FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 11809

FusionGeneSummary for EPHA6_C11orf80

check button Fusion gene summary
Fusion gene informationFusion gene name: EPHA6_C11orf80
Fusion gene ID: 11809
HgeneTgene
Gene symbol

EPHA6

C11orf80

Gene ID

285220

79703

Gene nameEPH receptor A6chromosome 11 open reading frame 80
SynonymsEHK-2|EHK2|EK12|EPA6|HEK12|PRO57066TOP6BL|TOPOVIBL
Cytomap

3q11.2

11q13.2

Type of geneprotein-codingprotein-coding
Descriptionephrin type-A receptor 6EPH homology kinase 2EPH-like kinase 12ephrin receptor EphA6type 2 DNA topoisomerase 6 subunit B-liketype 2 DNA topoisomerase VI subunit B-like
Modification date2018052320180523
UniProtAcc

Q9UF33

Ensembl transtripts involved in fusion geneENST00000470610, ENST00000389672, 
ENST00000542517, ENST00000514100, 
ENST00000502694, ENST00000442602, 
ENST00000346672, ENST00000360962, 
ENST00000527634, ENST00000540737, 
ENST00000532565, ENST00000525449, 
ENST00000527368, 
Fusion gene scores* DoF score5 X 4 X 4=8012 X 7 X 8=672
# samples 515
** MAII scorelog2(5/80*10)=-0.678071905112638
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(15/672*10)=-2.16349873228288
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: EPHA6 [Title/Abstract] AND C11orf80 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-LL-A7SZ-01AEPHA6chr3

96963131

+C11orf80chr11

66583524

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000470610ENST00000346672EPHA6chr3

96963131

+C11orf80chr11

66583524

+
Frame-shitENST00000470610ENST00000360962EPHA6chr3

96963131

+C11orf80chr11

66583524

+
Frame-shitENST00000470610ENST00000527634EPHA6chr3

96963131

+C11orf80chr11

66583524

+
Frame-shitENST00000470610ENST00000540737EPHA6chr3

96963131

+C11orf80chr11

66583524

+
Frame-shitENST00000470610ENST00000532565EPHA6chr3

96963131

+C11orf80chr11

66583524

+
Frame-shitENST00000470610ENST00000525449EPHA6chr3

96963131

+C11orf80chr11

66583524

+
5CDS-intronENST00000470610ENST00000527368EPHA6chr3

96963131

+C11orf80chr11

66583524

+
In-frameENST00000389672ENST00000346672EPHA6chr3

96963131

+C11orf80chr11

66583524

+
In-frameENST00000389672ENST00000360962EPHA6chr3

96963131

+C11orf80chr11

66583524

+
In-frameENST00000389672ENST00000527634EPHA6chr3

96963131

+C11orf80chr11

66583524

+
In-frameENST00000389672ENST00000540737EPHA6chr3

96963131

+C11orf80chr11

66583524

+
In-frameENST00000389672ENST00000532565EPHA6chr3

96963131

+C11orf80chr11

66583524

+
In-frameENST00000389672ENST00000525449EPHA6chr3

96963131

+C11orf80chr11

66583524

+
5CDS-intronENST00000389672ENST00000527368EPHA6chr3

96963131

+C11orf80chr11

66583524

+
intron-3CDSENST00000542517ENST00000346672EPHA6chr3

96963131

+C11orf80chr11

66583524

+
intron-3CDSENST00000542517ENST00000360962EPHA6chr3

96963131

+C11orf80chr11

66583524

+
intron-3CDSENST00000542517ENST00000527634EPHA6chr3

96963131

+C11orf80chr11

66583524

+
intron-3CDSENST00000542517ENST00000540737EPHA6chr3

96963131

+C11orf80chr11

66583524

+
intron-3CDSENST00000542517ENST00000532565EPHA6chr3

96963131

+C11orf80chr11

66583524

+
intron-3CDSENST00000542517ENST00000525449EPHA6chr3

96963131

+C11orf80chr11

66583524

+
intron-intronENST00000542517ENST00000527368EPHA6chr3

96963131

+C11orf80chr11

66583524

+
intron-3CDSENST00000514100ENST00000346672EPHA6chr3

96963131

+C11orf80chr11

66583524

+
intron-3CDSENST00000514100ENST00000360962EPHA6chr3

96963131

+C11orf80chr11

66583524

+
intron-3CDSENST00000514100ENST00000527634EPHA6chr3

96963131

+C11orf80chr11

66583524

+
intron-3CDSENST00000514100ENST00000540737EPHA6chr3

96963131

+C11orf80chr11

66583524

+
intron-3CDSENST00000514100ENST00000532565EPHA6chr3

96963131

+C11orf80chr11

66583524

+
intron-3CDSENST00000514100ENST00000525449EPHA6chr3

96963131

+C11orf80chr11

66583524

+
intron-intronENST00000514100ENST00000527368EPHA6chr3

96963131

+C11orf80chr11

66583524

+
intron-3CDSENST00000502694ENST00000346672EPHA6chr3

96963131

+C11orf80chr11

66583524

+
intron-3CDSENST00000502694ENST00000360962EPHA6chr3

96963131

+C11orf80chr11

66583524

+
intron-3CDSENST00000502694ENST00000527634EPHA6chr3

96963131

+C11orf80chr11

66583524

+
intron-3CDSENST00000502694ENST00000540737EPHA6chr3

96963131

+C11orf80chr11

66583524

+
intron-3CDSENST00000502694ENST00000532565EPHA6chr3

96963131

+C11orf80chr11

66583524

+
intron-3CDSENST00000502694ENST00000525449EPHA6chr3

96963131

+C11orf80chr11

66583524

+
intron-intronENST00000502694ENST00000527368EPHA6chr3

96963131

+C11orf80chr11

66583524

+
intron-3CDSENST00000442602ENST00000346672EPHA6chr3

96963131

+C11orf80chr11

66583524

+
intron-3CDSENST00000442602ENST00000360962EPHA6chr3

96963131

+C11orf80chr11

66583524

+
intron-3CDSENST00000442602ENST00000527634EPHA6chr3

96963131

+C11orf80chr11

66583524

+
intron-3CDSENST00000442602ENST00000540737EPHA6chr3

96963131

+C11orf80chr11

66583524

+
intron-3CDSENST00000442602ENST00000532565EPHA6chr3

96963131

+C11orf80chr11

66583524

+
intron-3CDSENST00000442602ENST00000525449EPHA6chr3

96963131

+C11orf80chr11

66583524

+
intron-intronENST00000442602ENST00000527368EPHA6chr3

96963131

+C11orf80chr11

66583524

+

Top

FusionProtFeatures for EPHA6_C11orf80


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
EPHA6

Q9UF33

C11orf80

Receptor tyrosine kinase which binds promiscuously GPI-anchored ephrin-A family ligands residing on adjacent cells,leading to contact-dependent bidirectional signaling intoneighboring cells. The signaling pathway downstream of thereceptor is referred to as forward signaling while the signalingpathway downstream of the ephrin ligand is referred to as reversesignaling (By similarity). {ECO:0000250}. Lectin that binds to various sugars: galactose > mannose= fucose > N-acetylglucosamine > N-acetylgalactosamine(PubMed:10224141). Acts as a chemoattractant, probably involved inthe regulation of cell migration (PubMed:28301481).{ECO:0000269|PubMed:10224141, ECO:0000269|PubMed:28301481}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for EPHA6_C11orf80


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_EPHA6_ENST00000389672_chr3_96963131_+_C11orf80_ENST00000346672_chr11_66583524_+_780aa
MQFPSPPAARSSPAPQAASSSEAAAPATGQPGPSCPVPGTSRRGRPGTPPAGRVEEEEEEEEEDVDKDPHPTQNTCLRCRHFSLRERKRE
PRRTMGGCEVREFLLQFGFFLPLLTAWPGDCSHVSNNQVVLLDTTTVLGELGWKTTPLNGWDAITEMDEHNRPIHTYQVCNVMEPNQNNW
LRTNWISRDAAQKITVEMKFTLRDCNSIPWVLGTCKETFNLFTMESDESHGIKFKPNQTTKIDTIAADESFTQMDLGDRILKLNTEIREV
GPIERKGFTLAFQDIGACIALVSVRVFYKKCPFTVRNLAMFPDTIPRVDSSSLVEVRGSCVKSAEERDTPKLTCGADGDWLVPLGRCICS
TGTEEIEGSCHACRPGFTKAFAGNTKCSKCPPHSLTYMEATSVCQCEKGTFRAEKDPPSMACTRPPSAPRNVVFNINETALILEWSPPSD
TGGRKDLTYSVICKKCGLDTSQCEDCGGGLRFIPRHTGLINNSVIVLDFVSHVNYTFEIEAMNGVSELSFSPKPFTAITVTTDQDDLVLP
DVSTQVESSEEDQSQTMDPQGQTLLLFLFVDFHSAFPVQQMEIWGVTTLLTTHLNAILVESHSVVQGSIQFTVDKVLEQHHQAAKAADTQ
EFRTKLHKVFREITQHQFLHHCSCEVKQQLTLEKKDSAQGTEDAPDNSSLELLADTSGQAENKRLKRGSPRIEEMRALRSARAPSPSEAA

>In-frame_EPHA6_ENST00000389672_chr3_96963131_+_C11orf80_ENST00000360962_chr11_66583524_+_817aa
MQFPSPPAARSSPAPQAASSSEAAAPATGQPGPSCPVPGTSRRGRPGTPPAGRVEEEEEEEEEDVDKDPHPTQNTCLRCRHFSLRERKRE
PRRTMGGCEVREFLLQFGFFLPLLTAWPGDCSHVSNNQVVLLDTTTVLGELGWKTTPLNGWDAITEMDEHNRPIHTYQVCNVMEPNQNNW
LRTNWISRDAAQKITVEMKFTLRDCNSIPWVLGTCKETFNLFTMESDESHGIKFKPNQTTKIDTIAADESFTQMDLGDRILKLNTEIREV
GPIERKGFTLAFQDIGACIALVSVRVFYKKCPFTVRNLAMFPDTIPRVDSSSLVEVRGSCVKSAEERDTPKLTCGADGDWLVPLGRCICS
TGTEEIEGSCHACRPGFTKAFAGNTKCSKCPPHSLTYMEATSVCQCEKGTFRAEKDPPSMACTRPPSAPRNVVFNINETALILEWSPPSD
TGGRKDLTYSVICKKCGLDTSQCEDCGGGLRFIPRHTGLINNSVIVLDFVSHVNYTFEIEAMNGVSELSFSPKPFTAITVTTDQDDLVLP
DVSTQVESSEEDQSQTMDPQGQTLLLFLFVDFHSAFPVQQMEIWGVTTLLTTHLNAILVESHSVVQGSIQFTVDKVLEQHHQAAKAQQKL
QASLSVAVNSIMSILTGSTRSSFRKMCLQTLQAADTQEFRTKLHKVFREITQHQFLHHCSCEVKQQLTLEKKDSAQGTEDAPDNSSLELL
ADTSGQAENKRLKRGSPRIEEMRALRSARAPSPSEAAPRRPEATAAPLTPRGREHREAHGRALAPGRASLGSRLEDVLWLQEVSNLSEWL

>In-frame_EPHA6_ENST00000389672_chr3_96963131_+_C11orf80_ENST00000527634_chr11_66583524_+_817aa
MQFPSPPAARSSPAPQAASSSEAAAPATGQPGPSCPVPGTSRRGRPGTPPAGRVEEEEEEEEEDVDKDPHPTQNTCLRCRHFSLRERKRE
PRRTMGGCEVREFLLQFGFFLPLLTAWPGDCSHVSNNQVVLLDTTTVLGELGWKTTPLNGWDAITEMDEHNRPIHTYQVCNVMEPNQNNW
LRTNWISRDAAQKITVEMKFTLRDCNSIPWVLGTCKETFNLFTMESDESHGIKFKPNQTTKIDTIAADESFTQMDLGDRILKLNTEIREV
GPIERKGFTLAFQDIGACIALVSVRVFYKKCPFTVRNLAMFPDTIPRVDSSSLVEVRGSCVKSAEERDTPKLTCGADGDWLVPLGRCICS
TGTEEIEGSCHACRPGFTKAFAGNTKCSKCPPHSLTYMEATSVCQCEKGTFRAEKDPPSMACTRPPSAPRNVVFNINETALILEWSPPSD
TGGRKDLTYSVICKKCGLDTSQCEDCGGGLRFIPRHTGLINNSVIVLDFVSHVNYTFEIEAMNGVSELSFSPKPFTAITVTTDQDDLVLP
DVSTQVESSEEDQSQTMDPQGQTLLLFLFVDFHSAFPVQQMEIWGVTTLLTTHLNAILVESHSVVQGSIQFTVDKVLEQHHQAAKAQQKL
QASLSVAVNSIMSILTGSTRSSFRKMCLQTLQAADTQEFRTKLHKVFREITQHQFLHHCSCEVKQQLTLEKKDSAQGTEDAPDNSSLELL
ADTSGQAENKRLKRGSPRIEEMRALRSARAPSPSEAAPRRPEATAAPLTPRGREHREAHGRALAPGRASLGSRLEDVLWLQEVSNLSEWL

>In-frame_EPHA6_ENST00000389672_chr3_96963131_+_C11orf80_ENST00000540737_chr11_66583524_+_816aa
MQFPSPPAARSSPAPQAASSSEAAAPATGQPGPSCPVPGTSRRGRPGTPPAGRVEEEEEEEEEDVDKDPHPTQNTCLRCRHFSLRERKRE
PRRTMGGCEVREFLLQFGFFLPLLTAWPGDCSHVSNNQVVLLDTTTVLGELGWKTTPLNGWDAITEMDEHNRPIHTYQVCNVMEPNQNNW
LRTNWISRDAAQKITVEMKFTLRDCNSIPWVLGTCKETFNLFTMESDESHGIKFKPNQTTKIDTIAADESFTQMDLGDRILKLNTEIREV
GPIERKGFTLAFQDIGACIALVSVRVFYKKCPFTVRNLAMFPDTIPRVDSSSLVEVRGSCVKSAEERDTPKLTCGADGDWLVPLGRCICS
TGTEEIEGSCHACRPGFTKAFAGNTKCSKCPPHSLTYMEATSVCQCEKGTFRAEKDPPSMACTRPPSAPRNVVFNINETALILEWSPPSD
TGGRKDLTYSVICKKCGLDTSQCEDCGGGLRFIPRHTGLINNSVIVLDFVSHVNYTFEIEAMNGVSELSFSPKPFTAITVTTDQDDLVLP
DVSTQVESSEEDQSQTMDPQGQTLLLFLFVDFHSAFPVQQMEIWGVTTLLTTHLNAILVESHSVVQGSIQFTVDKVLEQHHQAAKAQQKL
QASLSVAVNSIMSILTGSTRSSFRKMCLQTLQAADTQEFRTKLHKVFREITQHQFLHHCSCEVKQLTLEKKDSAQGTEDAPDNSSLELLA
DTSGQAENKRLKRGSPRIEEMRALRSARAPSPSEAAPRRPEATAAPLTPRGREHREAHGRALAPGRASLGSRLEDVLWLQEVSNLSEWLS

>In-frame_EPHA6_ENST00000389672_chr3_96963131_+_C11orf80_ENST00000532565_chr11_66583524_+_817aa
MQFPSPPAARSSPAPQAASSSEAAAPATGQPGPSCPVPGTSRRGRPGTPPAGRVEEEEEEEEEDVDKDPHPTQNTCLRCRHFSLRERKRE
PRRTMGGCEVREFLLQFGFFLPLLTAWPGDCSHVSNNQVVLLDTTTVLGELGWKTTPLNGWDAITEMDEHNRPIHTYQVCNVMEPNQNNW
LRTNWISRDAAQKITVEMKFTLRDCNSIPWVLGTCKETFNLFTMESDESHGIKFKPNQTTKIDTIAADESFTQMDLGDRILKLNTEIREV
GPIERKGFTLAFQDIGACIALVSVRVFYKKCPFTVRNLAMFPDTIPRVDSSSLVEVRGSCVKSAEERDTPKLTCGADGDWLVPLGRCICS
TGTEEIEGSCHACRPGFTKAFAGNTKCSKCPPHSLTYMEATSVCQCEKGTFRAEKDPPSMACTRPPSAPRNVVFNINETALILEWSPPSD
TGGRKDLTYSVICKKCGLDTSQCEDCGGGLRFIPRHTGLINNSVIVLDFVSHVNYTFEIEAMNGVSELSFSPKPFTAITVTTDQDDLVLP
DVSTQVESSEEDQSQTMDPQGQTLLLFLFVDFHSAFPVQQMEIWGVTTLLTTHLNAILVESHSVVQGSIQFTVDKVLEQHHQAAKAQQKL
QASLSVAVNSIMSILTGSTRSSFRKMCLQTLQAADTQEFRTKLHKVFREITQHQFLHHCSCEVKQQLTLEKKDSAQGTEDAPDNSSLELL
ADTSGQAENKRLKRGSPRIEEMRALRSARAPSPSEAAPRRPEATAAPLTPRGREHREAHGRALAPGRASLGSRLEDVLWLQEVSNLSEWL

>In-frame_EPHA6_ENST00000389672_chr3_96963131_+_C11orf80_ENST00000525449_chr11_66583524_+_780aa
MQFPSPPAARSSPAPQAASSSEAAAPATGQPGPSCPVPGTSRRGRPGTPPAGRVEEEEEEEEEDVDKDPHPTQNTCLRCRHFSLRERKRE
PRRTMGGCEVREFLLQFGFFLPLLTAWPGDCSHVSNNQVVLLDTTTVLGELGWKTTPLNGWDAITEMDEHNRPIHTYQVCNVMEPNQNNW
LRTNWISRDAAQKITVEMKFTLRDCNSIPWVLGTCKETFNLFTMESDESHGIKFKPNQTTKIDTIAADESFTQMDLGDRILKLNTEIREV
GPIERKGFTLAFQDIGACIALVSVRVFYKKCPFTVRNLAMFPDTIPRVDSSSLVEVRGSCVKSAEERDTPKLTCGADGDWLVPLGRCICS
TGTEEIEGSCHACRPGFTKAFAGNTKCSKCPPHSLTYMEATSVCQCEKGTFRAEKDPPSMACTRPPSAPRNVVFNINETALILEWSPPSD
TGGRKDLTYSVICKKCGLDTSQCEDCGGGLRFIPRHTGLINNSVIVLDFVSHVNYTFEIEAMNGVSELSFSPKPFTAITVTTDQDDLVLP
DVSTQVESSEEDQSQTMDPQGQTLLLFLFVDFHSAFPVQQMEIWGVTTLLTTHLNAILVESHSVVQGSIQFTVDKVLEQHHQAAKAADTQ
EFRTKLHKVFREITQHQFLHHCSCEVKQQLTLEKKDSAQGTEDAPDNSSLELLADTSGQAENKRLKRGSPRIEEMRALRSARAPSPSEAA


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_EPHA6_ENST00000389672_chr3_96963131_+_C11orf80_ENST00000346672_chr11_66583524_+_2340nt
ATGCAATTCCCCTCGCCTCCAGCCGCGAGGAGCTCCCCGGCGCCGCAGGCAGCGTCCTCCTCCGAAGCAGCTGCACCTGCAACTGGGCAG
CCTGGACCCTCGTGCCCTGTTCCCGGGACCTCGCGCAGGGGGCGCCCCGGGACACCCCCTGCGGGCCGGGTGGAGGAGGAAGAGGAGGAG
GAGGAAGAAGACGTGGACAAGGACCCCCATCCTACCCAGAACACCTGCCTGCGCTGCCGCCACTTCTCTTTAAGGGAGAGGAAAAGAGAG
CCTAGGAGAACCATGGGGGGCTGCGAAGTCCGGGAATTTCTTTTGCAATTTGGTTTCTTCTTGCCTCTGCTGACAGCGTGGCCAGGCGAC
TGCAGTCACGTCTCCAACAACCAAGTTGTGTTGCTTGATACAACAACTGTACTGGGAGAGCTAGGATGGAAAACATATCCATTAAATGGG
TGGGATGCCATCACTGAAATGGATGAACATAATAGGCCCATTCACACATACCAGGTATGTAATGTAATGGAACCAAACCAAAACAACTGG
CTTCGTACAAACTGGATCTCCCGTGATGCAGCTCAGAAAATTTATGTGGAAATGAAATTCACACTAAGGGATTGTAACAGCATCCCATGG
GTCTTGGGGACTTGCAAAGAAACATTTAATCTGTTTTATATGGAATCAGATGAGTCCCACGGAATTAAATTCAAGCCAAACCAGTATACA
AAGATCGACACAATTGCTGCTGATGAGAGTTTTACCCAGATGGATTTGGGTGATCGCATCCTCAAACTCAACACTGAAATTCGTGAGGTG
GGGCCTATAGAAAGGAAAGGATTTTATCTGGCTTTTCAAGACATTGGGGCGTGCATTGCCCTGGTTTCAGTCCGTGTTTTCTACAAGAAA
TGCCCCTTCACTGTTCGTAACTTGGCCATGTTTCCTGATACCATTCCAAGGGTTGATTCCTCCTCTTTGGTTGAAGTACGGGGTTCTTGT
GTGAAGAGTGCTGAAGAGCGTGACACTCCTAAACTGTATTGTGGAGCTGATGGAGATTGGCTGGTTCCTCTTGGAAGGTGCATCTGCAGT
ACAGGATATGAAGAAATTGAGGGTTCTTGCCATGCTTGCAGACCAGGATTCTATAAAGCTTTTGCTGGGAACACAAAATGTTCTAAATGT
CCTCCACACAGTTTAACATACATGGAAGCAACTTCTGTCTGTCAGTGTGAAAAGGGTTATTTCCGAGCTGAAAAAGACCCACCTTCTATG
GCATGTACCAGGCCACCTTCAGCTCCTAGGAATGTGGTTTTTAACATCAATGAAACAGCCCTTATTTTGGAATGGAGCCCACCAAGTGAC
ACAGGAGGGAGAAAAGATCTCACATACAGTGTAATCTGTAAGAAATGTGGCTTAGACACCAGCCAGTGTGAGGACTGTGGTGGAGGACTC
CGCTTCATCCCAAGACATACAGGCCTGATCAACAATTCCGTGATAGTACTTGACTTTGTGTCTCACGTGAATTACACCTTTGAAATAGAA
GCAATGAATGGAGTTTCTGAGTTGAGTTTTTCTCCCAAGCCATTCACAGCTATTACAGTGACCACGGATCAAGATGATTTGGTGCTTCCA
GATGTGAGTTATCAGGTGGAATCCAGTGAGGAGGATCAGTCTCAGACTATGGATCCTCAAGGACAAACTCTGCTGCTTTTTCTCTTTGTG
GATTTCCACAGTGCATTTCCAGTCCAGCAAATGGAAATCTGGGGAGTCTATACTTTGCTCACAACTCATCTCAATGCCATCCTTGTGGAG
AGCCACAGTGTAGTGCAAGGTTCCATCCAATTCACTGTGGACAAGGTCTTGGAGCAACATCACCAGGCTGCCAAGGCAGCTGACACACAA
GAGTTCAGGACCAAACTGCACAAAGTATTTCGTGAGATCACCCAACACCAATTTCTTCACCACTGCTCATGTGAGGTGAAGCAGCAGCTA
ACCCTAGAAAAAAAGGACTCAGCCCAGGGCACTGAGGACGCACCTGATAACAGCAGCCTGGAGCTCCTAGCAGATACCAGCGGGCAAGCA
GAAAACAAGAGGCTCAAGAGGGGCAGCCCCCGCATAGAGGAGATGCGAGCTCTGCGCTCTGCCAGGGCCCCGAGCCCGTCAGAGGCCGCC
CCGCGCCGCCCGGAAGCCACCGCGGCCCCCCTCACTCCTAGAGGAAGGGAGCACCGCGAGGCTCACGGCAGGGCCCTGGCGCCGGGCAGG
GCGAGCCTCGGAAGCCGCCTGGAGGACGTGCTGTGGCTGCAGGAGGTCTCCAACCTGTCAGAGTGGCTGAGTCCCAGCCCTGGGCCCTGA

>In-frame_EPHA6_ENST00000389672_chr3_96963131_+_C11orf80_ENST00000360962_chr11_66583524_+_2451nt
ATGCAATTCCCCTCGCCTCCAGCCGCGAGGAGCTCCCCGGCGCCGCAGGCAGCGTCCTCCTCCGAAGCAGCTGCACCTGCAACTGGGCAG
CCTGGACCCTCGTGCCCTGTTCCCGGGACCTCGCGCAGGGGGCGCCCCGGGACACCCCCTGCGGGCCGGGTGGAGGAGGAAGAGGAGGAG
GAGGAAGAAGACGTGGACAAGGACCCCCATCCTACCCAGAACACCTGCCTGCGCTGCCGCCACTTCTCTTTAAGGGAGAGGAAAAGAGAG
CCTAGGAGAACCATGGGGGGCTGCGAAGTCCGGGAATTTCTTTTGCAATTTGGTTTCTTCTTGCCTCTGCTGACAGCGTGGCCAGGCGAC
TGCAGTCACGTCTCCAACAACCAAGTTGTGTTGCTTGATACAACAACTGTACTGGGAGAGCTAGGATGGAAAACATATCCATTAAATGGG
TGGGATGCCATCACTGAAATGGATGAACATAATAGGCCCATTCACACATACCAGGTATGTAATGTAATGGAACCAAACCAAAACAACTGG
CTTCGTACAAACTGGATCTCCCGTGATGCAGCTCAGAAAATTTATGTGGAAATGAAATTCACACTAAGGGATTGTAACAGCATCCCATGG
GTCTTGGGGACTTGCAAAGAAACATTTAATCTGTTTTATATGGAATCAGATGAGTCCCACGGAATTAAATTCAAGCCAAACCAGTATACA
AAGATCGACACAATTGCTGCTGATGAGAGTTTTACCCAGATGGATTTGGGTGATCGCATCCTCAAACTCAACACTGAAATTCGTGAGGTG
GGGCCTATAGAAAGGAAAGGATTTTATCTGGCTTTTCAAGACATTGGGGCGTGCATTGCCCTGGTTTCAGTCCGTGTTTTCTACAAGAAA
TGCCCCTTCACTGTTCGTAACTTGGCCATGTTTCCTGATACCATTCCAAGGGTTGATTCCTCCTCTTTGGTTGAAGTACGGGGTTCTTGT
GTGAAGAGTGCTGAAGAGCGTGACACTCCTAAACTGTATTGTGGAGCTGATGGAGATTGGCTGGTTCCTCTTGGAAGGTGCATCTGCAGT
ACAGGATATGAAGAAATTGAGGGTTCTTGCCATGCTTGCAGACCAGGATTCTATAAAGCTTTTGCTGGGAACACAAAATGTTCTAAATGT
CCTCCACACAGTTTAACATACATGGAAGCAACTTCTGTCTGTCAGTGTGAAAAGGGTTATTTCCGAGCTGAAAAAGACCCACCTTCTATG
GCATGTACCAGGCCACCTTCAGCTCCTAGGAATGTGGTTTTTAACATCAATGAAACAGCCCTTATTTTGGAATGGAGCCCACCAAGTGAC
ACAGGAGGGAGAAAAGATCTCACATACAGTGTAATCTGTAAGAAATGTGGCTTAGACACCAGCCAGTGTGAGGACTGTGGTGGAGGACTC
CGCTTCATCCCAAGACATACAGGCCTGATCAACAATTCCGTGATAGTACTTGACTTTGTGTCTCACGTGAATTACACCTTTGAAATAGAA
GCAATGAATGGAGTTTCTGAGTTGAGTTTTTCTCCCAAGCCATTCACAGCTATTACAGTGACCACGGATCAAGATGATTTGGTGCTTCCA
GATGTGAGTTATCAGGTGGAATCCAGTGAGGAGGATCAGTCTCAGACTATGGATCCTCAAGGACAAACTCTGCTGCTTTTTCTCTTTGTG
GATTTCCACAGTGCATTTCCAGTCCAGCAAATGGAAATCTGGGGAGTCTATACTTTGCTCACAACTCATCTCAATGCCATCCTTGTGGAG
AGCCACAGTGTAGTGCAAGGTTCCATCCAATTCACTGTGGACAAGGTCTTGGAGCAACATCACCAGGCTGCCAAGGCTCAGCAGAAACTA
CAGGCCTCACTCTCAGTGGCTGTGAACTCCATCATGAGTATTCTGACTGGAAGCACTAGGAGCAGCTTCCGAAAGATGTGTCTCCAGACC
CTTCAAGCAGCTGACACACAAGAGTTCAGGACCAAACTGCACAAAGTATTTCGTGAGATCACCCAACACCAATTTCTTCACCACTGCTCA
TGTGAGGTGAAGCAGCAGCTAACCCTAGAAAAAAAGGACTCAGCCCAGGGCACTGAGGACGCACCTGATAACAGCAGCCTGGAGCTCCTA
GCAGATACCAGCGGGCAAGCAGAAAACAAGAGGCTCAAGAGGGGCAGCCCCCGCATAGAGGAGATGCGAGCTCTGCGCTCTGCCAGGGCC
CCGAGCCCGTCAGAGGCCGCCCCGCGCCGCCCGGAAGCCACCGCGGCCCCCCTCACTCCTAGAGGAAGGGAGCACCGCGAGGCTCACGGC
AGGGCCCTGGCGCCGGGCAGGGCGAGCCTCGGAAGCCGCCTGGAGGACGTGCTGTGGCTGCAGGAGGTCTCCAACCTGTCAGAGTGGCTG

>In-frame_EPHA6_ENST00000389672_chr3_96963131_+_C11orf80_ENST00000527634_chr11_66583524_+_2451nt
ATGCAATTCCCCTCGCCTCCAGCCGCGAGGAGCTCCCCGGCGCCGCAGGCAGCGTCCTCCTCCGAAGCAGCTGCACCTGCAACTGGGCAG
CCTGGACCCTCGTGCCCTGTTCCCGGGACCTCGCGCAGGGGGCGCCCCGGGACACCCCCTGCGGGCCGGGTGGAGGAGGAAGAGGAGGAG
GAGGAAGAAGACGTGGACAAGGACCCCCATCCTACCCAGAACACCTGCCTGCGCTGCCGCCACTTCTCTTTAAGGGAGAGGAAAAGAGAG
CCTAGGAGAACCATGGGGGGCTGCGAAGTCCGGGAATTTCTTTTGCAATTTGGTTTCTTCTTGCCTCTGCTGACAGCGTGGCCAGGCGAC
TGCAGTCACGTCTCCAACAACCAAGTTGTGTTGCTTGATACAACAACTGTACTGGGAGAGCTAGGATGGAAAACATATCCATTAAATGGG
TGGGATGCCATCACTGAAATGGATGAACATAATAGGCCCATTCACACATACCAGGTATGTAATGTAATGGAACCAAACCAAAACAACTGG
CTTCGTACAAACTGGATCTCCCGTGATGCAGCTCAGAAAATTTATGTGGAAATGAAATTCACACTAAGGGATTGTAACAGCATCCCATGG
GTCTTGGGGACTTGCAAAGAAACATTTAATCTGTTTTATATGGAATCAGATGAGTCCCACGGAATTAAATTCAAGCCAAACCAGTATACA
AAGATCGACACAATTGCTGCTGATGAGAGTTTTACCCAGATGGATTTGGGTGATCGCATCCTCAAACTCAACACTGAAATTCGTGAGGTG
GGGCCTATAGAAAGGAAAGGATTTTATCTGGCTTTTCAAGACATTGGGGCGTGCATTGCCCTGGTTTCAGTCCGTGTTTTCTACAAGAAA
TGCCCCTTCACTGTTCGTAACTTGGCCATGTTTCCTGATACCATTCCAAGGGTTGATTCCTCCTCTTTGGTTGAAGTACGGGGTTCTTGT
GTGAAGAGTGCTGAAGAGCGTGACACTCCTAAACTGTATTGTGGAGCTGATGGAGATTGGCTGGTTCCTCTTGGAAGGTGCATCTGCAGT
ACAGGATATGAAGAAATTGAGGGTTCTTGCCATGCTTGCAGACCAGGATTCTATAAAGCTTTTGCTGGGAACACAAAATGTTCTAAATGT
CCTCCACACAGTTTAACATACATGGAAGCAACTTCTGTCTGTCAGTGTGAAAAGGGTTATTTCCGAGCTGAAAAAGACCCACCTTCTATG
GCATGTACCAGGCCACCTTCAGCTCCTAGGAATGTGGTTTTTAACATCAATGAAACAGCCCTTATTTTGGAATGGAGCCCACCAAGTGAC
ACAGGAGGGAGAAAAGATCTCACATACAGTGTAATCTGTAAGAAATGTGGCTTAGACACCAGCCAGTGTGAGGACTGTGGTGGAGGACTC
CGCTTCATCCCAAGACATACAGGCCTGATCAACAATTCCGTGATAGTACTTGACTTTGTGTCTCACGTGAATTACACCTTTGAAATAGAA
GCAATGAATGGAGTTTCTGAGTTGAGTTTTTCTCCCAAGCCATTCACAGCTATTACAGTGACCACGGATCAAGATGATTTGGTGCTTCCA
GATGTGAGTTATCAGGTGGAATCCAGTGAGGAGGATCAGTCTCAGACTATGGATCCTCAAGGACAAACTCTGCTGCTTTTTCTCTTTGTG
GATTTCCACAGTGCATTTCCAGTCCAGCAAATGGAAATCTGGGGAGTCTATACTTTGCTCACAACTCATCTCAATGCCATCCTTGTGGAG
AGCCACAGTGTAGTGCAAGGTTCCATCCAATTCACTGTGGACAAGGTCTTGGAGCAACATCACCAGGCTGCCAAGGCTCAGCAGAAACTA
CAGGCCTCACTCTCAGTGGCTGTGAACTCCATCATGAGTATTCTGACTGGAAGCACTAGGAGCAGCTTCCGAAAGATGTGTCTCCAGACC
CTTCAAGCAGCTGACACACAAGAGTTCAGGACCAAACTGCACAAAGTATTTCGTGAGATCACCCAACACCAATTTCTTCACCACTGCTCA
TGTGAGGTGAAGCAGCAGCTAACCCTAGAAAAAAAGGACTCAGCCCAGGGCACTGAGGACGCACCTGATAACAGCAGCCTGGAGCTCCTA
GCAGATACCAGCGGGCAAGCAGAAAACAAGAGGCTCAAGAGGGGCAGCCCCCGCATAGAGGAGATGCGAGCTCTGCGCTCTGCCAGGGCC
CCGAGCCCGTCAGAGGCCGCCCCGCGCCGCCCGGAAGCCACCGCGGCCCCCCTCACTCCTAGAGGAAGGGAGCACCGCGAGGCTCACGGC
AGGGCCCTGGCGCCGGGCAGGGCGAGCCTCGGAAGCCGCCTGGAGGACGTGCTGTGGCTGCAGGAGGTCTCCAACCTGTCAGAGTGGCTG

>In-frame_EPHA6_ENST00000389672_chr3_96963131_+_C11orf80_ENST00000540737_chr11_66583524_+_2448nt
ATGCAATTCCCCTCGCCTCCAGCCGCGAGGAGCTCCCCGGCGCCGCAGGCAGCGTCCTCCTCCGAAGCAGCTGCACCTGCAACTGGGCAG
CCTGGACCCTCGTGCCCTGTTCCCGGGACCTCGCGCAGGGGGCGCCCCGGGACACCCCCTGCGGGCCGGGTGGAGGAGGAAGAGGAGGAG
GAGGAAGAAGACGTGGACAAGGACCCCCATCCTACCCAGAACACCTGCCTGCGCTGCCGCCACTTCTCTTTAAGGGAGAGGAAAAGAGAG
CCTAGGAGAACCATGGGGGGCTGCGAAGTCCGGGAATTTCTTTTGCAATTTGGTTTCTTCTTGCCTCTGCTGACAGCGTGGCCAGGCGAC
TGCAGTCACGTCTCCAACAACCAAGTTGTGTTGCTTGATACAACAACTGTACTGGGAGAGCTAGGATGGAAAACATATCCATTAAATGGG
TGGGATGCCATCACTGAAATGGATGAACATAATAGGCCCATTCACACATACCAGGTATGTAATGTAATGGAACCAAACCAAAACAACTGG
CTTCGTACAAACTGGATCTCCCGTGATGCAGCTCAGAAAATTTATGTGGAAATGAAATTCACACTAAGGGATTGTAACAGCATCCCATGG
GTCTTGGGGACTTGCAAAGAAACATTTAATCTGTTTTATATGGAATCAGATGAGTCCCACGGAATTAAATTCAAGCCAAACCAGTATACA
AAGATCGACACAATTGCTGCTGATGAGAGTTTTACCCAGATGGATTTGGGTGATCGCATCCTCAAACTCAACACTGAAATTCGTGAGGTG
GGGCCTATAGAAAGGAAAGGATTTTATCTGGCTTTTCAAGACATTGGGGCGTGCATTGCCCTGGTTTCAGTCCGTGTTTTCTACAAGAAA
TGCCCCTTCACTGTTCGTAACTTGGCCATGTTTCCTGATACCATTCCAAGGGTTGATTCCTCCTCTTTGGTTGAAGTACGGGGTTCTTGT
GTGAAGAGTGCTGAAGAGCGTGACACTCCTAAACTGTATTGTGGAGCTGATGGAGATTGGCTGGTTCCTCTTGGAAGGTGCATCTGCAGT
ACAGGATATGAAGAAATTGAGGGTTCTTGCCATGCTTGCAGACCAGGATTCTATAAAGCTTTTGCTGGGAACACAAAATGTTCTAAATGT
CCTCCACACAGTTTAACATACATGGAAGCAACTTCTGTCTGTCAGTGTGAAAAGGGTTATTTCCGAGCTGAAAAAGACCCACCTTCTATG
GCATGTACCAGGCCACCTTCAGCTCCTAGGAATGTGGTTTTTAACATCAATGAAACAGCCCTTATTTTGGAATGGAGCCCACCAAGTGAC
ACAGGAGGGAGAAAAGATCTCACATACAGTGTAATCTGTAAGAAATGTGGCTTAGACACCAGCCAGTGTGAGGACTGTGGTGGAGGACTC
CGCTTCATCCCAAGACATACAGGCCTGATCAACAATTCCGTGATAGTACTTGACTTTGTGTCTCACGTGAATTACACCTTTGAAATAGAA
GCAATGAATGGAGTTTCTGAGTTGAGTTTTTCTCCCAAGCCATTCACAGCTATTACAGTGACCACGGATCAAGATGATTTGGTGCTTCCA
GATGTGAGTTATCAGGTGGAATCCAGTGAGGAGGATCAGTCTCAGACTATGGATCCTCAAGGACAAACTCTGCTGCTTTTTCTCTTTGTG
GATTTCCACAGTGCATTTCCAGTCCAGCAAATGGAAATCTGGGGAGTCTATACTTTGCTCACAACTCATCTCAATGCCATCCTTGTGGAG
AGCCACAGTGTAGTGCAAGGTTCCATCCAATTCACTGTGGACAAGGTCTTGGAGCAACATCACCAGGCTGCCAAGGCTCAGCAGAAACTA
CAGGCCTCACTCTCAGTGGCTGTGAACTCCATCATGAGTATTCTGACTGGAAGCACTAGGAGCAGCTTCCGAAAGATGTGTCTCCAGACC
CTTCAAGCAGCTGACACACAAGAGTTCAGGACCAAACTGCACAAAGTATTTCGTGAGATCACCCAACACCAATTTCTTCACCACTGCTCA
TGTGAGGTGAAGCAGCTAACCCTAGAAAAAAAGGACTCAGCCCAGGGCACTGAGGACGCACCTGATAACAGCAGCCTGGAGCTCCTAGCA
GATACCAGCGGGCAAGCAGAAAACAAGAGGCTCAAGAGGGGCAGCCCCCGCATAGAGGAGATGCGAGCTCTGCGCTCTGCCAGGGCCCCG
AGCCCGTCAGAGGCCGCCCCGCGCCGCCCGGAAGCCACCGCGGCCCCCCTCACTCCTAGAGGAAGGGAGCACCGCGAGGCTCACGGCAGG
GCCCTGGCGCCGGGCAGGGCGAGCCTCGGAAGCCGCCTGGAGGACGTGCTGTGGCTGCAGGAGGTCTCCAACCTGTCAGAGTGGCTGAGT

>In-frame_EPHA6_ENST00000389672_chr3_96963131_+_C11orf80_ENST00000532565_chr11_66583524_+_2451nt
ATGCAATTCCCCTCGCCTCCAGCCGCGAGGAGCTCCCCGGCGCCGCAGGCAGCGTCCTCCTCCGAAGCAGCTGCACCTGCAACTGGGCAG
CCTGGACCCTCGTGCCCTGTTCCCGGGACCTCGCGCAGGGGGCGCCCCGGGACACCCCCTGCGGGCCGGGTGGAGGAGGAAGAGGAGGAG
GAGGAAGAAGACGTGGACAAGGACCCCCATCCTACCCAGAACACCTGCCTGCGCTGCCGCCACTTCTCTTTAAGGGAGAGGAAAAGAGAG
CCTAGGAGAACCATGGGGGGCTGCGAAGTCCGGGAATTTCTTTTGCAATTTGGTTTCTTCTTGCCTCTGCTGACAGCGTGGCCAGGCGAC
TGCAGTCACGTCTCCAACAACCAAGTTGTGTTGCTTGATACAACAACTGTACTGGGAGAGCTAGGATGGAAAACATATCCATTAAATGGG
TGGGATGCCATCACTGAAATGGATGAACATAATAGGCCCATTCACACATACCAGGTATGTAATGTAATGGAACCAAACCAAAACAACTGG
CTTCGTACAAACTGGATCTCCCGTGATGCAGCTCAGAAAATTTATGTGGAAATGAAATTCACACTAAGGGATTGTAACAGCATCCCATGG
GTCTTGGGGACTTGCAAAGAAACATTTAATCTGTTTTATATGGAATCAGATGAGTCCCACGGAATTAAATTCAAGCCAAACCAGTATACA
AAGATCGACACAATTGCTGCTGATGAGAGTTTTACCCAGATGGATTTGGGTGATCGCATCCTCAAACTCAACACTGAAATTCGTGAGGTG
GGGCCTATAGAAAGGAAAGGATTTTATCTGGCTTTTCAAGACATTGGGGCGTGCATTGCCCTGGTTTCAGTCCGTGTTTTCTACAAGAAA
TGCCCCTTCACTGTTCGTAACTTGGCCATGTTTCCTGATACCATTCCAAGGGTTGATTCCTCCTCTTTGGTTGAAGTACGGGGTTCTTGT
GTGAAGAGTGCTGAAGAGCGTGACACTCCTAAACTGTATTGTGGAGCTGATGGAGATTGGCTGGTTCCTCTTGGAAGGTGCATCTGCAGT
ACAGGATATGAAGAAATTGAGGGTTCTTGCCATGCTTGCAGACCAGGATTCTATAAAGCTTTTGCTGGGAACACAAAATGTTCTAAATGT
CCTCCACACAGTTTAACATACATGGAAGCAACTTCTGTCTGTCAGTGTGAAAAGGGTTATTTCCGAGCTGAAAAAGACCCACCTTCTATG
GCATGTACCAGGCCACCTTCAGCTCCTAGGAATGTGGTTTTTAACATCAATGAAACAGCCCTTATTTTGGAATGGAGCCCACCAAGTGAC
ACAGGAGGGAGAAAAGATCTCACATACAGTGTAATCTGTAAGAAATGTGGCTTAGACACCAGCCAGTGTGAGGACTGTGGTGGAGGACTC
CGCTTCATCCCAAGACATACAGGCCTGATCAACAATTCCGTGATAGTACTTGACTTTGTGTCTCACGTGAATTACACCTTTGAAATAGAA
GCAATGAATGGAGTTTCTGAGTTGAGTTTTTCTCCCAAGCCATTCACAGCTATTACAGTGACCACGGATCAAGATGATTTGGTGCTTCCA
GATGTGAGTTATCAGGTGGAATCCAGTGAGGAGGATCAGTCTCAGACTATGGATCCTCAAGGACAAACTCTGCTGCTTTTTCTCTTTGTG
GATTTCCACAGTGCATTTCCAGTCCAGCAAATGGAAATCTGGGGAGTCTATACTTTGCTCACAACTCATCTCAATGCCATCCTTGTGGAG
AGCCACAGTGTAGTGCAAGGTTCCATCCAATTCACTGTGGACAAGGTCTTGGAGCAACATCACCAGGCTGCCAAGGCTCAGCAGAAACTA
CAGGCCTCACTCTCAGTGGCTGTGAACTCCATCATGAGTATTCTGACTGGAAGCACTAGGAGCAGCTTCCGAAAGATGTGTCTCCAGACC
CTTCAAGCAGCTGACACACAAGAGTTCAGGACCAAACTGCACAAAGTATTTCGTGAGATCACCCAACACCAATTTCTTCACCACTGCTCA
TGTGAGGTGAAGCAGCAGCTAACCCTAGAAAAAAAGGACTCAGCCCAGGGCACTGAGGACGCACCTGATAACAGCAGCCTGGAGCTCCTA
GCAGATACCAGCGGGCAAGCAGAAAACAAGAGGCTCAAGAGGGGCAGCCCCCGCATAGAGGAGATGCGAGCTCTGCGCTCTGCCAGGGCC
CCGAGCCCGTCAGAGGCCGCCCCGCGCCGCCCGGAAGCCACCGCGGCCCCCCTCACTCCTAGAGGAAGGGAGCACCGCGAGGCTCACGGC
AGGGCCCTGGCGCCGGGCAGGGCGAGCCTCGGAAGCCGCCTGGAGGACGTGCTGTGGCTGCAGGAGGTCTCCAACCTGTCAGAGTGGCTG

>In-frame_EPHA6_ENST00000389672_chr3_96963131_+_C11orf80_ENST00000525449_chr11_66583524_+_2340nt
ATGCAATTCCCCTCGCCTCCAGCCGCGAGGAGCTCCCCGGCGCCGCAGGCAGCGTCCTCCTCCGAAGCAGCTGCACCTGCAACTGGGCAG
CCTGGACCCTCGTGCCCTGTTCCCGGGACCTCGCGCAGGGGGCGCCCCGGGACACCCCCTGCGGGCCGGGTGGAGGAGGAAGAGGAGGAG
GAGGAAGAAGACGTGGACAAGGACCCCCATCCTACCCAGAACACCTGCCTGCGCTGCCGCCACTTCTCTTTAAGGGAGAGGAAAAGAGAG
CCTAGGAGAACCATGGGGGGCTGCGAAGTCCGGGAATTTCTTTTGCAATTTGGTTTCTTCTTGCCTCTGCTGACAGCGTGGCCAGGCGAC
TGCAGTCACGTCTCCAACAACCAAGTTGTGTTGCTTGATACAACAACTGTACTGGGAGAGCTAGGATGGAAAACATATCCATTAAATGGG
TGGGATGCCATCACTGAAATGGATGAACATAATAGGCCCATTCACACATACCAGGTATGTAATGTAATGGAACCAAACCAAAACAACTGG
CTTCGTACAAACTGGATCTCCCGTGATGCAGCTCAGAAAATTTATGTGGAAATGAAATTCACACTAAGGGATTGTAACAGCATCCCATGG
GTCTTGGGGACTTGCAAAGAAACATTTAATCTGTTTTATATGGAATCAGATGAGTCCCACGGAATTAAATTCAAGCCAAACCAGTATACA
AAGATCGACACAATTGCTGCTGATGAGAGTTTTACCCAGATGGATTTGGGTGATCGCATCCTCAAACTCAACACTGAAATTCGTGAGGTG
GGGCCTATAGAAAGGAAAGGATTTTATCTGGCTTTTCAAGACATTGGGGCGTGCATTGCCCTGGTTTCAGTCCGTGTTTTCTACAAGAAA
TGCCCCTTCACTGTTCGTAACTTGGCCATGTTTCCTGATACCATTCCAAGGGTTGATTCCTCCTCTTTGGTTGAAGTACGGGGTTCTTGT
GTGAAGAGTGCTGAAGAGCGTGACACTCCTAAACTGTATTGTGGAGCTGATGGAGATTGGCTGGTTCCTCTTGGAAGGTGCATCTGCAGT
ACAGGATATGAAGAAATTGAGGGTTCTTGCCATGCTTGCAGACCAGGATTCTATAAAGCTTTTGCTGGGAACACAAAATGTTCTAAATGT
CCTCCACACAGTTTAACATACATGGAAGCAACTTCTGTCTGTCAGTGTGAAAAGGGTTATTTCCGAGCTGAAAAAGACCCACCTTCTATG
GCATGTACCAGGCCACCTTCAGCTCCTAGGAATGTGGTTTTTAACATCAATGAAACAGCCCTTATTTTGGAATGGAGCCCACCAAGTGAC
ACAGGAGGGAGAAAAGATCTCACATACAGTGTAATCTGTAAGAAATGTGGCTTAGACACCAGCCAGTGTGAGGACTGTGGTGGAGGACTC
CGCTTCATCCCAAGACATACAGGCCTGATCAACAATTCCGTGATAGTACTTGACTTTGTGTCTCACGTGAATTACACCTTTGAAATAGAA
GCAATGAATGGAGTTTCTGAGTTGAGTTTTTCTCCCAAGCCATTCACAGCTATTACAGTGACCACGGATCAAGATGATTTGGTGCTTCCA
GATGTGAGTTATCAGGTGGAATCCAGTGAGGAGGATCAGTCTCAGACTATGGATCCTCAAGGACAAACTCTGCTGCTTTTTCTCTTTGTG
GATTTCCACAGTGCATTTCCAGTCCAGCAAATGGAAATCTGGGGAGTCTATACTTTGCTCACAACTCATCTCAATGCCATCCTTGTGGAG
AGCCACAGTGTAGTGCAAGGTTCCATCCAATTCACTGTGGACAAGGTCTTGGAGCAACATCACCAGGCTGCCAAGGCAGCTGACACACAA
GAGTTCAGGACCAAACTGCACAAAGTATTTCGTGAGATCACCCAACACCAATTTCTTCACCACTGCTCATGTGAGGTGAAGCAGCAGCTA
ACCCTAGAAAAAAAGGACTCAGCCCAGGGCACTGAGGACGCACCTGATAACAGCAGCCTGGAGCTCCTAGCAGATACCAGCGGGCAAGCA
GAAAACAAGAGGCTCAAGAGGGGCAGCCCCCGCATAGAGGAGATGCGAGCTCTGCGCTCTGCCAGGGCCCCGAGCCCGTCAGAGGCCGCC
CCGCGCCGCCCGGAAGCCACCGCGGCCCCCCTCACTCCTAGAGGAAGGGAGCACCGCGAGGCTCACGGCAGGGCCCTGGCGCCGGGCAGG
GCGAGCCTCGGAAGCCGCCTGGAGGACGTGCTGTGGCTGCAGGAGGTCTCCAACCTGTCAGAGTGGCTGAGTCCCAGCCCTGGGCCCTGA


* Fusion transcript sequences (Full-length transcript).
>In-frame_EPHA6_ENST00000389672_chr3_96963131_+_C11orf80_ENST00000346672_chr11_66583524_+_2472nt
AAGTGAATAGTCCTCGCGCAAGCGGGACACTGTGGTGGATGCAATTCCCCTCGCCTCCAGCCGCGAGGAGCTCCCCGGCGCCGCAGGCAG
CGTCCTCCTCCGAAGCAGCTGCACCTGCAACTGGGCAGCCTGGACCCTCGTGCCCTGTTCCCGGGACCTCGCGCAGGGGGCGCCCCGGGA
CACCCCCTGCGGGCCGGGTGGAGGAGGAAGAGGAGGAGGAGGAAGAAGACGTGGACAAGGACCCCCATCCTACCCAGAACACCTGCCTGC
GCTGCCGCCACTTCTCTTTAAGGGAGAGGAAAAGAGAGCCTAGGAGAACCATGGGGGGCTGCGAAGTCCGGGAATTTCTTTTGCAATTTG
GTTTCTTCTTGCCTCTGCTGACAGCGTGGCCAGGCGACTGCAGTCACGTCTCCAACAACCAAGTTGTGTTGCTTGATACAACAACTGTAC
TGGGAGAGCTAGGATGGAAAACATATCCATTAAATGGGTGGGATGCCATCACTGAAATGGATGAACATAATAGGCCCATTCACACATACC
AGGTATGTAATGTAATGGAACCAAACCAAAACAACTGGCTTCGTACAAACTGGATCTCCCGTGATGCAGCTCAGAAAATTTATGTGGAAA
TGAAATTCACACTAAGGGATTGTAACAGCATCCCATGGGTCTTGGGGACTTGCAAAGAAACATTTAATCTGTTTTATATGGAATCAGATG
AGTCCCACGGAATTAAATTCAAGCCAAACCAGTATACAAAGATCGACACAATTGCTGCTGATGAGAGTTTTACCCAGATGGATTTGGGTG
ATCGCATCCTCAAACTCAACACTGAAATTCGTGAGGTGGGGCCTATAGAAAGGAAAGGATTTTATCTGGCTTTTCAAGACATTGGGGCGT
GCATTGCCCTGGTTTCAGTCCGTGTTTTCTACAAGAAATGCCCCTTCACTGTTCGTAACTTGGCCATGTTTCCTGATACCATTCCAAGGG
TTGATTCCTCCTCTTTGGTTGAAGTACGGGGTTCTTGTGTGAAGAGTGCTGAAGAGCGTGACACTCCTAAACTGTATTGTGGAGCTGATG
GAGATTGGCTGGTTCCTCTTGGAAGGTGCATCTGCAGTACAGGATATGAAGAAATTGAGGGTTCTTGCCATGCTTGCAGACCAGGATTCT
ATAAAGCTTTTGCTGGGAACACAAAATGTTCTAAATGTCCTCCACACAGTTTAACATACATGGAAGCAACTTCTGTCTGTCAGTGTGAAA
AGGGTTATTTCCGAGCTGAAAAAGACCCACCTTCTATGGCATGTACCAGGCCACCTTCAGCTCCTAGGAATGTGGTTTTTAACATCAATG
AAACAGCCCTTATTTTGGAATGGAGCCCACCAAGTGACACAGGAGGGAGAAAAGATCTCACATACAGTGTAATCTGTAAGAAATGTGGCT
TAGACACCAGCCAGTGTGAGGACTGTGGTGGAGGACTCCGCTTCATCCCAAGACATACAGGCCTGATCAACAATTCCGTGATAGTACTTG
ACTTTGTGTCTCACGTGAATTACACCTTTGAAATAGAAGCAATGAATGGAGTTTCTGAGTTGAGTTTTTCTCCCAAGCCATTCACAGCTA
TTACAGTGACCACGGATCAAGATGATTTGGTGCTTCCAGATGTGAGTTATCAGGTGGAATCCAGTGAGGAGGATCAGTCTCAGACTATGG
ATCCTCAAGGACAAACTCTGCTGCTTTTTCTCTTTGTGGATTTCCACAGTGCATTTCCAGTCCAGCAAATGGAAATCTGGGGAGTCTATA
CTTTGCTCACAACTCATCTCAATGCCATCCTTGTGGAGAGCCACAGTGTAGTGCAAGGTTCCATCCAATTCACTGTGGACAAGGTCTTGG
AGCAACATCACCAGGCTGCCAAGGCAGCTGACACACAAGAGTTCAGGACCAAACTGCACAAAGTATTTCGTGAGATCACCCAACACCAAT
TTCTTCACCACTGCTCATGTGAGGTGAAGCAGCAGCTAACCCTAGAAAAAAAGGACTCAGCCCAGGGCACTGAGGACGCACCTGATAACA
GCAGCCTGGAGCTCCTAGCAGATACCAGCGGGCAAGCAGAAAACAAGAGGCTCAAGAGGGGCAGCCCCCGCATAGAGGAGATGCGAGCTC
TGCGCTCTGCCAGGGCCCCGAGCCCGTCAGAGGCCGCCCCGCGCCGCCCGGAAGCCACCGCGGCCCCCCTCACTCCTAGAGGAAGGGAGC
ACCGCGAGGCTCACGGCAGGGCCCTGGCGCCGGGCAGGGCGAGCCTCGGAAGCCGCCTGGAGGACGTGCTGTGGCTGCAGGAGGTCTCCA
ACCTGTCAGAGTGGCTGAGTCCCAGCCCTGGGCCCTGAGCCGGGTCCCCTTCCGCAAGCGCCCACCGATCCGGAGGCTGCGGGCAGCCGT

>In-frame_EPHA6_ENST00000389672_chr3_96963131_+_C11orf80_ENST00000360962_chr11_66583524_+_2771nt
AAGTGAATAGTCCTCGCGCAAGCGGGACACTGTGGTGGATGCAATTCCCCTCGCCTCCAGCCGCGAGGAGCTCCCCGGCGCCGCAGGCAG
CGTCCTCCTCCGAAGCAGCTGCACCTGCAACTGGGCAGCCTGGACCCTCGTGCCCTGTTCCCGGGACCTCGCGCAGGGGGCGCCCCGGGA
CACCCCCTGCGGGCCGGGTGGAGGAGGAAGAGGAGGAGGAGGAAGAAGACGTGGACAAGGACCCCCATCCTACCCAGAACACCTGCCTGC
GCTGCCGCCACTTCTCTTTAAGGGAGAGGAAAAGAGAGCCTAGGAGAACCATGGGGGGCTGCGAAGTCCGGGAATTTCTTTTGCAATTTG
GTTTCTTCTTGCCTCTGCTGACAGCGTGGCCAGGCGACTGCAGTCACGTCTCCAACAACCAAGTTGTGTTGCTTGATACAACAACTGTAC
TGGGAGAGCTAGGATGGAAAACATATCCATTAAATGGGTGGGATGCCATCACTGAAATGGATGAACATAATAGGCCCATTCACACATACC
AGGTATGTAATGTAATGGAACCAAACCAAAACAACTGGCTTCGTACAAACTGGATCTCCCGTGATGCAGCTCAGAAAATTTATGTGGAAA
TGAAATTCACACTAAGGGATTGTAACAGCATCCCATGGGTCTTGGGGACTTGCAAAGAAACATTTAATCTGTTTTATATGGAATCAGATG
AGTCCCACGGAATTAAATTCAAGCCAAACCAGTATACAAAGATCGACACAATTGCTGCTGATGAGAGTTTTACCCAGATGGATTTGGGTG
ATCGCATCCTCAAACTCAACACTGAAATTCGTGAGGTGGGGCCTATAGAAAGGAAAGGATTTTATCTGGCTTTTCAAGACATTGGGGCGT
GCATTGCCCTGGTTTCAGTCCGTGTTTTCTACAAGAAATGCCCCTTCACTGTTCGTAACTTGGCCATGTTTCCTGATACCATTCCAAGGG
TTGATTCCTCCTCTTTGGTTGAAGTACGGGGTTCTTGTGTGAAGAGTGCTGAAGAGCGTGACACTCCTAAACTGTATTGTGGAGCTGATG
GAGATTGGCTGGTTCCTCTTGGAAGGTGCATCTGCAGTACAGGATATGAAGAAATTGAGGGTTCTTGCCATGCTTGCAGACCAGGATTCT
ATAAAGCTTTTGCTGGGAACACAAAATGTTCTAAATGTCCTCCACACAGTTTAACATACATGGAAGCAACTTCTGTCTGTCAGTGTGAAA
AGGGTTATTTCCGAGCTGAAAAAGACCCACCTTCTATGGCATGTACCAGGCCACCTTCAGCTCCTAGGAATGTGGTTTTTAACATCAATG
AAACAGCCCTTATTTTGGAATGGAGCCCACCAAGTGACACAGGAGGGAGAAAAGATCTCACATACAGTGTAATCTGTAAGAAATGTGGCT
TAGACACCAGCCAGTGTGAGGACTGTGGTGGAGGACTCCGCTTCATCCCAAGACATACAGGCCTGATCAACAATTCCGTGATAGTACTTG
ACTTTGTGTCTCACGTGAATTACACCTTTGAAATAGAAGCAATGAATGGAGTTTCTGAGTTGAGTTTTTCTCCCAAGCCATTCACAGCTA
TTACAGTGACCACGGATCAAGATGATTTGGTGCTTCCAGATGTGAGTTATCAGGTGGAATCCAGTGAGGAGGATCAGTCTCAGACTATGG
ATCCTCAAGGACAAACTCTGCTGCTTTTTCTCTTTGTGGATTTCCACAGTGCATTTCCAGTCCAGCAAATGGAAATCTGGGGAGTCTATA
CTTTGCTCACAACTCATCTCAATGCCATCCTTGTGGAGAGCCACAGTGTAGTGCAAGGTTCCATCCAATTCACTGTGGACAAGGTCTTGG
AGCAACATCACCAGGCTGCCAAGGCTCAGCAGAAACTACAGGCCTCACTCTCAGTGGCTGTGAACTCCATCATGAGTATTCTGACTGGAA
GCACTAGGAGCAGCTTCCGAAAGATGTGTCTCCAGACCCTTCAAGCAGCTGACACACAAGAGTTCAGGACCAAACTGCACAAAGTATTTC
GTGAGATCACCCAACACCAATTTCTTCACCACTGCTCATGTGAGGTGAAGCAGCAGCTAACCCTAGAAAAAAAGGACTCAGCCCAGGGCA
CTGAGGACGCACCTGATAACAGCAGCCTGGAGCTCCTAGCAGATACCAGCGGGCAAGCAGAAAACAAGAGGCTCAAGAGGGGCAGCCCCC
GCATAGAGGAGATGCGAGCTCTGCGCTCTGCCAGGGCCCCGAGCCCGTCAGAGGCCGCCCCGCGCCGCCCGGAAGCCACCGCGGCCCCCC
TCACTCCTAGAGGAAGGGAGCACCGCGAGGCTCACGGCAGGGCCCTGGCGCCGGGCAGGGCGAGCCTCGGAAGCCGCCTGGAGGACGTGC
TGTGGCTGCAGGAGGTCTCCAACCTGTCAGAGTGGCTGAGTCCCAGCCCTGGGCCCTGAGCCGGGTCCCCTTCCGCAAGCGCCCACCGAT
CCGGAGGCTGCGGGCAGCCGTTATCCCGTGGTTTAATAAAGCTGCCGCGCGCTCACCAAGTCCTCTTCCGCGTCTGCTTCCGCGTCGGGC
CCGGGCGGGGCGGGGCGGGGCGTGGAGCCGCGCCGCGGCCTGACGTCACCCACACCTCCCTGGGACTGCGTCACTGGTGCGCGCCGCGGG

>In-frame_EPHA6_ENST00000389672_chr3_96963131_+_C11orf80_ENST00000527634_chr11_66583524_+_2545nt
AAGTGAATAGTCCTCGCGCAAGCGGGACACTGTGGTGGATGCAATTCCCCTCGCCTCCAGCCGCGAGGAGCTCCCCGGCGCCGCAGGCAG
CGTCCTCCTCCGAAGCAGCTGCACCTGCAACTGGGCAGCCTGGACCCTCGTGCCCTGTTCCCGGGACCTCGCGCAGGGGGCGCCCCGGGA
CACCCCCTGCGGGCCGGGTGGAGGAGGAAGAGGAGGAGGAGGAAGAAGACGTGGACAAGGACCCCCATCCTACCCAGAACACCTGCCTGC
GCTGCCGCCACTTCTCTTTAAGGGAGAGGAAAAGAGAGCCTAGGAGAACCATGGGGGGCTGCGAAGTCCGGGAATTTCTTTTGCAATTTG
GTTTCTTCTTGCCTCTGCTGACAGCGTGGCCAGGCGACTGCAGTCACGTCTCCAACAACCAAGTTGTGTTGCTTGATACAACAACTGTAC
TGGGAGAGCTAGGATGGAAAACATATCCATTAAATGGGTGGGATGCCATCACTGAAATGGATGAACATAATAGGCCCATTCACACATACC
AGGTATGTAATGTAATGGAACCAAACCAAAACAACTGGCTTCGTACAAACTGGATCTCCCGTGATGCAGCTCAGAAAATTTATGTGGAAA
TGAAATTCACACTAAGGGATTGTAACAGCATCCCATGGGTCTTGGGGACTTGCAAAGAAACATTTAATCTGTTTTATATGGAATCAGATG
AGTCCCACGGAATTAAATTCAAGCCAAACCAGTATACAAAGATCGACACAATTGCTGCTGATGAGAGTTTTACCCAGATGGATTTGGGTG
ATCGCATCCTCAAACTCAACACTGAAATTCGTGAGGTGGGGCCTATAGAAAGGAAAGGATTTTATCTGGCTTTTCAAGACATTGGGGCGT
GCATTGCCCTGGTTTCAGTCCGTGTTTTCTACAAGAAATGCCCCTTCACTGTTCGTAACTTGGCCATGTTTCCTGATACCATTCCAAGGG
TTGATTCCTCCTCTTTGGTTGAAGTACGGGGTTCTTGTGTGAAGAGTGCTGAAGAGCGTGACACTCCTAAACTGTATTGTGGAGCTGATG
GAGATTGGCTGGTTCCTCTTGGAAGGTGCATCTGCAGTACAGGATATGAAGAAATTGAGGGTTCTTGCCATGCTTGCAGACCAGGATTCT
ATAAAGCTTTTGCTGGGAACACAAAATGTTCTAAATGTCCTCCACACAGTTTAACATACATGGAAGCAACTTCTGTCTGTCAGTGTGAAA
AGGGTTATTTCCGAGCTGAAAAAGACCCACCTTCTATGGCATGTACCAGGCCACCTTCAGCTCCTAGGAATGTGGTTTTTAACATCAATG
AAACAGCCCTTATTTTGGAATGGAGCCCACCAAGTGACACAGGAGGGAGAAAAGATCTCACATACAGTGTAATCTGTAAGAAATGTGGCT
TAGACACCAGCCAGTGTGAGGACTGTGGTGGAGGACTCCGCTTCATCCCAAGACATACAGGCCTGATCAACAATTCCGTGATAGTACTTG
ACTTTGTGTCTCACGTGAATTACACCTTTGAAATAGAAGCAATGAATGGAGTTTCTGAGTTGAGTTTTTCTCCCAAGCCATTCACAGCTA
TTACAGTGACCACGGATCAAGATGATTTGGTGCTTCCAGATGTGAGTTATCAGGTGGAATCCAGTGAGGAGGATCAGTCTCAGACTATGG
ATCCTCAAGGACAAACTCTGCTGCTTTTTCTCTTTGTGGATTTCCACAGTGCATTTCCAGTCCAGCAAATGGAAATCTGGGGAGTCTATA
CTTTGCTCACAACTCATCTCAATGCCATCCTTGTGGAGAGCCACAGTGTAGTGCAAGGTTCCATCCAATTCACTGTGGACAAGGTCTTGG
AGCAACATCACCAGGCTGCCAAGGCTCAGCAGAAACTACAGGCCTCACTCTCAGTGGCTGTGAACTCCATCATGAGTATTCTGACTGGAA
GCACTAGGAGCAGCTTCCGAAAGATGTGTCTCCAGACCCTTCAAGCAGCTGACACACAAGAGTTCAGGACCAAACTGCACAAAGTATTTC
GTGAGATCACCCAACACCAATTTCTTCACCACTGCTCATGTGAGGTGAAGCAGCAGCTAACCCTAGAAAAAAAGGACTCAGCCCAGGGCA
CTGAGGACGCACCTGATAACAGCAGCCTGGAGCTCCTAGCAGATACCAGCGGGCAAGCAGAAAACAAGAGGCTCAAGAGGGGCAGCCCCC
GCATAGAGGAGATGCGAGCTCTGCGCTCTGCCAGGGCCCCGAGCCCGTCAGAGGCCGCCCCGCGCCGCCCGGAAGCCACCGCGGCCCCCC
TCACTCCTAGAGGAAGGGAGCACCGCGAGGCTCACGGCAGGGCCCTGGCGCCGGGCAGGGCGAGCCTCGGAAGCCGCCTGGAGGACGTGC
TGTGGCTGCAGGAGGTCTCCAACCTGTCAGAGTGGCTGAGTCCCAGCCCTGGGCCCTGAGCCGGGTCCCCTTCCGCAAGCGCCCACCGAT

>In-frame_EPHA6_ENST00000389672_chr3_96963131_+_C11orf80_ENST00000540737_chr11_66583524_+_2574nt
AAGTGAATAGTCCTCGCGCAAGCGGGACACTGTGGTGGATGCAATTCCCCTCGCCTCCAGCCGCGAGGAGCTCCCCGGCGCCGCAGGCAG
CGTCCTCCTCCGAAGCAGCTGCACCTGCAACTGGGCAGCCTGGACCCTCGTGCCCTGTTCCCGGGACCTCGCGCAGGGGGCGCCCCGGGA
CACCCCCTGCGGGCCGGGTGGAGGAGGAAGAGGAGGAGGAGGAAGAAGACGTGGACAAGGACCCCCATCCTACCCAGAACACCTGCCTGC
GCTGCCGCCACTTCTCTTTAAGGGAGAGGAAAAGAGAGCCTAGGAGAACCATGGGGGGCTGCGAAGTCCGGGAATTTCTTTTGCAATTTG
GTTTCTTCTTGCCTCTGCTGACAGCGTGGCCAGGCGACTGCAGTCACGTCTCCAACAACCAAGTTGTGTTGCTTGATACAACAACTGTAC
TGGGAGAGCTAGGATGGAAAACATATCCATTAAATGGGTGGGATGCCATCACTGAAATGGATGAACATAATAGGCCCATTCACACATACC
AGGTATGTAATGTAATGGAACCAAACCAAAACAACTGGCTTCGTACAAACTGGATCTCCCGTGATGCAGCTCAGAAAATTTATGTGGAAA
TGAAATTCACACTAAGGGATTGTAACAGCATCCCATGGGTCTTGGGGACTTGCAAAGAAACATTTAATCTGTTTTATATGGAATCAGATG
AGTCCCACGGAATTAAATTCAAGCCAAACCAGTATACAAAGATCGACACAATTGCTGCTGATGAGAGTTTTACCCAGATGGATTTGGGTG
ATCGCATCCTCAAACTCAACACTGAAATTCGTGAGGTGGGGCCTATAGAAAGGAAAGGATTTTATCTGGCTTTTCAAGACATTGGGGCGT
GCATTGCCCTGGTTTCAGTCCGTGTTTTCTACAAGAAATGCCCCTTCACTGTTCGTAACTTGGCCATGTTTCCTGATACCATTCCAAGGG
TTGATTCCTCCTCTTTGGTTGAAGTACGGGGTTCTTGTGTGAAGAGTGCTGAAGAGCGTGACACTCCTAAACTGTATTGTGGAGCTGATG
GAGATTGGCTGGTTCCTCTTGGAAGGTGCATCTGCAGTACAGGATATGAAGAAATTGAGGGTTCTTGCCATGCTTGCAGACCAGGATTCT
ATAAAGCTTTTGCTGGGAACACAAAATGTTCTAAATGTCCTCCACACAGTTTAACATACATGGAAGCAACTTCTGTCTGTCAGTGTGAAA
AGGGTTATTTCCGAGCTGAAAAAGACCCACCTTCTATGGCATGTACCAGGCCACCTTCAGCTCCTAGGAATGTGGTTTTTAACATCAATG
AAACAGCCCTTATTTTGGAATGGAGCCCACCAAGTGACACAGGAGGGAGAAAAGATCTCACATACAGTGTAATCTGTAAGAAATGTGGCT
TAGACACCAGCCAGTGTGAGGACTGTGGTGGAGGACTCCGCTTCATCCCAAGACATACAGGCCTGATCAACAATTCCGTGATAGTACTTG
ACTTTGTGTCTCACGTGAATTACACCTTTGAAATAGAAGCAATGAATGGAGTTTCTGAGTTGAGTTTTTCTCCCAAGCCATTCACAGCTA
TTACAGTGACCACGGATCAAGATGATTTGGTGCTTCCAGATGTGAGTTATCAGGTGGAATCCAGTGAGGAGGATCAGTCTCAGACTATGG
ATCCTCAAGGACAAACTCTGCTGCTTTTTCTCTTTGTGGATTTCCACAGTGCATTTCCAGTCCAGCAAATGGAAATCTGGGGAGTCTATA
CTTTGCTCACAACTCATCTCAATGCCATCCTTGTGGAGAGCCACAGTGTAGTGCAAGGTTCCATCCAATTCACTGTGGACAAGGTCTTGG
AGCAACATCACCAGGCTGCCAAGGCTCAGCAGAAACTACAGGCCTCACTCTCAGTGGCTGTGAACTCCATCATGAGTATTCTGACTGGAA
GCACTAGGAGCAGCTTCCGAAAGATGTGTCTCCAGACCCTTCAAGCAGCTGACACACAAGAGTTCAGGACCAAACTGCACAAAGTATTTC
GTGAGATCACCCAACACCAATTTCTTCACCACTGCTCATGTGAGGTGAAGCAGCTAACCCTAGAAAAAAAGGACTCAGCCCAGGGCACTG
AGGACGCACCTGATAACAGCAGCCTGGAGCTCCTAGCAGATACCAGCGGGCAAGCAGAAAACAAGAGGCTCAAGAGGGGCAGCCCCCGCA
TAGAGGAGATGCGAGCTCTGCGCTCTGCCAGGGCCCCGAGCCCGTCAGAGGCCGCCCCGCGCCGCCCGGAAGCCACCGCGGCCCCCCTCA
CTCCTAGAGGAAGGGAGCACCGCGAGGCTCACGGCAGGGCCCTGGCGCCGGGCAGGGCGAGCCTCGGAAGCCGCCTGGAGGACGTGCTGT
GGCTGCAGGAGGTCTCCAACCTGTCAGAGTGGCTGAGTCCCAGCCCTGGGCCCTGAGCCGGGTCCCCTTCCGCAAGCGCCCACCGATCCG

>In-frame_EPHA6_ENST00000389672_chr3_96963131_+_C11orf80_ENST00000532565_chr11_66583524_+_2545nt
AAGTGAATAGTCCTCGCGCAAGCGGGACACTGTGGTGGATGCAATTCCCCTCGCCTCCAGCCGCGAGGAGCTCCCCGGCGCCGCAGGCAG
CGTCCTCCTCCGAAGCAGCTGCACCTGCAACTGGGCAGCCTGGACCCTCGTGCCCTGTTCCCGGGACCTCGCGCAGGGGGCGCCCCGGGA
CACCCCCTGCGGGCCGGGTGGAGGAGGAAGAGGAGGAGGAGGAAGAAGACGTGGACAAGGACCCCCATCCTACCCAGAACACCTGCCTGC
GCTGCCGCCACTTCTCTTTAAGGGAGAGGAAAAGAGAGCCTAGGAGAACCATGGGGGGCTGCGAAGTCCGGGAATTTCTTTTGCAATTTG
GTTTCTTCTTGCCTCTGCTGACAGCGTGGCCAGGCGACTGCAGTCACGTCTCCAACAACCAAGTTGTGTTGCTTGATACAACAACTGTAC
TGGGAGAGCTAGGATGGAAAACATATCCATTAAATGGGTGGGATGCCATCACTGAAATGGATGAACATAATAGGCCCATTCACACATACC
AGGTATGTAATGTAATGGAACCAAACCAAAACAACTGGCTTCGTACAAACTGGATCTCCCGTGATGCAGCTCAGAAAATTTATGTGGAAA
TGAAATTCACACTAAGGGATTGTAACAGCATCCCATGGGTCTTGGGGACTTGCAAAGAAACATTTAATCTGTTTTATATGGAATCAGATG
AGTCCCACGGAATTAAATTCAAGCCAAACCAGTATACAAAGATCGACACAATTGCTGCTGATGAGAGTTTTACCCAGATGGATTTGGGTG
ATCGCATCCTCAAACTCAACACTGAAATTCGTGAGGTGGGGCCTATAGAAAGGAAAGGATTTTATCTGGCTTTTCAAGACATTGGGGCGT
GCATTGCCCTGGTTTCAGTCCGTGTTTTCTACAAGAAATGCCCCTTCACTGTTCGTAACTTGGCCATGTTTCCTGATACCATTCCAAGGG
TTGATTCCTCCTCTTTGGTTGAAGTACGGGGTTCTTGTGTGAAGAGTGCTGAAGAGCGTGACACTCCTAAACTGTATTGTGGAGCTGATG
GAGATTGGCTGGTTCCTCTTGGAAGGTGCATCTGCAGTACAGGATATGAAGAAATTGAGGGTTCTTGCCATGCTTGCAGACCAGGATTCT
ATAAAGCTTTTGCTGGGAACACAAAATGTTCTAAATGTCCTCCACACAGTTTAACATACATGGAAGCAACTTCTGTCTGTCAGTGTGAAA
AGGGTTATTTCCGAGCTGAAAAAGACCCACCTTCTATGGCATGTACCAGGCCACCTTCAGCTCCTAGGAATGTGGTTTTTAACATCAATG
AAACAGCCCTTATTTTGGAATGGAGCCCACCAAGTGACACAGGAGGGAGAAAAGATCTCACATACAGTGTAATCTGTAAGAAATGTGGCT
TAGACACCAGCCAGTGTGAGGACTGTGGTGGAGGACTCCGCTTCATCCCAAGACATACAGGCCTGATCAACAATTCCGTGATAGTACTTG
ACTTTGTGTCTCACGTGAATTACACCTTTGAAATAGAAGCAATGAATGGAGTTTCTGAGTTGAGTTTTTCTCCCAAGCCATTCACAGCTA
TTACAGTGACCACGGATCAAGATGATTTGGTGCTTCCAGATGTGAGTTATCAGGTGGAATCCAGTGAGGAGGATCAGTCTCAGACTATGG
ATCCTCAAGGACAAACTCTGCTGCTTTTTCTCTTTGTGGATTTCCACAGTGCATTTCCAGTCCAGCAAATGGAAATCTGGGGAGTCTATA
CTTTGCTCACAACTCATCTCAATGCCATCCTTGTGGAGAGCCACAGTGTAGTGCAAGGTTCCATCCAATTCACTGTGGACAAGGTCTTGG
AGCAACATCACCAGGCTGCCAAGGCTCAGCAGAAACTACAGGCCTCACTCTCAGTGGCTGTGAACTCCATCATGAGTATTCTGACTGGAA
GCACTAGGAGCAGCTTCCGAAAGATGTGTCTCCAGACCCTTCAAGCAGCTGACACACAAGAGTTCAGGACCAAACTGCACAAAGTATTTC
GTGAGATCACCCAACACCAATTTCTTCACCACTGCTCATGTGAGGTGAAGCAGCAGCTAACCCTAGAAAAAAAGGACTCAGCCCAGGGCA
CTGAGGACGCACCTGATAACAGCAGCCTGGAGCTCCTAGCAGATACCAGCGGGCAAGCAGAAAACAAGAGGCTCAAGAGGGGCAGCCCCC
GCATAGAGGAGATGCGAGCTCTGCGCTCTGCCAGGGCCCCGAGCCCGTCAGAGGCCGCCCCGCGCCGCCCGGAAGCCACCGCGGCCCCCC
TCACTCCTAGAGGAAGGGAGCACCGCGAGGCTCACGGCAGGGCCCTGGCGCCGGGCAGGGCGAGCCTCGGAAGCCGCCTGGAGGACGTGC
TGTGGCTGCAGGAGGTCTCCAACCTGTCAGAGTGGCTGAGTCCCAGCCCTGGGCCCTGAGCCGGGTCCCCTTCCGCAAGCGCCCACCGAT

>In-frame_EPHA6_ENST00000389672_chr3_96963131_+_C11orf80_ENST00000525449_chr11_66583524_+_2468nt
AAGTGAATAGTCCTCGCGCAAGCGGGACACTGTGGTGGATGCAATTCCCCTCGCCTCCAGCCGCGAGGAGCTCCCCGGCGCCGCAGGCAG
CGTCCTCCTCCGAAGCAGCTGCACCTGCAACTGGGCAGCCTGGACCCTCGTGCCCTGTTCCCGGGACCTCGCGCAGGGGGCGCCCCGGGA
CACCCCCTGCGGGCCGGGTGGAGGAGGAAGAGGAGGAGGAGGAAGAAGACGTGGACAAGGACCCCCATCCTACCCAGAACACCTGCCTGC
GCTGCCGCCACTTCTCTTTAAGGGAGAGGAAAAGAGAGCCTAGGAGAACCATGGGGGGCTGCGAAGTCCGGGAATTTCTTTTGCAATTTG
GTTTCTTCTTGCCTCTGCTGACAGCGTGGCCAGGCGACTGCAGTCACGTCTCCAACAACCAAGTTGTGTTGCTTGATACAACAACTGTAC
TGGGAGAGCTAGGATGGAAAACATATCCATTAAATGGGTGGGATGCCATCACTGAAATGGATGAACATAATAGGCCCATTCACACATACC
AGGTATGTAATGTAATGGAACCAAACCAAAACAACTGGCTTCGTACAAACTGGATCTCCCGTGATGCAGCTCAGAAAATTTATGTGGAAA
TGAAATTCACACTAAGGGATTGTAACAGCATCCCATGGGTCTTGGGGACTTGCAAAGAAACATTTAATCTGTTTTATATGGAATCAGATG
AGTCCCACGGAATTAAATTCAAGCCAAACCAGTATACAAAGATCGACACAATTGCTGCTGATGAGAGTTTTACCCAGATGGATTTGGGTG
ATCGCATCCTCAAACTCAACACTGAAATTCGTGAGGTGGGGCCTATAGAAAGGAAAGGATTTTATCTGGCTTTTCAAGACATTGGGGCGT
GCATTGCCCTGGTTTCAGTCCGTGTTTTCTACAAGAAATGCCCCTTCACTGTTCGTAACTTGGCCATGTTTCCTGATACCATTCCAAGGG
TTGATTCCTCCTCTTTGGTTGAAGTACGGGGTTCTTGTGTGAAGAGTGCTGAAGAGCGTGACACTCCTAAACTGTATTGTGGAGCTGATG
GAGATTGGCTGGTTCCTCTTGGAAGGTGCATCTGCAGTACAGGATATGAAGAAATTGAGGGTTCTTGCCATGCTTGCAGACCAGGATTCT
ATAAAGCTTTTGCTGGGAACACAAAATGTTCTAAATGTCCTCCACACAGTTTAACATACATGGAAGCAACTTCTGTCTGTCAGTGTGAAA
AGGGTTATTTCCGAGCTGAAAAAGACCCACCTTCTATGGCATGTACCAGGCCACCTTCAGCTCCTAGGAATGTGGTTTTTAACATCAATG
AAACAGCCCTTATTTTGGAATGGAGCCCACCAAGTGACACAGGAGGGAGAAAAGATCTCACATACAGTGTAATCTGTAAGAAATGTGGCT
TAGACACCAGCCAGTGTGAGGACTGTGGTGGAGGACTCCGCTTCATCCCAAGACATACAGGCCTGATCAACAATTCCGTGATAGTACTTG
ACTTTGTGTCTCACGTGAATTACACCTTTGAAATAGAAGCAATGAATGGAGTTTCTGAGTTGAGTTTTTCTCCCAAGCCATTCACAGCTA
TTACAGTGACCACGGATCAAGATGATTTGGTGCTTCCAGATGTGAGTTATCAGGTGGAATCCAGTGAGGAGGATCAGTCTCAGACTATGG
ATCCTCAAGGACAAACTCTGCTGCTTTTTCTCTTTGTGGATTTCCACAGTGCATTTCCAGTCCAGCAAATGGAAATCTGGGGAGTCTATA
CTTTGCTCACAACTCATCTCAATGCCATCCTTGTGGAGAGCCACAGTGTAGTGCAAGGTTCCATCCAATTCACTGTGGACAAGGTCTTGG
AGCAACATCACCAGGCTGCCAAGGCAGCTGACACACAAGAGTTCAGGACCAAACTGCACAAAGTATTTCGTGAGATCACCCAACACCAAT
TTCTTCACCACTGCTCATGTGAGGTGAAGCAGCAGCTAACCCTAGAAAAAAAGGACTCAGCCCAGGGCACTGAGGACGCACCTGATAACA
GCAGCCTGGAGCTCCTAGCAGATACCAGCGGGCAAGCAGAAAACAAGAGGCTCAAGAGGGGCAGCCCCCGCATAGAGGAGATGCGAGCTC
TGCGCTCTGCCAGGGCCCCGAGCCCGTCAGAGGCCGCCCCGCGCCGCCCGGAAGCCACCGCGGCCCCCCTCACTCCTAGAGGAAGGGAGC
ACCGCGAGGCTCACGGCAGGGCCCTGGCGCCGGGCAGGGCGAGCCTCGGAAGCCGCCTGGAGGACGTGCTGTGGCTGCAGGAGGTCTCCA
ACCTGTCAGAGTGGCTGAGTCCCAGCCCTGGGCCCTGAGCCGGGTCCCCTTCCGCAAGCGCCCACCGATCCGGAGGCTGCGGGCAGCCGT


Top

FusionGenePPI for EPHA6_C11orf80


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
EPHA6GPHA2, PROC, DEFA5C11orf80


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for EPHA6_C11orf80


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for EPHA6_C11orf80


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource