CCTGCAGATCTTATGGAGCATCACAGTGGTAGTCAGGGTCCTTTACTGACCACTGGGGACTTAGGGAAAGAAAAGACTCAAAAGAGGGTA
AAGGAAGGCAATGGCACCAGTAATAGTACTCTCTCGGGGCCCGGATTAGACAGCAAACCAGGGAAGCGCAGTCGGACCCCTTCTAATGAT
GGGAAAAGCAAAGATAAGCCTCCAAAGCGGAAGAAGGCAGACACTGAGGGAAAGTCTCCATCTCATAGTTCTTCTAACAGACCTTTTACC
CCACCTACCAGTACAGGTGGATCTAAATCGCCAGGCAGTGCAGGAAGATCTCAGACTCCCCCAGGTGTTGCCACACCACCCATTCCCAAA
ATCACTATTCAGATTCCTAAGGGAACAGTGATGGTGGGCAAGCCTTCCTCTCACAGTCAGTATACCAGCAGTGGTTCTGTGTCTTCCTCA
GGCAGCAAAAGCCACCATAGCCATTCTTCCTCCTCTTCCTCATCTGCTTCCACCTCAGGGAAGATGAAAAGCAGTAAATCAGAAGGTTCA
TCAAGTTCCAAGTTAAGTAGCAGTATGTATTCTAGCCAGGGGTCTTCTGGATCTAGCCAGTCCAAAAATTCATCCCAGTCTGGGGGGAAG
CCAGGCTCCTCTCCCATAACCAAGCATGGACTGAGCAGTGGCTCTAGCAGCACCAAGATGAAACCTCAAGGAAAGCCATCATCACTTATG
AATCCTTCTTTAAGTAAACCAAACATATCCCCTTCTCATTCAAGGCCACCTGGAGGCTCTGACAAGCTTGCCTCTCCAATGAAGCCTGTT
CCTGGAACTCCTCCATCCTCTAAAGCCAAGTCCCCTATCAGTTCAGGTTCTGGTGGTTCTCATATGTCTGGAACTAGTTCAAGCTCTGGC
ATGAAGTCATCTTCAGGGTTAGGATCCTCAGGCTCGTTGTCCCAGAAAACTCCCCCATCATCTAATTCCTGTACGGCATCTTCCTCCTCC
TTTTCCTCAAGTGGCTCTTCCATGTCATCCTCTCAGAACCAGCATGGGAGTTCTAAAGGAAAATCTCCCAGCAGAAACAAGAAGCCGTCC
TTGACAGCTGTCATAGATAAACTGAAGCATGGGGTTGTCACCAGTGGCCCTGGGGGTGAAGACCCACTGGACGGCCAGATGGGGGTGAGC
ACAAATTCTTCCAGCCATCCTATGTCCTCCAAACATAACATGTCAGGAGGAGAGTTTCAGGGCAAGCGTGAGAAAAGTGATAAAGACAAA
TCAAAGGTTTCCACCTCCGGGAGTTCAGTGGATTCTTCTAAGAAGACCTCAGAGTCAAAAAATGTGGGGAGCACAGGTGTGGCAAAAATT
ATCATCAGTAAGCATGATGGAGGCTCCCCTAGCATTAAAGCCAAAGTGACTTTGCAGAAACCTGGGGAAAGTAGTGGAGAAGGGCTTAGG
CCTCAAATGGCTTCTTCTAAAAACTATGGCTCTCCACTCATCAGTGGTTCCACTCCAAAGCATGAGCGTGGCTCTCCCAGCCATAGTAAG
TCACCAGCATATACCCCCCAGAATCTGGACAGTGAAAGTGAGTCAGGCTCCTCCATAGCAGAGAAATCTTATCAGAATAGTCCCAGCTCA
GACGATGGTATCCGACCACTTCCAGAATACAGCACAGAGAAACATAAGAAGCACAAAAAGGAAAAGAAGAAAGTAAAAGACAAAGATAGG
GACCGAGACCGGGACAAAGACCGAGACAAGAAAAAATCTCATAGCATCAAGCCAGAGAGTTGGTCCAAATCACCCATCTCTTCAGACCAG
TCCTTGTCTATGACAAGTAACACAATCTTATCTGCAGACAGACCCTCAAGGCTCAGCCCAGACTTTATGATTGGGGAGGAAGATGATGAT


* Fusion transcript sequences (Full-length transcript).
>In-frame_ERBB2_ENST00000540042_chr17_37873733_+_MED1_ENST00000394287_chr17_37571592_-_3885nt
GCCCTCTTGGCCTTTTCCCGGTCCCCGCCGCGCGCCTGCTGCTGTCCCCGTGCCCGAGGACTGGGAGGATGGGGCTGAGCCGCTTGCCTG
ACTTTTGATCCGACCAGTAATCACTTTGCCCGTGTGGCGCGTGGCCCGTTGCCTGAGGCTTCCTGGCGCGTGGGGCTGTTTGGTCCCCTC
CGGAGTGCGGTGAGGCGGGCCGAGCCGGGACTGCCTGGGTTTGGGGATAACGTTCCCATCTCCACCCCTGTTGCAGCAAGGGAAATTGAG
GCTGAGGGAACTGGGCCCAGGGACGGCGAGCCGTGGCTGCCTCTCCAGTCCGGGCCCCGAAGGGCTGCTCGTGGATGAACCAGACTGATT
TTAAGGGGTGAAGAGGGTGCGTTTCAATCAGATGCTTCTGGAACGTCGAAATTGTCTTCTTTGGAAAGAACCATCCCCTCTTTGGGCTTC
AGAGGCCCAAATTGAGGCGCAATGATGAGAGGATGTGGTGGTCTACTCTGATGTCAATCTTGAGGGCTAGTGTGCACCGGCACAGACATG
AAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAA
CTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTG
AGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGAC
CCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGA
GGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTC
ACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGAT
TGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCT
GCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTG
GTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTAC
AACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGT
GAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATC
CAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCG
CTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGAC
CTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGC
TGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCC
TGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGTGGGCGAGGGCCTGGCCTGC
CACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTG
GAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAGAAT
GGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCC
AGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGCACC
CACTCGTGAGTCCAACGGTCTTTTCTGCAGAAAGGAGGACTTTCCTTTCAGGGGTCTTTCTGGGGCTCTTACTATAAAAGGGGACCAACT
CTCCCTTTGTCATATCTTGTTTCTGATGACAAAAATAACACATTGTTAAAATTGTAAAATTAAAACATGAAATATAAATTAATGCCCTAT
TCTCCTGGGCTTCTCCAATTTGAAGTGTGTCCTCTCTCAGAGTCTCGTTTCAGCGTATCTTTTCAGCACCCTGTGAATGACTCCCTGGTG
TGTGTGGTAATGGATGTGCAGGACTCAACACATGTGAGCTGTAAACTCTACAAAGGGCTGTCGGATGCACTGATCTGCACAGATGACTTC
ATTGCCAAAGTTGTTCAAAGATGTATGTCCATCCCTGTGACGATGAGGGCTATTCGGAGGAAAGCTGAAACCATTCAAGCCGACACCCCA
GCACTGTCCCTCATTGCAGAGACAGTTGAAGACATGGTGAAAAAGAACCTGCCCCCGGCTAGCAGCCCAGGATCAAAGAATCCCGAGTTA
GGATCTGGATGAAGGATAAGCCCCTGAATTGTCGATGGGCTCACCCCCACACTGACCCAGCATCTGAACTTGCTTAACAGGGAGCCGGGG
CTAAACTGCTTCACCCTGCCTGAGAACCAGGGAGCACTGCATTTCTCCACAGGGTGGAGGAGAAGAGGCAGAATAAACCAAGCCTGGGAC
ACCTCCCTCCTGTCTAGGTGTACTCATTCTTCTGTTTCAAAAGAAGGCAAGGACATGAAGTCAACTTCTACCTATCTTCTGCTGCTGGTG
TCTTATGTATTCTCAGTTTGACCTGATTCCTCTTCTGTCTTTTGACTTAACATTAGGGGTTCTTGGTCATAACCTGCTCTGATGTACATA
AAGATTTCAGGTTCAATATCAATGTGTCTTAAAACAGAAGTATTTTAGCGGGTGGGGGGTGGGGTGGTGGGGACAAACAACGCAGGATAT
AATTGCCAAAACCAGGCTTGAGGTTGGTGACTCTTGAAAGATTTTCTTTCTTCAGGCCTAGATCAGAAAATTAAGTGCAGCAATATCATG
AATTCTCAGAAGCCCTTTCAGGGAGCCAGTGAGTCATACAGTATCCACAGTTGAGTCACTTAAAGATGTCAGTATACGAAACATTATTCA
CAATCCTTGGGCAATCTCATTTTTTTTTCCTTCTCCCCTCCTCCCCTGCCCCCCATACATTTCTATCCTTGAGTTAGTTTTGGAGGGGCA
GGAAGTACTTAACATCTCAGAAGCTAGATTGGGAAACATGCTCAGCTATAAGAACTGAGCTTTAAATTTTGAGTTTAAAAATGTACATCA
GGAGCAGCTGGGGAGGGTCTTTTTTTAAAAAAATCTTTCAAATTTGGTTTTCTGTGCATATGGCCGTTTTGTAAATACTTTGGGGTTTTT
CATTTTTTTGAAAGTAGATGAAATCTGTTGTGGGATTTTTTTCCCGAAACATTACAAAATAACCTGTTTATTTACATGCAAATAAACTTC

>In-frame_ERBB2_ENST00000540042_chr17_37873733_+_MED1_ENST00000300651_chr17_37571592_-_6841nt
GCCCTCTTGGCCTTTTCCCGGTCCCCGCCGCGCGCCTGCTGCTGTCCCCGTGCCCGAGGACTGGGAGGATGGGGCTGAGCCGCTTGCCTG
ACTTTTGATCCGACCAGTAATCACTTTGCCCGTGTGGCGCGTGGCCCGTTGCCTGAGGCTTCCTGGCGCGTGGGGCTGTTTGGTCCCCTC
CGGAGTGCGGTGAGGCGGGCCGAGCCGGGACTGCCTGGGTTTGGGGATAACGTTCCCATCTCCACCCCTGTTGCAGCAAGGGAAATTGAG
GCTGAGGGAACTGGGCCCAGGGACGGCGAGCCGTGGCTGCCTCTCCAGTCCGGGCCCCGAAGGGCTGCTCGTGGATGAACCAGACTGATT
TTAAGGGGTGAAGAGGGTGCGTTTCAATCAGATGCTTCTGGAACGTCGAAATTGTCTTCTTTGGAAAGAACCATCCCCTCTTTGGGCTTC
AGAGGCCCAAATTGAGGCGCAATGATGAGAGGATGTGGTGGTCTACTCTGATGTCAATCTTGAGGGCTAGTGTGCACCGGCACAGACATG
AAGCTGCGGCTCCCTGCCAGTCCCGAGACCCACCTGGACATGCTCCGCCACCTCTACCAGGGCTGCCAGGTGGTGCAGGGAAACCTGGAA
CTCACCTACCTGCCCACCAATGCCAGCCTGTCCTTCCTGCAGGATATCCAGGAGGTGCAGGGCTACGTGCTCATCGCTCACAACCAAGTG
AGGCAGGTCCCACTGCAGAGGCTGCGGATTGTGCGAGGCACCCAGCTCTTTGAGGACAACTATGCCCTGGCCGTGCTAGACAATGGAGAC
CCGCTGAACAATACCACCCCTGTCACAGGGGCCTCCCCAGGAGGCCTGCGGGAGCTGCAGCTTCGAAGCCTCACAGAGATCTTGAAAGGA
GGGGTCTTGATCCAGCGGAACCCCCAGCTCTGCTACCAGGACACGATTTTGTGGAAGGACATCTTCCACAAGAACAACCAGCTGGCTCTC
ACACTGATAGACACCAACCGCTCTCGGGCCTGCCACCCCTGTTCTCCGATGTGTAAGGGCTCCCGCTGCTGGGGAGAGAGTTCTGAGGAT
TGTCAGAGCCTGACGCGCACTGTCTGTGCCGGTGGCTGTGCCCGCTGCAAGGGGCCACTGCCCACTGACTGCTGCCATGAGCAGTGTGCT
GCCGGCTGCACGGGCCCCAAGCACTCTGACTGCCTGGCCTGCCTCCACTTCAACCACAGTGGCATCTGTGAGCTGCACTGCCCAGCCCTG
GTCACCTACAACACAGACACGTTTGAGTCCATGCCCAATCCCGAGGGCCGGTATACATTCGGCGCCAGCTGTGTGACTGCCTGTCCCTAC
AACTACCTTTCTACGGACGTGGGATCCTGCACCCTCGTCTGCCCCCTGCACAACCAAGAGGTGACAGCAGAGGATGGAACACAGCGGTGT
GAGAAGTGCAGCAAGCCCTGTGCCCGAGTGTGCTATGGTCTGGGCATGGAGCACTTGCGAGAGGTGAGGGCAGTTACCAGTGCCAATATC
CAGGAGTTTGCTGGCTGCAAGAAGATCTTTGGGAGCCTGGCATTTCTGCCGGAGAGCTTTGATGGGGACCCAGCCTCCAACACTGCCCCG
CTCCAGCCAGAGCAGCTCCAAGTGTTTGAGACTCTGGAAGAGATCACAGGTTACCTATACATCTCAGCATGGCCGGACAGCCTGCCTGAC
CTCAGCGTCTTCCAGAACCTGCAAGTAATCCGGGGACGAATTCTGCACAATGGCGCCTACTCGCTGACCCTGCAAGGGCTGGGCATCAGC
TGGCTGGGGCTGCGCTCACTGAGGGAACTGGGCAGTGGACTGGCCCTCATCCACCATAACACCCACCTCTGCTTCGTGCACACGGTGCCC
TGGGACCAGCTCTTTCGGAACCCGCACCAAGCTCTGCTCCACACTGCCAACCGGCCAGAGGACGAGTGTGTGGGCGAGGGCCTGGCCTGC
CACCAGCTGTGCGCCCGAGGGCACTGCTGGGGTCCAGGGCCCACCCAGTGTGTCAACTGCAGCCAGTTCCTTCGGGGCCAGGAGTGCGTG
GAGGAATGCCGAGTACTGCAGGGGCTCCCCAGGGAGTATGTGAATGCCAGGCACTGTTTGCCGTGCCACCCTGAGTGTCAGCCCCAGAAT
GGCTCAGTGACCTGTTTTGGACCGGAGGCTGACCAGTGTGTGGCCTGTGCCCACTATAAGGACCCTCCCTTCTGCGTGGCCCGCTGCCCC
AGCGGTGTGAAACCTGACCTCTCCTACATGCCCATCTGGAAGTTTCCAGATGAGGAGGGCGCATGCCAGCCTTGCCCCATCAACTGCACC
CACTCGTGAGTCCAACGGTCTTTTCTGCAGAAAGGAGGACTTTCCTTTCAGGGGTCTTTCTGGGGCTCTTACTATAAAAGGGGACCAACT
CTCCCTTTGTCATATCTTGTTTCTGATGACAAAAATAACACATTGTTAAAATTGTAAAATTAAAACATGAAATATAAATTAATGCCCTAT
TCTCCTGGGCTTCTCCAATTTGAAGTGTGTCCTCTCTCAGAGTCTCGTTTCAGCGTATCTTTTCAGCACCCTGTGAATGACTCCCTGGTG
TGTGTGGTAATGGATGTGCAGGACTCAACACATGTGAGCTGTAAACTCTACAAAGGGCTGTCGGATGCACTGATCTGCACAGATGACTTC
ATTGCCAAAGTTGTTCAAAGATGTATGTCCATCCCTGTGACGATGAGGGCTATTCGGAGGAAAGCTGAAACCATTCAAGCCGACACCCCA
GCACTGTCCCTCATTGCAGAGACAGTTGAAGACATGGTGAAAAAGAACCTGCCCCCGGCTAGCAGCCCAGGGTATGGCATGACCACAGGC
AACAACCCAATGAGTGGTACCACTACACCAACCAACACCTTTCCGGGGGGTCCCATTACCACCTTGTTTAATATGAGCATGAGCATCAAA
GATCGGCATGAGTCGGTGGGCCATGGGGAGGACTTCAGCAAGGTGTCTCAGAACCCAATTCTTACCAGTTTGTTGCAAATCACAGGGAAC
GGGGGGTCTACCATTGGCTCGAGTCCGACCCCTCCTCATCACACGCCGCCACCTGTCTCTTCGATGGCCGGCAACACCAAGAACCACCCG
ATGCTCATGAACCTTCTTAAAGATAATCCTGCCCAGGATTTCTCAACCCTTTATGGAAGCAGCCCTTTAGAAAGGCAGAACTCCTCTTCC
GGCTCACCCCGCATGGAAATATGCTCGGGGAGCAACAAGACCAAGAAAAAGAAGTCATCAAGATTACCACCTGAGAAACCAAAGCACCAG
ACTGAAGATGACTTTCAGAGGGAGCTATTTTCAATGGATGTTGACTCACAGAACCCTATCTTTGATGTCAACATGACAGCTGACACGCTG
GATACGCCACACATCACTCCAGCTCCAAGCCAGTGTAGCACTCCCCCAACAACTTACCCACAACCAGTACCTCACCCCCAACCCAGTATT
CAAAGGATGGTCCGACTATCCAGTTCAGACAGCATTGGCCCAGATGTAACTGACATCCTTTCAGACATTGCAGAAGAAGCTTCTAAACTT
CCCAGCACTAGTGATGATTGCCCAGCCATTGGCACCCCTCTTCGAGATTCTTCAAGCTCTGGGCATTCTCAGAGTACCCTGTTTGACTCT
GATGTCTTTCAAACTAACAATAATGAAAATCCATACACTGATCCAGCTGATCTTATTGCAGATGCTGCTGGAAGCCCCAGTAGTGACTCT
CCTACCAATCATTTTTTTCATGATGGAGTAGATTTCAATCCTGATTTATTGAACAGCCAGAGCCAAAGTGGTTTTGGAGAAGAATATTTT
GATGAAAGCAGCCAAAGTGGGGATAATGATGATTTCAAAGGATTTGCATCTCAGGCACTAAATACTTTGGGGGTGCCAATGCTTGGAGGT
GATAATGGGGAGACCAAGTTTAAGGGCAATAACCAAGCCGACACAGTTGATTTCAGTATTATTTCAGTAGCCGGCAAAGCTTTAGCTCCT
GCAGATCTTATGGAGCATCACAGTGGTAGTCAGGGTCCTTTACTGACCACTGGGGACTTAGGGAAAGAAAAGACTCAAAAGAGGGTAAAG
GAAGGCAATGGCACCAGTAATAGTACTCTCTCGGGGCCCGGATTAGACAGCAAACCAGGGAAGCGCAGTCGGACCCCTTCTAATGATGGG
AAAAGCAAAGATAAGCCTCCAAAGCGGAAGAAGGCAGACACTGAGGGAAAGTCTCCATCTCATAGTTCTTCTAACAGACCTTTTACCCCA
CCTACCAGTACAGGTGGATCTAAATCGCCAGGCAGTGCAGGAAGATCTCAGACTCCCCCAGGTGTTGCCACACCACCCATTCCCAAAATC
ACTATTCAGATTCCTAAGGGAACAGTGATGGTGGGCAAGCCTTCCTCTCACAGTCAGTATACCAGCAGTGGTTCTGTGTCTTCCTCAGGC
AGCAAAAGCCACCATAGCCATTCTTCCTCCTCTTCCTCATCTGCTTCCACCTCAGGGAAGATGAAAAGCAGTAAATCAGAAGGTTCATCA
AGTTCCAAGTTAAGTAGCAGTATGTATTCTAGCCAGGGGTCTTCTGGATCTAGCCAGTCCAAAAATTCATCCCAGTCTGGGGGGAAGCCA
GGCTCCTCTCCCATAACCAAGCATGGACTGAGCAGTGGCTCTAGCAGCACCAAGATGAAACCTCAAGGAAAGCCATCATCACTTATGAAT
CCTTCTTTAAGTAAACCAAACATATCCCCTTCTCATTCAAGGCCACCTGGAGGCTCTGACAAGCTTGCCTCTCCAATGAAGCCTGTTCCT
GGAACTCCTCCATCCTCTAAAGCCAAGTCCCCTATCAGTTCAGGTTCTGGTGGTTCTCATATGTCTGGAACTAGTTCAAGCTCTGGCATG
AAGTCATCTTCAGGGTTAGGATCCTCAGGCTCGTTGTCCCAGAAAACTCCCCCATCATCTAATTCCTGTACGGCATCTTCCTCCTCCTTT
TCCTCAAGTGGCTCTTCCATGTCATCCTCTCAGAACCAGCATGGGAGTTCTAAAGGAAAATCTCCCAGCAGAAACAAGAAGCCGTCCTTG
ACAGCTGTCATAGATAAACTGAAGCATGGGGTTGTCACCAGTGGCCCTGGGGGTGAAGACCCACTGGACGGCCAGATGGGGGTGAGCACA
AATTCTTCCAGCCATCCTATGTCCTCCAAACATAACATGTCAGGAGGAGAGTTTCAGGGCAAGCGTGAGAAAAGTGATAAAGACAAATCA
AAGGTTTCCACCTCCGGGAGTTCAGTGGATTCTTCTAAGAAGACCTCAGAGTCAAAAAATGTGGGGAGCACAGGTGTGGCAAAAATTATC
ATCAGTAAGCATGATGGAGGCTCCCCTAGCATTAAAGCCAAAGTGACTTTGCAGAAACCTGGGGAAAGTAGTGGAGAAGGGCTTAGGCCT
CAAATGGCTTCTTCTAAAAACTATGGCTCTCCACTCATCAGTGGTTCCACTCCAAAGCATGAGCGTGGCTCTCCCAGCCATAGTAAGTCA
CCAGCATATACCCCCCAGAATCTGGACAGTGAAAGTGAGTCAGGCTCCTCCATAGCAGAGAAATCTTATCAGAATAGTCCCAGCTCAGAC
GATGGTATCCGACCACTTCCAGAATACAGCACAGAGAAACATAAGAAGCACAAAAAGGAAAAGAAGAAAGTAAAAGACAAAGATAGGGAC
CGAGACCGGGACAAAGACCGAGACAAGAAAAAATCTCATAGCATCAAGCCAGAGAGTTGGTCCAAATCACCCATCTCTTCAGACCAGTCC
TTGTCTATGACAAGTAACACAATCTTATCTGCAGACAGACCCTCAAGGCTCAGCCCAGACTTTATGATTGGGGAGGAAGATGATGATCTT
ATGGATGTGGCCCTGATTGGGAATTAGGAACCTTATTTCCTAAAAGAAACAGGGCCAGAGGAAAAAAAACTATTGATAAGTTTATAGGCA
AACCACCATAAGGGGTGAGTCAGACAGGTCTGATTTGGTTAAGAATCCTAAATGGCATGGCTTTGACATCAAGCTGGGTGAATTAGAAAG
GCATATCCAGACCCTATTAAAGAAACCACAGGGTTTGATTCTGGTTACCAGGAAGTCTTCTTTGTTCCTGTGCCAGAAAGAAAGTTAAAA
TACTTGCTTAAGAAAGGGAGGGGGGTGGGAGGGGTGTAGGGAGAGGGAAGGGAGGGAAACAGTTTTGTGGGAAATATTCATATATATTTT
CTTCTCCCTTTTTCCATTTTTAGGCCATGTTTTAAACTCATTTTAGTGCATGTATATGAAGGGCTGGGCAGAAAATGAAAAAGCAATACA
TTCCTTGATGCATTTGCATGAAGGTTGTTCAACTTTGTTTGAGGTAGTTGTCCGTTTGAGTCATGGGCAAATGAAGGACTTTGGTCATTT
TGGACACTTAAGTAATGTTTGGTGTCTGTTTCTTAGGAGTGACTGGGGGAGGGAAGATTATTTTAGCTATTTATTTGTAATATTTTAACC
CTTTATCTGTTTGTTTTTATACAGTGTTTCGTTCTAAATCTATGAGGTTTAGGGTTCAAAATGATGGAAGGCCGAAGAGCAAGGCTTATA
TGGTGGTAGGGAGCTTATAGCTTGTGCTAATACTGTAGCATCAAGCCCAAGCAAATTAGTCAGAGCCCGCCTTTAGAGTTAAATATAATA
GAAAAACCAAAATGATATTTTTATTTTAGGAGGGTTTAAATAGGGTTCAGAGATCATAGGAATATTAGGAGTTACCTCTCTGTGGAGGTA


Top

FusionGenePPI for ERBB2_MED1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ERBB2SHC1, SH3BGRL, PTPN11, GRB2, MUC1, CTNNB1, ERBB2, CD82, EGF, PAK1, ERBB2IP, PICK1, PIK3R2, DLG4, ERBB4, NRG1, JUP, STAT3, SRC, JAK2, HSP90B1, CD44, GRB7, PLCG1, IL6ST, OSMR, PTK2B, HSP90AA1, ELF3, EGFR, ERBB3, HDAC6, LRIG1, STUB1, HSPA4, IGF1R, CUL5, ESR1, PPP1R13B, H2AFY, PIK3R1, PIN1, PTK6, ACTB, POLR1B, KPNB1, XPO1, CLTC, AP2B1, EEA1, APBB1, SH2B2, IRS4, SH2D1B, SOCS1, NCK2, DAB1, GRAP2, APBB3, ABL1, FGR, CHN1, FER, PLCG2, RASA1, JAK1, IRS1, STAT1, MATK, TEC, TXK, ABL2, SYK, CRK, CRKL, BLK, BMX, VAV2, SH3BP2, SHC2, ITK, SLA, MAPK8IP2, RIN1, BCAR3, TENC1, TNS3, DOK6, SH2D5, SUPT6H, ANKS1B, CLNK, DOK4, BLNK, RIN2, SHC3, PIK3R3, ANKS1A, VAV1, DOK1, SH2D3A, SLA2, SH2D2A, CISH, VAV3, MAPK8IP1, SH2B3, TLN1, SRPK1, CBL, ERRFI1, FRS3, USP2, NXF1, DTWD2, TGFBR2, NAALADL2, LPAR6, VSIG4, PTGER3, CYP17A1, GLCE, IL13RA2, KLK5, LYPD3, NAT2, PRDM14, PSMC3IP, RHOBTB2, THRSP, ANXA6, BAI1, CLCN6, GMPR2, HDLBP, IARS, MTCH1, MUCL1, PHF23, POLD2, PSAP, STK24, TCEAL2, ATP6AP1, TTC9B, UTP18, ATP1A1, EEF1G, TNPO1, PC, SURF4, TFRC, VAPB, PTDSS1, HPSE, ZNF280C, CCDC88A, ZNF622, BTC, PTK2, TGFA, BCAR1, ESRRB, CDC37, EZR, RDX, ITGAV, L1CAM, ITGB1, CHEK2, TOP1, RRM2, CDK4, CDH2, CDH1, PTPN6, PTPRR, PTPRT, PTPRU, PTPRA, PTPRH, MPZL2, SSH1, CD79B, MAS1, HAVCR2, IL4R, PPM1A, PPM1F, ILKAP, DUSP14, DUSP18, DUSP19, STYX, GAB1MED1MED10, MED9, MED29, MED19, MED28, MED26, PPARGC1A, NR3C1, YWHAQ, TGS1, TP53, CDK8, VDR, MED1, HNF4A, THRA, THRAP3, MED24, AR, ESR1, ESR2, MED13, MED6, MED16, MED17, MED20, MED14, MED12, MED23, MED27, MED4, MED7, MED8, MED30, MED22, MED31, MED15, MED18, MED11, MED25, POLR2A, MED21, POLR2F, GABPA, GATA1, ATM, POU1F1, GATA2, PARP1, RXRA, TRRAP, PPARG, RARA, SREBF1, KAT2A, SUPT3H, SUPT7L, MYC, CCNC, CDK19, POLR2E, CDK9, ZC3H13, TRIP4, OBFC1, QKI, TADA2A, TRA, NR1H2, KIF1A, BRD4, CTDP1, NCOA6, ELAVL1, MDM2, ZNF281, ZNF326, RALY, SETD7, FBXW7, MED13L, EPAS1, EZH2, BAG3, GJB5, PIN1, POLL, NR1I3, TCL1B, HNRNPC, NTRK1, POLR2G, EMC2, SMEK1, MED12L, RPAP2, POLR2D, BIRC5, PLK1, SPAG5


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ERBB2_MED1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneERBB2P04626DB06366PertuzumabReceptor tyrosine-protein kinase erbB-2biotechapproved
HgeneERBB2P04626DB08916AfatinibReceptor tyrosine-protein kinase erbB-2small moleculeapproved
HgeneERBB2P04626DB00072TrastuzumabReceptor tyrosine-protein kinase erbB-2biotechapproved|investigational
HgeneERBB2P04626DB01259LapatinibReceptor tyrosine-protein kinase erbB-2small moleculeapproved|investigational
HgeneERBB2P04626DB05773Trastuzumab emtansineReceptor tyrosine-protein kinase erbB-2biotechapproved|investigational

Top

RelatedDiseases for ERBB2_MED1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneERBB2C1458155Mammary Neoplasms40CTD_human
HgeneERBB2C0033578Prostatic Neoplasms3CTD_human
HgeneERBB2C0038356Stomach Neoplasms3CTD_human
HgeneERBB2C0001418Adenocarcinoma2CTD_human
HgeneERBB2C0024668Mammary Neoplasms, Experimental2CTD_human
HgeneERBB2C0919267ovarian neoplasm2CTD_human
HgeneERBB2C0007117Basal cell carcinoma1CTD_human
HgeneERBB2C0007134Renal Cell Carcinoma1CTD_human
HgeneERBB2C0009375Colonic Neoplasms1CTD_human
HgeneERBB2C0014859Esophageal Neoplasms1CTD_human
HgeneERBB2C0016978gallbladder neoplasm1CTD_human
HgeneERBB2C0017185Gastrointestinal Neoplasms1CTD_human
HgeneERBB2C0024121Lung Neoplasms1CTD_human
HgeneERBB2C0024232Lymphatic Metastasis1CTD_human
HgeneERBB2C0024667Animal Mammary Neoplasms1CTD_human
HgeneERBB2C0025149Medulloblastoma1CTD_human
HgeneERBB2C0027627Neoplasm Metastasis1CTD_human
HgeneERBB2C0027643Neoplasm Recurrence, Local1CTD_human
HgeneERBB2C0027659Neoplasms, Experimental1CTD_human
HgeneERBB2C0030354Papilloma1CTD_human
HgeneERBB2C0206698Cholangiocarcinoma1CTD_human
HgeneERBB2C0596263Carcinogenesis1CTD_human
HgeneERBB2C2931822Nasopharyngeal carcinoma1CTD_human
TgeneMED1C0014175Endometriosis1CTD_human
TgeneMED1C2239176Liver carcinoma1CTD_human
TgeneMED1C4277682Chemical and Drug Induced Liver Injury1CTD_human