FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 11440

FusionGeneSummary for ELL_KMT2A

check button Fusion gene summary
Fusion gene informationFusion gene name: ELL_KMT2A
Fusion gene ID: 11440
HgeneTgene
Gene symbol

ELL

KMT2A

Gene ID

8178

4297

Gene nameelongation factor for RNA polymerase IIlysine methyltransferase 2A
SynonymsC19orf17|ELL1|MEN|PPP1R68ALL-1|CXXC7|HRX|HTRX1|MLL|MLL1|MLL1A|TRX1|WDSTS
Cytomap

19p13.11

11q23.3

Type of geneprotein-codingprotein-coding
DescriptionRNA polymerase II elongation factor ELLELL gene (11-19 lysine-rich leukemia gene)eleven-nineteen lysine-rich leukemia proteinelongation factor RNA polymerase IIprotein phosphatase 1, regulatory subunit 68histone-lysine N-methyltransferase 2ACXXC-type zinc finger protein 7lysine (K)-specific methyltransferase 2Alysine N-methyltransferase 2Amixed lineage leukemia 1myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila)trithorax-like
Modification date2018051920180519
UniProtAcc

P55199

Q03164

Ensembl transtripts involved in fusion geneENST00000262809, ENST00000596124, 
ENST00000534358, ENST00000389506, 
ENST00000354520, ENST00000420751, 
Fusion gene scores* DoF score14 X 8 X 11=123215 X 40 X 1=600
# samples 1658
** MAII scorelog2(16/1232*10)=-2.94485844580754
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(58/600*10)=-0.0489096004809464
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: ELL [Title/Abstract] AND KMT2A [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
Transcription factor involved fusion gene, inframe and retained DNA-binding domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneELL

GO:0010923

negative regulation of phosphatase activity

19389623

TgeneKMT2A

GO:0045944

positive regulation of transcription by RNA polymerase II

20861184

TgeneKMT2A

GO:0051568

histone H3-K4 methylation

19556245

TgeneKMT2A

GO:0065003

protein-containing complex assembly

15199122

TgeneKMT2A

GO:0080182

histone H3-K4 trimethylation

20861184


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
ChiTaRS3.1DQ437655ELLchr19

18632731

-KMT2Achr11

118359327

+
ChiTaRS3.1DQ437653ELLchr19

18617518

-KMT2Achr11

118358209

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000262809ENST00000534358ELLchr19

18632731

-KMT2Achr11

118359327

+
In-frameENST00000262809ENST00000389506ELLchr19

18632731

-KMT2Achr11

118359327

+
In-frameENST00000262809ENST00000354520ELLchr19

18632731

-KMT2Achr11

118359327

+
5CDS-intronENST00000262809ENST00000420751ELLchr19

18632731

-KMT2Achr11

118359327

+
intron-3CDSENST00000596124ENST00000534358ELLchr19

18632731

-KMT2Achr11

118359327

+
intron-3CDSENST00000596124ENST00000389506ELLchr19

18632731

-KMT2Achr11

118359327

+
intron-3CDSENST00000596124ENST00000354520ELLchr19

18632731

-KMT2Achr11

118359327

+
intron-intronENST00000596124ENST00000420751ELLchr19

18632731

-KMT2Achr11

118359327

+
intron-intronENST00000262809ENST00000534358ELLchr19

18617518

-KMT2Achr11

118358209

+
intron-intronENST00000262809ENST00000389506ELLchr19

18617518

-KMT2Achr11

118358209

+
intron-intronENST00000262809ENST00000354520ELLchr19

18617518

-KMT2Achr11

118358209

+
intron-intronENST00000262809ENST00000420751ELLchr19

18617518

-KMT2Achr11

118358209

+
intron-intronENST00000596124ENST00000534358ELLchr19

18617518

-KMT2Achr11

118358209

+
intron-intronENST00000596124ENST00000389506ELLchr19

18617518

-KMT2Achr11

118358209

+
intron-intronENST00000596124ENST00000354520ELLchr19

18617518

-KMT2Achr11

118358209

+
intron-intronENST00000596124ENST00000420751ELLchr19

18617518

-KMT2Achr11

118358209

+

Top

FusionProtFeatures for ELL_KMT2A


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
ELL

P55199

KMT2A

Q03164

Elongation factor component of the super elongationcomplex (SEC), a complex required to increase the catalytic rateof RNA polymerase II transcription by suppressing transientpausing by the polymerase at multiple sites along the DNA.Elongation factor component of the little elongation complex(LEC), a complex required to regulate small nuclear RNA (snRNA)gene transcription by RNA polymerase II and III (PubMed:22195968,PubMed:23932780). Specifically required for stimulating theelongation step of RNA polymerase II- and III-dependent snRNA genetranscription (PubMed:23932780). ELL also plays an early rolebefore its assembly into in the SEC complex by stabilizing RNApolymerase II recruitment/initiation and entry into the pausesite. Required to stabilize the pre-initiation complex and earlyelongation. {ECO:0000269|PubMed:16006523,ECO:0000269|PubMed:20159561, ECO:0000269|PubMed:20471948,ECO:0000269|PubMed:22195968, ECO:0000269|PubMed:22252557,ECO:0000269|PubMed:23932780, ECO:0000269|PubMed:8596958}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneKMT2Achr19:18632731chr11:118359327ENST00000354520+8351703_174814063932DomainBromo%3B divergent
TgeneKMT2Achr19:18632731chr11:118359327ENST00000354520+8352018_207414063932DomainFYR N-terminal
TgeneKMT2Achr19:18632731chr11:118359327ENST00000354520+8353666_374714063932DomainFYR C-terminal
TgeneKMT2Achr19:18632731chr11:118359327ENST00000354520+8353829_394514063932DomainSET
TgeneKMT2Achr19:18632731chr11:118359327ENST00000354520+8353953_396914063932DomainPost-SET
TgeneKMT2Achr19:18632731chr11:118359327ENST00000389506+9361703_174814443970DomainBromo%3B divergent
TgeneKMT2Achr19:18632731chr11:118359327ENST00000389506+9362018_207414443970DomainFYR N-terminal
TgeneKMT2Achr19:18632731chr11:118359327ENST00000389506+9363666_374714443970DomainFYR C-terminal
TgeneKMT2Achr19:18632731chr11:118359327ENST00000389506+9363829_394514443970DomainSET
TgeneKMT2Achr19:18632731chr11:118359327ENST00000389506+9363953_396914443970DomainPost-SET
TgeneKMT2Achr19:18632731chr11:118359327ENST00000534358+9361703_174814443973DomainBromo%3B divergent
TgeneKMT2Achr19:18632731chr11:118359327ENST00000534358+9362018_207414443973DomainFYR N-terminal
TgeneKMT2Achr19:18632731chr11:118359327ENST00000534358+9363666_374714443973DomainFYR C-terminal
TgeneKMT2Achr19:18632731chr11:118359327ENST00000534358+9363829_394514443973DomainSET
TgeneKMT2Achr19:18632731chr11:118359327ENST00000534358+9363953_396914443973DomainPost-SET
TgeneKMT2Achr19:18632731chr11:118359327ENST00000354520+8353906_390714063932RegionS-adenosyl-L-methionine binding
TgeneKMT2Achr19:18632731chr11:118359327ENST00000389506+9363906_390714443970RegionS-adenosyl-L-methionine binding
TgeneKMT2Achr19:18632731chr11:118359327ENST00000534358+9363906_390714443973RegionS-adenosyl-L-methionine binding
TgeneKMT2Achr19:18632731chr11:118359327ENST00000354520+8351431_148214063932Zinc fingerPHD-type 1
TgeneKMT2Achr19:18632731chr11:118359327ENST00000354520+8351479_153314063932Zinc fingerPHD-type 2
TgeneKMT2Achr19:18632731chr11:118359327ENST00000354520+8351566_162714063932Zinc fingerPHD-type 3
TgeneKMT2Achr19:18632731chr11:118359327ENST00000354520+8351870_191014063932Zinc fingerC2HC pre-PHD-type
TgeneKMT2Achr19:18632731chr11:118359327ENST00000354520+8351931_197814063932Zinc fingerPHD-type 4
TgeneKMT2Achr19:18632731chr11:118359327ENST00000389506+9361479_153314443970Zinc fingerPHD-type 2
TgeneKMT2Achr19:18632731chr11:118359327ENST00000389506+9361566_162714443970Zinc fingerPHD-type 3
TgeneKMT2Achr19:18632731chr11:118359327ENST00000389506+9361870_191014443970Zinc fingerC2HC pre-PHD-type
TgeneKMT2Achr19:18632731chr11:118359327ENST00000389506+9361931_197814443970Zinc fingerPHD-type 4
TgeneKMT2Achr19:18632731chr11:118359327ENST00000534358+9361479_153314443973Zinc fingerPHD-type 2
TgeneKMT2Achr19:18632731chr11:118359327ENST00000534358+9361566_162714443973Zinc fingerPHD-type 3
TgeneKMT2Achr19:18632731chr11:118359327ENST00000534358+9361870_191014443973Zinc fingerC2HC pre-PHD-type
TgeneKMT2Achr19:18632731chr11:118359327ENST00000534358+9361931_197814443973Zinc fingerPHD-type 4

- In-frame and not-retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneELLchr19:18632731chr11:118359327ENST00000262809-112445_45945622MotifNuclear localization signal
TgeneKMT2Achr19:18632731chr11:118359327ENST00000354520+835137_14314063932Compositional biasNote=Poly-Gly
TgeneKMT2Achr19:18632731chr11:118359327ENST00000354520+83517_10214063932Compositional biasNote=Ala/Gly/Ser-rich
TgeneKMT2Achr19:18632731chr11:118359327ENST00000354520+835561_56414063932Compositional biasNote=Poly-Pro
TgeneKMT2Achr19:18632731chr11:118359327ENST00000354520+835568_57114063932Compositional biasNote=Poly-Pro
TgeneKMT2Achr19:18632731chr11:118359327ENST00000389506+936137_14314443970Compositional biasNote=Poly-Gly
TgeneKMT2Achr19:18632731chr11:118359327ENST00000389506+93617_10214443970Compositional biasNote=Ala/Gly/Ser-rich
TgeneKMT2Achr19:18632731chr11:118359327ENST00000389506+936561_56414443970Compositional biasNote=Poly-Pro
TgeneKMT2Achr19:18632731chr11:118359327ENST00000389506+936568_57114443970Compositional biasNote=Poly-Pro
TgeneKMT2Achr19:18632731chr11:118359327ENST00000534358+936137_14314443973Compositional biasNote=Poly-Gly
TgeneKMT2Achr19:18632731chr11:118359327ENST00000534358+93617_10214443973Compositional biasNote=Ala/Gly/Ser-rich
TgeneKMT2Achr19:18632731chr11:118359327ENST00000534358+936561_56414443973Compositional biasNote=Poly-Pro
TgeneKMT2Achr19:18632731chr11:118359327ENST00000534358+936568_57114443973Compositional biasNote=Poly-Pro
TgeneKMT2Achr19:18632731chr11:118359327ENST00000354520+835169_18014063932DNA bindingNote=A.T hook 1
TgeneKMT2Achr19:18632731chr11:118359327ENST00000354520+835217_22714063932DNA bindingNote=A.T hook 2
TgeneKMT2Achr19:18632731chr11:118359327ENST00000354520+835301_30914063932DNA bindingNote=A.T hook 3
TgeneKMT2Achr19:18632731chr11:118359327ENST00000389506+936169_18014443970DNA bindingNote=A.T hook 1
TgeneKMT2Achr19:18632731chr11:118359327ENST00000389506+936217_22714443970DNA bindingNote=A.T hook 2
TgeneKMT2Achr19:18632731chr11:118359327ENST00000389506+936301_30914443970DNA bindingNote=A.T hook 3
TgeneKMT2Achr19:18632731chr11:118359327ENST00000534358+936169_18014443973DNA bindingNote=A.T hook 1
TgeneKMT2Achr19:18632731chr11:118359327ENST00000534358+936217_22714443973DNA bindingNote=A.T hook 2
TgeneKMT2Achr19:18632731chr11:118359327ENST00000534358+936301_30914443973DNA bindingNote=A.T hook 3
TgeneKMT2Achr19:18632731chr11:118359327ENST00000354520+8351147_119514063932Zinc fingerCXXC-type
TgeneKMT2Achr19:18632731chr11:118359327ENST00000389506+9361147_119514443970Zinc fingerCXXC-type
TgeneKMT2Achr19:18632731chr11:118359327ENST00000389506+9361431_148214443970Zinc fingerPHD-type 1
TgeneKMT2Achr19:18632731chr11:118359327ENST00000534358+9361147_119514443973Zinc fingerCXXC-type
TgeneKMT2Achr19:18632731chr11:118359327ENST00000534358+9361431_148214443973Zinc fingerPHD-type 1


Top

FusionGeneSequence for ELL_KMT2A


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_ELL_ENST00000262809_chr19_18632731_-_KMT2A_ENST00000534358_chr11_118359327_+_2574aa
MAALKEDRSYGLSCGRVSDGSKVSVFHVKLTDSALRAFESYRARQFVTCQVCCEPFHKFCLEENERPLEDQLENWCCRRCKFCHVCGRQH
QATKQLLECNKCRNSTHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGSTTPGKGWDAQWSHDFSLCHDCAKLFAKGNFCPLCDKCTDDD
DTESKMMQCGKCDRWVHSKCENLSGTEDEMTEILSNLPESVAYTCVNCTERHPAEWRLALEKELQISLKQVLTALLNSRTTSHLLRYRQA
AKPPDLNPETEESIPSRSSPEGPDPPVLTEVSKQDDQQPLDLEGVKRKMDQGNYTSVLEFSDDIVKIIQAAINSDGGQPEIKKANSMVKS
FFIRQMERVFPWFSVKKSRFWEPNKVSSNSGMLPNAVLPPSLDHNTAQWQEREENSHTEQPPLMKKIIPAPKPKGPGEPDSPTPLHPPTP
PILSTDRSREDSPELNPPPGIEDNRQCALCLTTGDDSANDAGRLLTIGQNEWTHVNCALWSAEVFEDDDGSLKNVHMAVIRGKQLRCEFC
QKPGATVGCCLTSCTSNTHFMCSRAKNCVFLDDKKVTCQRHRDLIKGEVVPENGFEVFRRVFVDFEGISLRRKFLNGLEPENIHMMIGSM
TIDCLGILNDLSDCEDKLFPIGTQCSRVYWSTTDARKRCVTTCKIVECRPPVVEPDINSTVEHDENRTIAHSPTSFTESSSKESQNTAEI
ISPPSPDRPPHSQTSGSCTTHVISKVPRIRTPSTSPTQRSPGCRPLPSAGSPTPTTHEIVTVGDPLLSSGLRSIGSRRHSTSSLSPQRSK
LRIMSPMRTGNTYSRNNVSSVSTTGTATDLESSAKVVDHVLGPLNSSTSLGQNTSTSSNLQRTVVTVGNKNSHLDGSSSSEMKQSSASDL
VSKSSSLKGEKTKVLSSKSSEGSAHNVAYPGIPKLAPQVHNTTSRELNVSKIGSFAEPSSVSFSSKEALSFPHLHLRGQRNDRDQHTDST
QSANSSPDEDTEVKTLKLSGMSNRSSIINEHMGSSSRDRRQKGKKSCKETFKEKHSSKSFLEPGQVTTGEEGNLKPEFMDEVLTPETMGQ
RPCNNVSSDKIGDKGLSMPGVPKAPPMQVEGSAKELQAPRKRTVKVTLTPLKMENESQSKNALKESSPASPLQIESTSPTEPISASENPG
DGPVAQPSPNNTSCQDSQSNNTQNLPVQDRNLMLPDGPKPQEDGSFKRRTPRRSARARSNMFFGLTPLTGVRSTGEEDIPFYSSSTGKKR
GKRSAEGQVDGADDLSTSDEDDLYTYNFTRTVISSGGEERLASHNLFREEEQCDLPKISQLDGVDDGTESDTSVTATTRKSSQIPKRNGK
ENGTENLKIDRPEDAGEKEHVTKSSVGHKNEPKMDNCHSVSRVKTQGQDSLEAQLSSLESSRRVHTSTPSDKNLLDTTNTELLKSDSDNN
NSDDCGNILPSDIMDFVLKNTPSMQALGESPESSSSELLNLGEGLGLDSNREKDMGLFEVFSQQLPTTEPVDSSVSSSISAEEQFELPLE
LPSDLSVLTTRSPTVPSQNPSRLAVISDSGEKRVTITEKSVASSESDPALLSPGVDPTPEGHMTPDHFIQGHMDADHISSPPCGSVEQGH
GNNQDLTRNSSTPGLQVPVSPTVPIQNQKTVPNSTDSPGPSQISNAAVQTTPPHLKPATEKLIVVNQNMQPLTVLQTLPNGVTQKIQLTS
SVSSTPSVMETNTSVLGPMGGGLTLTTGLNPSLPTSQSLFPSASKGLLPMSHHQHLHSFPAATQSSFPPNISNPPSGLLIGVQPPPDPQL
LVSESSQRTDLSTTVATPSSGLKKRPISRLQTRKNKKLAPSSTPSNIAPSDVVSNMTLINFTPSQLPNHPSLLDLGSLNTSSHRTVPNII
KRSKSSIMTFEPAPLLPQSVGGTAATAAGTSTISQDTSHLTSGSVSGLASSSSVLNVVSMQTTTTPTSSASVPGHVTLTNPRLLGTPDIG
SISNLLIKASQQSLGIQDQPVALPPSSGMFPQLGTSQTPSTAAITAASSICVLPSTQTTGITAASPSGEADEHTQLQHVNQLLASKTGIH
SSQRDLDSASGPQVSNFTQTVDAPNSMGLEQNKALSSAVQASPTSPGGSPSSPSSGQRSASPSVPGPTKPKPKTKRFQLPLDKGNGKKHK
VSHLRTSSSEAHIPDQETTSLTSGTGTPGAEAEQQDTASVEQSSQKECGQPAGQVAVLPEVQVTQNPANEQESAEPKTVEEEESNFSSPL
MLWLQQEQKRKESITEKKPKKGLVFEISSDDGFQICAESIEDAWKSLTDKVQEARSNARLKQLSFAGVNGLRMLGILHDAVVFLIEQLSG
AKHCRNYKFRFHKPEEANEPPLNPHGSARAEVHLRKSAFDMFNFLASKHRQPPEYNPNDEEEEEVQLKSARRATSMDLPMPMRFRHLKKT
SKEAVGVYRSPIHGRGLFCKRNIDAGEMVIETAGNVIRSIQTDKREKTYDSKGIGCTMFRIDDSEVVDATMHGNAARFINHSCEPNCTSR

>In-frame_ELL_ENST00000262809_chr19_18632731_-_KMT2A_ENST00000389506_chr11_118359327_+_2571aa
MAALKEDRSYGLSCGRVSDGSKVSVFHVKLTDSALRAFESYRARQFVTCQVCCEPFHKFCLEENERPLEDQLENWCCRRCKFCHVCGRQH
QATKQLLECNKCRNSTHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGSTTPGKGWDAQWSHDFSLCHDCAKLFAKGNFCPLCDKCTDDD
DTESKMMQCGKCDRWVHSKCENLSDEMTEILSNLPESVAYTCVNCTERHPAEWRLALEKELQISLKQVLTALLNSRTTSHLLRYRQAAKP
PDLNPETEESIPSRSSPEGPDPPVLTEVSKQDDQQPLDLEGVKRKMDQGNYTSVLEFSDDIVKIIQAAINSDGGQPEIKKANSMVKSFFI
RQMERVFPWFSVKKSRFWEPNKVSSNSGMLPNAVLPPSLDHNTAQWQEREENSHTEQPPLMKKIIPAPKPKGPGEPDSPTPLHPPTPPIL
STDRSREDSPELNPPPGIEDNRQCALCLTTGDDSANDAGRLLTIGQNEWTHVNCALWSAEVFEDDDGSLKNVHMAVIRGKQLRCEFCQKP
GATVGCCLTSCTSNTHFMCSRAKNCVFLDDKKVTCQRHRDLIKGEVVPENGFEVFRRVFVDFEGISLRRKFLNGLEPENIHMMIGSMTID
CLGILNDLSDCEDKLFPIGTQCSRVYWSTTDARKRCVTTCKIVECRPPVVEPDINSTVEHDENRTIAHSPTSFTESSSKESQNTAEIISP
PSPDRPPHSQTSGSCTTHVISKVPRIRTPSTSPTQRSPGCRPLPSAGSPTPTTHEIVTVGDPLLSSGLRSIGSRRHSTSSLSPQRSKLRI
MSPMRTGNTYSRNNVSSVSTTGTATDLESSAKVVDHVLGPLNSSTSLGQNTSTSSNLQRTVVTVGNKNSHLDGSSSSEMKQSSASDLVSK
SSSLKGEKTKVLSSKSSEGSAHNVAYPGIPKLAPQVHNTTSRELNVSKIGSFAEPSSVSFSSKEALSFPHLHLRGQRNDRDQHTDSTQSA
NSSPDEDTEVKTLKLSGMSNRSSIINEHMGSSSRDRRQKGKKSCKETFKEKHSSKSFLEPGQVTTGEEGNLKPEFMDEVLTPETMGQRPC
NNVSSDKIGDKGLSMPGVPKAPPMQVEGSAKELQAPRKRTVKVTLTPLKMENESQSKNALKESSPASPLQIESTSPTEPISASENPGDGP
VAQPSPNNTSCQDSQSNNTQNLPVQDRNLMLPDGPKPQEDGSFKRRTPRRSARARSNMFFGLTPLTGVRSTGEEDIPFYSSSTGKKRGKR
SAEGQVDGADDLSTSDEDDLYTYNFTRTVISSGGEERLASHNLFREEEQCDLPKISQLDGVDDGTESDTSVTATTRKSSQIPKRNGKENG
TENLKIDRPEDAGEKEHVTKSSVGHKNEPKMDNCHSVSRVKTQGQDSLEAQLSSLESSRRVHTSTPSDKNLLDTTNTELLKSDSDNNNSD
DCGNILPSDIMDFVLKNTPSMQALGESPESSSSELLNLGEGLGLDSNREKDMGLFEVFSQQLPTTEPVDSSVSSSISAEEQFELPLELPS
DLSVLTTRSPTVPSQNPSRLAVISDSGEKRVTITEKSVASSESDPALLSPGVDPTPEGHMTPDHFIQGHMDADHISSPPCGSVEQGHGNN
QDLTRNSSTPGLQVPVSPTVPIQNQKTVPNSTDSPGPSQISNAAVQTTPPHLKPATEKLIVVNQNMQPLTVLQTLPNGVTQKIQLTSSVS
STPSVMETNTSVLGPMGGGLTLTTGLNPSLPTSQSLFPSASKGLLPMSHHQHLHSFPAATQSSFPPNISNPPSGLLIGVQPPPDPQLLVS
ESSQRTDLSTTVATPSSGLKKRPISRLQTRKNKKLAPSSTPSNIAPSDVVSNMTLINFTPSQLPNHPSLLDLGSLNTSSHRTVPNIIKRS
KSSIMTFEPAPLLPQSVGGTAATAAGTSTISQDTSHLTSGSVSGLASSSSVLNVVSMQTTTTPTSSASVPGHVTLTNPRLLGTPDIGSIS
NLLIKASQQSLGIQDQPVALPPSSGMFPQLGTSQTPSTAAITAASSICVLPSTQTTGITAASPSGEADEHTQLQHVNQLLASKTGIHSSQ
RDLDSASGPQVSNFTQTVDAPNSMGLEQNKALSSAVQASPTSPGGSPSSPSSGQRSASPSVPGPTKPKPKTKRFQLPLDKGNGKKHKVSH
LRTSSSEAHIPDQETTSLTSGTGTPGAEAEQQDTASVEQSSQKECGQPAGQVAVLPEVQVTQNPANEQESAEPKTVEEEESNFSSPLMLW
LQQEQKRKESITEKKPKKGLVFEISSDDGFQICAESIEDAWKSLTDKVQEARSNARLKQLSFAGVNGLRMLGILHDAVVFLIEQLSGAKH
CRNYKFRFHKPEEANEPPLNPHGSARAEVHLRKSAFDMFNFLASKHRQPPEYNPNDEEEEEVQLKSARRATSMDLPMPMRFRHLKKTSKE
AVGVYRSPIHGRGLFCKRNIDAGEMVIETAGNVIRSIQTDKREKTYDSKGIGCTMFRIDDSEVVDATMHGNAARFINHSCEPNCTSRVIN

>In-frame_ELL_ENST00000262809_chr19_18632731_-_KMT2A_ENST00000354520_chr11_118359327_+_2571aa
MAALKEDRSYGLSCGRVSDGSKVSVFHVKLTDSALRAFESYRARQFVTCQVCCEPFHKFCLEENERPLEDQLENWCCRRCKFCHVCGRQH
QATKQLLECNKCRNSTHPECLGPNYPTKPTKKKKVWICTKCVRCKSCGSTTPGKGWDAQWSHDFSLCHDCAKLFAKGNFCPLCDKCTDDD
DTESKMMQCGKCDRWVHSKCENLSDEMTEILSNLPESVAYTCVNCTERHPAEWRLALEKELQISLKQVLTALLNSRTTSHLLRYRQAAKP
PDLNPETEESIPSRSSPEGPDPPVLTEVSKQDDQQPLDLEGVKRKMDQGNYTSVLEFSDDIVKIIQAAINSDGGQPEIKKANSMVKSFFI
RQMERVFPWFSVKKSRFWEPNKVSSNSGMLPNAVLPPSLDHNTAQWQEREENSHTEQPPLMKKIIPAPKPKGPGEPDSPTPLHPPTPPIL
STDRSREDSPELNPPPGIEDNRQCALCLTTGDDSANDAGRLLTIGQNEWTHVNCALWSAEVFEDDDGSLKNVHMAVIRGKQLRCEFCQKP
GATVGCCLTSCTSNTHFMCSRAKNCVFLDDKKVTCQRHRDLIKGEVVPENGFEVFRRVFVDFEGISLRRKFLNGLEPENIHMMIGSMTID
CLGILNDLSDCEDKLFPIGTQCSRVYWSTTDARKRCVTTCKIVECRPPVVEPDINSTVEHDENRTIAHSPTSFTESSSKESQNTAEIISP
PSPDRPPHSQTSGSCTTHVISKVPRIRTPSTSPTQRSPGCRPLPSAGSPTPTTHEIVTVGDPLLSSGLRSIGSRRHSTSSLSPQRSKLRI
MSPMRTGNTYSRNNVSSVSTTGTATDLESSAKVVDHVLGPLNSSTSLGQNTSTSSNLQRTVVTVGNKNSHLDGSSSSEMKQSSASDLVSK
SSSLKGEKTKVLSSKSSEGSAHNVAYPGIPKLAPQVHNTTSRELNVSKIGSFAEPSSVSFSSKEALSFPHLHLRGQRNDRDQHTDSTQSA
NSSPDEDTEVKTLKLSGMSNRSSIINEHMGSSSRDRRQKGKKSCKETFKEKHSSKSFLEPGQVTTGEEGNLKPEFMDEVLTPETMGQRPC
NNVSSDKIGDKGLSMPGVPKAPPMQVEGSAKELQAPRKRTVKVTLTPLKMENESQSKNALKESSPASPLQIESTSPTEPISASENPGDGP
VAQPSPNNTSCQDSQSNNTQNLPVQDRNLMLPDGPKPQEDGSFKRRTPRRSARARSNMFFGLTPLTGVRSTGEEDIPFYSSSTGKKRGKR
SAEGQVDGADDLSTSDEDDLYTYNFTRTVISSGGEERLASHNLFREEEQCDLPKISQLDGVDDGTESDTSVTATTRKSSQIPKRNGKENG
TENLKIDRPEDAGEKEHVTKSSVGHKNEPKMDNCHSVSRVKTQGQDSLEAQLSSLESSRRVHTSTPSDKNLLDTTNTELLKSDSDNNNSD
DCGNILPSDIMDFVLKNTPSMQALGESPESSSSELLNLGEGLGLDSNREKDMGLFEVFSQQLPTTEPVDSSVSSSISAEEQFELPLELPS
DLSVLTTRSPTVPSQNPSRLAVISDSGEKRVTITEKSVASSESDPALLSPGVDPTPEGHMTPDHFIQGHMDADHISSPPCGSVEQGHGNN
QDLTRNSSTPGLQVPVSPTVPIQNQKTVPNSTDSPGPSQISNAAVQTTPPHLKPATEKLIVVNQNMQPLTVLQTLPNGVTQKIQLTSSVS
STPSVMETNTSVLGPMGGGLTLTTGLNPSLPTSQSLFPSASKGLLPMSHHQHLHSFPAATQSSFPPNISNPPSGLLIGVQPPPDPQLLVS
ESSQRTDLSTTVATPSSGLKKRPISRLQTRKNKKLAPSSTPSNIAPSDVVSNMTLINFTPSQLPNHPSLLDLGSLNTSSHRTVPNIIKRS
KSSIMTFEPAPLLPQSVGGTAATAAGTSTISQDTSHLTSGSVSGLASSSSVLNVVSMQTTTTPTSSASVPGHVTLTNPRLLGTPDIGSIS
NLLIKASQQSLGIQDQPVALPPSSGMFPQLGTSQTPSTAAITAASSICVLPSTQTTGITAASPSGEADEHTQLQHVNQLLASKTGIHSSQ
RDLDSASGPQVSNFTQTVDAPNSMGLEQNKALSSAVQASPTSPGGSPSSPSSGQRSASPSVPGPTKPKPKTKRFQLPLDKGNGKKHKVSH
LRTSSSEAHIPDQETTSLTSGTGTPGAEAEQQDTASVEQSSQKECGQPAGQVAVLPEVQVTQNPANEQESAEPKTVEEEESNFSSPLMLW
LQQEQKRKESITEKKPKKGLVFEISSDDGFQICAESIEDAWKSLTDKVQEARSNARLKQLSFAGVNGLRMLGILHDAVVFLIEQLSGAKH
CRNYKFRFHKPEEANEPPLNPHGSARAEVHLRKSAFDMFNFLASKHRQPPEYNPNDEEEEEVQLKSARRATSMDLPMPMRFRHLKKTSKE
AVGVYRSPIHGRGLFCKRNIDAGEMVIETAGNVIRSIQTDKREKTYDSKGIGCTMFRIDDSEVVDATMHGNAARFINHSCEPNCTSRVIN


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_ELL_ENST00000262809_chr19_18632731_-_KMT2A_ENST00000534358_chr11_118359327_+_7722nt
ATGGCGGCGCTGAAGGAGGATAGGAGCTACGGGCTGTCGTGCGGGCGGGTTAGCGACGGCAGCAAGGTGTCGGTGTTCCACGTGAAGCTC
ACCGACAGTGCCCTGAGGGCCTTCGAGAGCTACCGCGCCAGACAGTTTGTGTATTGCCAAGTCTGTTGTGAGCCCTTCCACAAGTTTTGT
TTAGAGGAGAACGAGCGCCCTCTGGAGGACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCAAATTCTGTCACGTTTGTGGAAGGCAACAT
CAGGCTACAAAGCAGCTGCTGGAGTGTAATAAGTGCCGAAACAGCTATCACCCTGAGTGCCTGGGACCAAACTACCCCACCAAACCCACA
AAGAAGAAGAAAGTCTGGATCTGTACCAAGTGTGTTCGCTGTAAGAGCTGTGGATCCACAACTCCAGGCAAAGGGTGGGATGCACAGTGG
TCTCATGATTTCTCACTGTGTCATGATTGCGCCAAGCTCTTTGCTAAAGGAAACTTCTGCCCTCTCTGTGACAAATGTTATGATGATGAT
GACTATGAGAGTAAGATGATGCAATGTGGAAAGTGTGATCGCTGGGTCCATTCCAAATGTGAGAATCTTTCAGGTACAGAAGATGAGATG
TATGAGATTCTATCTAATCTGCCAGAAAGTGTGGCCTACACTTGTGTGAACTGTACTGAGCGGCACCCTGCAGAGTGGCGACTGGCCCTT
GAAAAAGAGCTGCAGATTTCTCTGAAGCAAGTTCTGACAGCTTTGTTGAATTCTCGGACTACCAGCCATTTGCTACGCTACCGGCAGGCT
GCCAAGCCTCCAGACTTAAATCCCGAGACAGAGGAGAGTATACCTTCCCGCAGCTCCCCCGAAGGACCTGATCCACCAGTTCTTACTGAG
GTCAGCAAACAGGATGATCAGCAGCCTTTAGATCTAGAAGGAGTCAAGAGGAAGATGGACCAAGGGAATTACACATCTGTGTTGGAGTTC
AGTGATGATATTGTGAAGATCATTCAAGCAGCCATTAATTCAGATGGAGGACAGCCAGAAATTAAAAAAGCCAACAGCATGGTCAAGTCC
TTCTTCATTCGGCAAATGGAACGTGTTTTTCCATGGTTCAGTGTCAAAAAGTCCAGGTTTTGGGAGCCAAATAAAGTATCAAGCAACAGT
GGGATGTTACCAAACGCAGTGCTTCCACCTTCACTTGACCATAATTATGCTCAGTGGCAGGAGCGAGAGGAAAACAGCCACACTGAGCAG
CCTCCTTTAATGAAGAAAATCATTCCAGCTCCCAAACCCAAAGGTCCTGGAGAACCAGACTCACCAACTCCTCTGCATCCTCCTACACCA
CCAATTTTGAGTACTGATAGGAGTCGAGAAGACAGTCCAGAGCTGAACCCACCCCCAGGCATAGAAGACAATAGACAGTGTGCGTTATGT
TTGACTTATGGTGATGACAGTGCTAATGATGCTGGTCGTTTACTATATATTGGCCAAAATGAGTGGACACATGTAAATTGTGCTTTGTGG
TCAGCGGAAGTGTTTGAAGATGATGACGGATCACTAAAGAATGTGCATATGGCTGTGATCAGGGGCAAGCAGCTGAGATGTGAATTCTGC
CAAAAGCCAGGAGCCACCGTGGGTTGCTGTCTCACATCCTGCACCAGCAACTATCACTTCATGTGTTCCCGAGCCAAGAACTGTGTCTTT
CTGGATGATAAAAAAGTATATTGCCAACGACATCGGGATTTGATCAAAGGCGAAGTGGTTCCTGAGAATGGATTTGAAGTTTTCAGAAGA
GTGTTTGTGGACTTTGAAGGAATCAGCTTGAGAAGGAAGTTTCTCAATGGCTTGGAACCAGAAAATATCCACATGATGATTGGGTCTATG
ACAATCGACTGCTTAGGAATTCTAAATGATCTCTCCGACTGTGAAGATAAGCTCTTTCCTATTGGATATCAGTGTTCCAGGGTATACTGG
AGCACCACAGATGCTCGCAAGCGCTGTGTATATACATGCAAGATAGTGGAGTGCCGTCCTCCAGTCGTAGAGCCGGATATCAACAGCACT
GTTGAACATGATGAAAACAGGACCATTGCCCATAGTCCAACATCTTTTACAGAAAGTTCATCAAAAGAGAGTCAAAACACAGCTGAAATT
ATAAGTCCTCCATCACCAGACCGACCTCCTCATTCACAAACCTCTGGCTCCTGTTATTATCATGTCATCTCAAAGGTCCCCAGGATTCGA
ACACCCAGTTATTCTCCAACACAGAGATCCCCTGGCTGTCGACCGTTGCCTTCTGCAGGAAGTCCTACCCCAACCACTCATGAAATAGTC
ACAGTAGGTGATCCTTTACTCTCCTCTGGACTTCGAAGCATTGGCTCCAGGCGTCACAGTACCTCTTCCTTATCACCCCAGCGGTCCAAA
CTCCGGATAATGTCTCCAATGAGAACTGGGAATACTTACTCTAGGAATAATGTTTCCTCAGTCTCCACCACCGGGACCGCTACTGATCTT
GAATCAAGTGCCAAAGTAGTTGATCATGTCTTAGGGCCACTGAATTCAAGTACTAGTTTAGGGCAAAACACTTCCACCTCTTCAAATTTG
CAAAGGACAGTGGTTACTGTAGGCAATAAAAACAGTCACTTGGATGGATCTTCATCTTCAGAAATGAAGCAGTCCAGTGCTTCAGACTTG
GTGTCCAAGAGCTCCTCTTTAAAGGGAGAGAAGACCAAAGTGCTGAGTTCCAAGAGCTCAGAGGGATCTGCACATAATGTGGCTTACCCT
GGAATTCCTAAACTGGCCCCACAGGTTCATAACACAACATCTAGAGAACTGAATGTTAGTAAAATCGGCTCCTTTGCTGAACCCTCTTCA
GTGTCGTTTTCTTCTAAAGAGGCCCTCTCCTTCCCACACCTCCATTTGAGAGGGCAAAGGAATGATCGAGACCAACACACAGATTCTACC
CAATCAGCAAACTCCTCTCCAGATGAAGATACTGAAGTCAAAACCTTGAAGCTATCTGGAATGAGCAACAGATCATCCATTATCAACGAA
CATATGGGATCTAGTTCCAGAGATAGGAGACAGAAAGGGAAAAAATCCTGTAAAGAAACTTTCAAAGAAAAGCATTCCAGTAAATCTTTT
TTGGAACCTGGTCAGGTGACAACTGGTGAGGAAGGAAACTTGAAGCCAGAGTTTATGGATGAGGTTTTGACTCCTGAGTATATGGGCCAA
CGACCATGTAACAATGTTTCTTCTGATAAGATTGGTGATAAAGGCCTTTCTATGCCAGGAGTCCCCAAAGCTCCACCCATGCAAGTAGAA
GGATCTGCCAAGGAATTACAGGCACCACGGAAACGCACAGTCAAAGTGACACTGACACCTCTAAAAATGGAAAATGAGAGTCAATCCAAA
AATGCCCTGAAAGAAAGTAGTCCTGCTTCCCCTTTGCAAATAGAGTCAACATCTCCCACAGAACCAATTTCAGCCTCTGAAAATCCAGGA
GATGGTCCAGTGGCCCAACCAAGCCCCAATAATACCTCATGCCAGGATTCTCAAAGTAACAACTATCAGAATCTTCCAGTACAGGACAGA
AACCTAATGCTTCCAGATGGCCCCAAACCTCAGGAGGATGGCTCTTTTAAAAGGAGGTATCCCCGTCGCAGTGCCCGTGCACGTTCTAAC
ATGTTTTTTGGGCTTACCCCACTCTATGGAGTAAGATCCTATGGTGAAGAAGACATTCCATTCTACAGCAGCTCAACTGGGAAGAAGCGA
GGCAAGAGATCAGCTGAAGGACAGGTGGATGGGGCCGATGACTTAAGCACTTCAGATGAAGACGACTTATACTATTACAACTTCACTAGA
ACAGTGATTTCTTCAGGTGGAGAGGAACGACTGGCATCCCATAATTTATTTCGGGAGGAGGAACAGTGTGATCTTCCAAAAATCTCACAG
TTGGATGGTGTTGATGATGGGACAGAGAGTGATACTAGTGTCACAGCCACAACAAGGAAAAGCAGCCAGATTCCAAAAAGAAATGGTAAA
GAAAATGGAACAGAGAACTTAAAGATTGATAGACCTGAAGATGCTGGGGAGAAAGAACATGTCACTAAGAGTTCTGTTGGCCACAAAAAT
GAGCCAAAGATGGATAACTGCCATTCTGTAAGCAGAGTTAAAACACAGGGACAAGATTCCTTGGAAGCTCAGCTCAGCTCATTGGAGTCA
AGCCGCAGAGTCCACACAAGTACCCCCTCCGACAAAAATTTACTGGACACCTATAATACTGAGCTCCTGAAATCAGATTCAGACAATAAC
AACAGTGATGACTGTGGGAATATCCTGCCTTCAGACATTATGGACTTTGTACTAAAGAATACTCCATCCATGCAGGCTTTGGGTGAGAGC
CCAGAGTCATCTTCATCAGAACTCCTGAATCTTGGTGAAGGATTGGGTCTTGACAGTAATCGTGAAAAAGACATGGGTCTTTTTGAAGTA
TTTTCTCAGCAGCTGCCTACAACAGAACCTGTGGATAGTAGTGTCTCTTCCTCTATCTCAGCAGAGGAACAGTTTGAGTTGCCTCTAGAG
CTACCATCTGATCTGTCTGTCTTGACCACCCGGAGTCCCACTGTCCCCAGCCAGAATCCCAGTAGACTAGCTGTTATCTCAGACTCAGGG
GAGAAGAGAGTAACCATCACAGAAAAATCTGTAGCCTCCTCTGAAAGTGACCCAGCACTGCTGAGCCCAGGAGTAGATCCAACTCCTGAA
GGCCACATGACTCCTGATCATTTTATCCAAGGACACATGGATGCAGACCACATCTCTAGCCCTCCTTGTGGTTCAGTAGAGCAAGGTCAT
GGCAACAATCAGGATTTAACTAGGAACAGTAGCACCCCTGGCCTTCAGGTACCTGTTTCCCCAACTGTTCCCATCCAGAACCAGAAGTAT
GTGCCCAATTCTACTGATAGTCCTGGCCCGTCTCAGATTTCCAATGCAGCTGTCCAGACCACTCCACCCCACCTGAAGCCAGCCACTGAG
AAACTCATAGTTGTTAACCAGAACATGCAGCCACTTTATGTTCTCCAAACTCTTCCAAATGGAGTGACCCAAAAAATCCAATTGACCTCT
TCTGTTAGTTCTACACCCAGTGTGATGGAGACAAATACTTCAGTATTGGGACCCATGGGAGGTGGTCTCACCCTTACCACAGGACTAAAT
CCAAGCTTGCCAACTTCTCAATCTTTGTTCCCTTCTGCTAGCAAAGGATTGCTACCCATGTCTCATCACCAGCACTTACATTCCTTCCCT
GCAGCTACTCAAAGTAGTTTCCCACCAAACATCAGCAATCCTCCTTCAGGCCTGCTTATTGGGGTTCAGCCTCCTCCGGATCCCCAACTT
TTGGTTTCAGAATCCAGCCAGAGGACAGACCTCAGTACCACAGTAGCCACTCCATCCTCTGGACTCAAGAAAAGACCCATATCTCGTCTA
CAGACCCGAAAGAATAAAAAACTTGCTCCCTCTAGTACCCCTTCAAACATTGCCCCTTCTGATGTGGTTTCTAATATGACATTGATTAAC
TTCACACCCTCCCAGCTTCCTAATCATCCAAGTCTGTTAGATTTGGGGTCACTTAATACTTCATCTCACCGAACTGTCCCCAACATCATA
AAAAGATCTAAATCTAGCATCATGTATTTTGAACCGGCACCCCTGTTACCACAGAGTGTGGGAGGAACTGCTGCCACAGCGGCAGGCACA
TCAACAATAAGCCAGGATACTAGCCACCTCACATCAGGGTCTGTGTCTGGCTTGGCATCCAGTTCCTCTGTCTTGAATGTTGTATCCATG
CAAACTACCACAACCCCTACAAGTAGTGCGTCAGTTCCAGGACACGTCACCTTAACCAACCCAAGGTTGCTTGGTACCCCAGATATTGGC
TCAATAAGCAATCTTTTAATCAAAGCTAGCCAGCAGAGCCTGGGGATTCAGGACCAGCCTGTGGCTTTACCGCCAAGTTCAGGAATGTTT
CCACAACTGGGGACATCACAGACCCCCTCTACTGCTGCAATAACAGCGGCATCTAGCATCTGTGTGCTCCCCTCCACTCAGACTACGGGC
ATAACAGCCGCTTCACCTTCTGGGGAAGCAGACGAACACTATCAGCTTCAGCATGTGAACCAGCTCCTTGCCAGCAAAACTGGGATTCAT
TCTTCCCAGCGTGATCTTGATTCTGCTTCAGGGCCCCAGGTATCCAACTTTACCCAGACGGTAGACGCTCCTAATAGCATGGGACTGGAG
CAGAACAAGGCTTTATCCTCAGCTGTGCAAGCCAGCCCCACCTCTCCTGGGGGTTCTCCATCCTCTCCATCTTCTGGACAGCGGTCAGCA
AGCCCTTCAGTGCCGGGTCCCACTAAACCCAAACCAAAAACCAAACGGTTTCAGCTGCCTCTAGACAAAGGGAATGGCAAGAAGCACAAA
GTTTCCCATTTGCGGACCAGTTCTTCTGAAGCACACATTCCAGACCAAGAAACGACATCCCTGACCTCAGGCACAGGGACTCCAGGAGCA
GAGGCTGAGCAGCAGGATACAGCTAGCGTGGAGCAGTCCTCCCAGAAGGAGTGTGGGCAACCTGCAGGGCAAGTCGCTGTTCTTCCGGAA
GTTCAGGTGACCCAAAATCCAGCAAATGAACAAGAAAGTGCAGAACCTAAAACAGTGGAAGAAGAGGAAAGTAATTTCAGCTCCCCACTG
ATGCTTTGGCTTCAGCAAGAACAAAAGCGGAAGGAAAGCATTACTGAGAAAAAACCCAAGAAAGGACTTGTTTTTGAAATTTCCAGTGAT
GATGGCTTTCAGATCTGTGCAGAAAGTATTGAAGATGCCTGGAAGTCATTGACAGATAAAGTCCAGGAAGCTCGATCAAATGCCCGCCTA
AAGCAGCTCTCATTTGCAGGTGTTAACGGTTTGAGGATGCTGGGGATTCTCCATGATGCAGTTGTGTTCCTCATTGAGCAGCTGTCTGGT
GCCAAGCACTGTCGAAATTACAAATTCCGTTTCCACAAGCCAGAGGAGGCCAATGAACCCCCCTTGAACCCTCACGGCTCAGCCAGGGCT
GAAGTCCACCTCAGGAAGTCAGCATTTGACATGTTTAACTTCCTGGCTTCTAAACATCGTCAGCCTCCTGAATACAACCCCAATGATGAA
GAAGAGGAGGAGGTACAGCTGAAGTCAGCTCGGAGGGCAACTAGCATGGATCTGCCAATGCCCATGCGCTTCCGGCACTTAAAAAAGACT
TCTAAGGAGGCAGTTGGTGTCTACAGGTCTCCCATCCATGGCCGGGGTCTTTTCTGTAAGAGAAACATTGATGCAGGTGAGATGGTGATT
GAGTATGCCGGCAACGTCATCCGCTCCATCCAGACTGACAAGCGGGAAAAGTATTACGACAGCAAGGGCATTGGTTGCTATATGTTCCGA
ATTGATGACTCAGAGGTAGTGGATGCCACCATGCATGGAAATGCTGCACGCTTCATCAATCACTCGTGTGAGCCTAACTGCTATTCTCGG
GTCATCAATATTGATGGGCAGAAGCACATTGTCATCTTTGCCATGCGTAAGATCTACCGAGGAGAGGAACTCACTTACGACTATAAGTTC

>In-frame_ELL_ENST00000262809_chr19_18632731_-_KMT2A_ENST00000389506_chr11_118359327_+_7713nt
ATGGCGGCGCTGAAGGAGGATAGGAGCTACGGGCTGTCGTGCGGGCGGGTTAGCGACGGCAGCAAGGTGTCGGTGTTCCACGTGAAGCTC
ACCGACAGTGCCCTGAGGGCCTTCGAGAGCTACCGCGCCAGACAGTTTGTGTATTGCCAAGTCTGTTGTGAGCCCTTCCACAAGTTTTGT
TTAGAGGAGAACGAGCGCCCTCTGGAGGACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCAAATTCTGTCACGTTTGTGGAAGGCAACAT
CAGGCTACAAAGCAGCTGCTGGAGTGTAATAAGTGCCGAAACAGCTATCACCCTGAGTGCCTGGGACCAAACTACCCCACCAAACCCACA
AAGAAGAAGAAAGTCTGGATCTGTACCAAGTGTGTTCGCTGTAAGAGCTGTGGATCCACAACTCCAGGCAAAGGGTGGGATGCACAGTGG
TCTCATGATTTCTCACTGTGTCATGATTGCGCCAAGCTCTTTGCTAAAGGAAACTTCTGCCCTCTCTGTGACAAATGTTATGATGATGAT
GACTATGAGAGTAAGATGATGCAATGTGGAAAGTGTGATCGCTGGGTCCATTCCAAATGTGAGAATCTTTCAGATGAGATGTATGAGATT
CTATCTAATCTGCCAGAAAGTGTGGCCTACACTTGTGTGAACTGTACTGAGCGGCACCCTGCAGAGTGGCGACTGGCCCTTGAAAAAGAG
CTGCAGATTTCTCTGAAGCAAGTTCTGACAGCTTTGTTGAATTCTCGGACTACCAGCCATTTGCTACGCTACCGGCAGGCTGCCAAGCCT
CCAGACTTAAATCCCGAGACAGAGGAGAGTATACCTTCCCGCAGCTCCCCCGAAGGACCTGATCCACCAGTTCTTACTGAGGTCAGCAAA
CAGGATGATCAGCAGCCTTTAGATCTAGAAGGAGTCAAGAGGAAGATGGACCAAGGGAATTACACATCTGTGTTGGAGTTCAGTGATGAT
ATTGTGAAGATCATTCAAGCAGCCATTAATTCAGATGGAGGACAGCCAGAAATTAAAAAAGCCAACAGCATGGTCAAGTCCTTCTTCATT
CGGCAAATGGAACGTGTTTTTCCATGGTTCAGTGTCAAAAAGTCCAGGTTTTGGGAGCCAAATAAAGTATCAAGCAACAGTGGGATGTTA
CCAAACGCAGTGCTTCCACCTTCACTTGACCATAATTATGCTCAGTGGCAGGAGCGAGAGGAAAACAGCCACACTGAGCAGCCTCCTTTA
ATGAAGAAAATCATTCCAGCTCCCAAACCCAAAGGTCCTGGAGAACCAGACTCACCAACTCCTCTGCATCCTCCTACACCACCAATTTTG
AGTACTGATAGGAGTCGAGAAGACAGTCCAGAGCTGAACCCACCCCCAGGCATAGAAGACAATAGACAGTGTGCGTTATGTTTGACTTAT
GGTGATGACAGTGCTAATGATGCTGGTCGTTTACTATATATTGGCCAAAATGAGTGGACACATGTAAATTGTGCTTTGTGGTCAGCGGAA
GTGTTTGAAGATGATGACGGATCACTAAAGAATGTGCATATGGCTGTGATCAGGGGCAAGCAGCTGAGATGTGAATTCTGCCAAAAGCCA
GGAGCCACCGTGGGTTGCTGTCTCACATCCTGCACCAGCAACTATCACTTCATGTGTTCCCGAGCCAAGAACTGTGTCTTTCTGGATGAT
AAAAAAGTATATTGCCAACGACATCGGGATTTGATCAAAGGCGAAGTGGTTCCTGAGAATGGATTTGAAGTTTTCAGAAGAGTGTTTGTG
GACTTTGAAGGAATCAGCTTGAGAAGGAAGTTTCTCAATGGCTTGGAACCAGAAAATATCCACATGATGATTGGGTCTATGACAATCGAC
TGCTTAGGAATTCTAAATGATCTCTCCGACTGTGAAGATAAGCTCTTTCCTATTGGATATCAGTGTTCCAGGGTATACTGGAGCACCACA
GATGCTCGCAAGCGCTGTGTATATACATGCAAGATAGTGGAGTGCCGTCCTCCAGTCGTAGAGCCGGATATCAACAGCACTGTTGAACAT
GATGAAAACAGGACCATTGCCCATAGTCCAACATCTTTTACAGAAAGTTCATCAAAAGAGAGTCAAAACACAGCTGAAATTATAAGTCCT
CCATCACCAGACCGACCTCCTCATTCACAAACCTCTGGCTCCTGTTATTATCATGTCATCTCAAAGGTCCCCAGGATTCGAACACCCAGT
TATTCTCCAACACAGAGATCCCCTGGCTGTCGACCGTTGCCTTCTGCAGGAAGTCCTACCCCAACCACTCATGAAATAGTCACAGTAGGT
GATCCTTTACTCTCCTCTGGACTTCGAAGCATTGGCTCCAGGCGTCACAGTACCTCTTCCTTATCACCCCAGCGGTCCAAACTCCGGATA
ATGTCTCCAATGAGAACTGGGAATACTTACTCTAGGAATAATGTTTCCTCAGTCTCCACCACCGGGACCGCTACTGATCTTGAATCAAGT
GCCAAAGTAGTTGATCATGTCTTAGGGCCACTGAATTCAAGTACTAGTTTAGGGCAAAACACTTCCACCTCTTCAAATTTGCAAAGGACA
GTGGTTACTGTAGGCAATAAAAACAGTCACTTGGATGGATCTTCATCTTCAGAAATGAAGCAGTCCAGTGCTTCAGACTTGGTGTCCAAG
AGCTCCTCTTTAAAGGGAGAGAAGACCAAAGTGCTGAGTTCCAAGAGCTCAGAGGGATCTGCACATAATGTGGCTTACCCTGGAATTCCT
AAACTGGCCCCACAGGTTCATAACACAACATCTAGAGAACTGAATGTTAGTAAAATCGGCTCCTTTGCTGAACCCTCTTCAGTGTCGTTT
TCTTCTAAAGAGGCCCTCTCCTTCCCACACCTCCATTTGAGAGGGCAAAGGAATGATCGAGACCAACACACAGATTCTACCCAATCAGCA
AACTCCTCTCCAGATGAAGATACTGAAGTCAAAACCTTGAAGCTATCTGGAATGAGCAACAGATCATCCATTATCAACGAACATATGGGA
TCTAGTTCCAGAGATAGGAGACAGAAAGGGAAAAAATCCTGTAAAGAAACTTTCAAAGAAAAGCATTCCAGTAAATCTTTTTTGGAACCT
GGTCAGGTGACAACTGGTGAGGAAGGAAACTTGAAGCCAGAGTTTATGGATGAGGTTTTGACTCCTGAGTATATGGGCCAACGACCATGT
AACAATGTTTCTTCTGATAAGATTGGTGATAAAGGCCTTTCTATGCCAGGAGTCCCCAAAGCTCCACCCATGCAAGTAGAAGGATCTGCC
AAGGAATTACAGGCACCACGGAAACGCACAGTCAAAGTGACACTGACACCTCTAAAAATGGAAAATGAGAGTCAATCCAAAAATGCCCTG
AAAGAAAGTAGTCCTGCTTCCCCTTTGCAAATAGAGTCAACATCTCCCACAGAACCAATTTCAGCCTCTGAAAATCCAGGAGATGGTCCA
GTGGCCCAACCAAGCCCCAATAATACCTCATGCCAGGATTCTCAAAGTAACAACTATCAGAATCTTCCAGTACAGGACAGAAACCTAATG
CTTCCAGATGGCCCCAAACCTCAGGAGGATGGCTCTTTTAAAAGGAGGTATCCCCGTCGCAGTGCCCGTGCACGTTCTAACATGTTTTTT
GGGCTTACCCCACTCTATGGAGTAAGATCCTATGGTGAAGAAGACATTCCATTCTACAGCAGCTCAACTGGGAAGAAGCGAGGCAAGAGA
TCAGCTGAAGGACAGGTGGATGGGGCCGATGACTTAAGCACTTCAGATGAAGACGACTTATACTATTACAACTTCACTAGAACAGTGATT
TCTTCAGGTGGAGAGGAACGACTGGCATCCCATAATTTATTTCGGGAGGAGGAACAGTGTGATCTTCCAAAAATCTCACAGTTGGATGGT
GTTGATGATGGGACAGAGAGTGATACTAGTGTCACAGCCACAACAAGGAAAAGCAGCCAGATTCCAAAAAGAAATGGTAAAGAAAATGGA
ACAGAGAACTTAAAGATTGATAGACCTGAAGATGCTGGGGAGAAAGAACATGTCACTAAGAGTTCTGTTGGCCACAAAAATGAGCCAAAG
ATGGATAACTGCCATTCTGTAAGCAGAGTTAAAACACAGGGACAAGATTCCTTGGAAGCTCAGCTCAGCTCATTGGAGTCAAGCCGCAGA
GTCCACACAAGTACCCCCTCCGACAAAAATTTACTGGACACCTATAATACTGAGCTCCTGAAATCAGATTCAGACAATAACAACAGTGAT
GACTGTGGGAATATCCTGCCTTCAGACATTATGGACTTTGTACTAAAGAATACTCCATCCATGCAGGCTTTGGGTGAGAGCCCAGAGTCA
TCTTCATCAGAACTCCTGAATCTTGGTGAAGGATTGGGTCTTGACAGTAATCGTGAAAAAGACATGGGTCTTTTTGAAGTATTTTCTCAG
CAGCTGCCTACAACAGAACCTGTGGATAGTAGTGTCTCTTCCTCTATCTCAGCAGAGGAACAGTTTGAGTTGCCTCTAGAGCTACCATCT
GATCTGTCTGTCTTGACCACCCGGAGTCCCACTGTCCCCAGCCAGAATCCCAGTAGACTAGCTGTTATCTCAGACTCAGGGGAGAAGAGA
GTAACCATCACAGAAAAATCTGTAGCCTCCTCTGAAAGTGACCCAGCACTGCTGAGCCCAGGAGTAGATCCAACTCCTGAAGGCCACATG
ACTCCTGATCATTTTATCCAAGGACACATGGATGCAGACCACATCTCTAGCCCTCCTTGTGGTTCAGTAGAGCAAGGTCATGGCAACAAT
CAGGATTTAACTAGGAACAGTAGCACCCCTGGCCTTCAGGTACCTGTTTCCCCAACTGTTCCCATCCAGAACCAGAAGTATGTGCCCAAT
TCTACTGATAGTCCTGGCCCGTCTCAGATTTCCAATGCAGCTGTCCAGACCACTCCACCCCACCTGAAGCCAGCCACTGAGAAACTCATA
GTTGTTAACCAGAACATGCAGCCACTTTATGTTCTCCAAACTCTTCCAAATGGAGTGACCCAAAAAATCCAATTGACCTCTTCTGTTAGT
TCTACACCCAGTGTGATGGAGACAAATACTTCAGTATTGGGACCCATGGGAGGTGGTCTCACCCTTACCACAGGACTAAATCCAAGCTTG
CCAACTTCTCAATCTTTGTTCCCTTCTGCTAGCAAAGGATTGCTACCCATGTCTCATCACCAGCACTTACATTCCTTCCCTGCAGCTACT
CAAAGTAGTTTCCCACCAAACATCAGCAATCCTCCTTCAGGCCTGCTTATTGGGGTTCAGCCTCCTCCGGATCCCCAACTTTTGGTTTCA
GAATCCAGCCAGAGGACAGACCTCAGTACCACAGTAGCCACTCCATCCTCTGGACTCAAGAAAAGACCCATATCTCGTCTACAGACCCGA
AAGAATAAAAAACTTGCTCCCTCTAGTACCCCTTCAAACATTGCCCCTTCTGATGTGGTTTCTAATATGACATTGATTAACTTCACACCC
TCCCAGCTTCCTAATCATCCAAGTCTGTTAGATTTGGGGTCACTTAATACTTCATCTCACCGAACTGTCCCCAACATCATAAAAAGATCT
AAATCTAGCATCATGTATTTTGAACCGGCACCCCTGTTACCACAGAGTGTGGGAGGAACTGCTGCCACAGCGGCAGGCACATCAACAATA
AGCCAGGATACTAGCCACCTCACATCAGGGTCTGTGTCTGGCTTGGCATCCAGTTCCTCTGTCTTGAATGTTGTATCCATGCAAACTACC
ACAACCCCTACAAGTAGTGCGTCAGTTCCAGGACACGTCACCTTAACCAACCCAAGGTTGCTTGGTACCCCAGATATTGGCTCAATAAGC
AATCTTTTAATCAAAGCTAGCCAGCAGAGCCTGGGGATTCAGGACCAGCCTGTGGCTTTACCGCCAAGTTCAGGAATGTTTCCACAACTG
GGGACATCACAGACCCCCTCTACTGCTGCAATAACAGCGGCATCTAGCATCTGTGTGCTCCCCTCCACTCAGACTACGGGCATAACAGCC
GCTTCACCTTCTGGGGAAGCAGACGAACACTATCAGCTTCAGCATGTGAACCAGCTCCTTGCCAGCAAAACTGGGATTCATTCTTCCCAG
CGTGATCTTGATTCTGCTTCAGGGCCCCAGGTATCCAACTTTACCCAGACGGTAGACGCTCCTAATAGCATGGGACTGGAGCAGAACAAG
GCTTTATCCTCAGCTGTGCAAGCCAGCCCCACCTCTCCTGGGGGTTCTCCATCCTCTCCATCTTCTGGACAGCGGTCAGCAAGCCCTTCA
GTGCCGGGTCCCACTAAACCCAAACCAAAAACCAAACGGTTTCAGCTGCCTCTAGACAAAGGGAATGGCAAGAAGCACAAAGTTTCCCAT
TTGCGGACCAGTTCTTCTGAAGCACACATTCCAGACCAAGAAACGACATCCCTGACCTCAGGCACAGGGACTCCAGGAGCAGAGGCTGAG
CAGCAGGATACAGCTAGCGTGGAGCAGTCCTCCCAGAAGGAGTGTGGGCAACCTGCAGGGCAAGTCGCTGTTCTTCCGGAAGTTCAGGTG
ACCCAAAATCCAGCAAATGAACAAGAAAGTGCAGAACCTAAAACAGTGGAAGAAGAGGAAAGTAATTTCAGCTCCCCACTGATGCTTTGG
CTTCAGCAAGAACAAAAGCGGAAGGAAAGCATTACTGAGAAAAAACCCAAGAAAGGACTTGTTTTTGAAATTTCCAGTGATGATGGCTTT
CAGATCTGTGCAGAAAGTATTGAAGATGCCTGGAAGTCATTGACAGATAAAGTCCAGGAAGCTCGATCAAATGCCCGCCTAAAGCAGCTC
TCATTTGCAGGTGTTAACGGTTTGAGGATGCTGGGGATTCTCCATGATGCAGTTGTGTTCCTCATTGAGCAGCTGTCTGGTGCCAAGCAC
TGTCGAAATTACAAATTCCGTTTCCACAAGCCAGAGGAGGCCAATGAACCCCCCTTGAACCCTCACGGCTCAGCCAGGGCTGAAGTCCAC
CTCAGGAAGTCAGCATTTGACATGTTTAACTTCCTGGCTTCTAAACATCGTCAGCCTCCTGAATACAACCCCAATGATGAAGAAGAGGAG
GAGGTACAGCTGAAGTCAGCTCGGAGGGCAACTAGCATGGATCTGCCAATGCCCATGCGCTTCCGGCACTTAAAAAAGACTTCTAAGGAG
GCAGTTGGTGTCTACAGGTCTCCCATCCATGGCCGGGGTCTTTTCTGTAAGAGAAACATTGATGCAGGTGAGATGGTGATTGAGTATGCC
GGCAACGTCATCCGCTCCATCCAGACTGACAAGCGGGAAAAGTATTACGACAGCAAGGGCATTGGTTGCTATATGTTCCGAATTGATGAC
TCAGAGGTAGTGGATGCCACCATGCATGGAAATGCTGCACGCTTCATCAATCACTCGTGTGAGCCTAACTGCTATTCTCGGGTCATCAAT
ATTGATGGGCAGAAGCACATTGTCATCTTTGCCATGCGTAAGATCTACCGAGGAGAGGAACTCACTTACGACTATAAGTTCCCCATTGAG

>In-frame_ELL_ENST00000262809_chr19_18632731_-_KMT2A_ENST00000354520_chr11_118359327_+_7713nt
ATGGCGGCGCTGAAGGAGGATAGGAGCTACGGGCTGTCGTGCGGGCGGGTTAGCGACGGCAGCAAGGTGTCGGTGTTCCACGTGAAGCTC
ACCGACAGTGCCCTGAGGGCCTTCGAGAGCTACCGCGCCAGACAGTTTGTGTATTGCCAAGTCTGTTGTGAGCCCTTCCACAAGTTTTGT
TTAGAGGAGAACGAGCGCCCTCTGGAGGACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCAAATTCTGTCACGTTTGTGGAAGGCAACAT
CAGGCTACAAAGCAGCTGCTGGAGTGTAATAAGTGCCGAAACAGCTATCACCCTGAGTGCCTGGGACCAAACTACCCCACCAAACCCACA
AAGAAGAAGAAAGTCTGGATCTGTACCAAGTGTGTTCGCTGTAAGAGCTGTGGATCCACAACTCCAGGCAAAGGGTGGGATGCACAGTGG
TCTCATGATTTCTCACTGTGTCATGATTGCGCCAAGCTCTTTGCTAAAGGAAACTTCTGCCCTCTCTGTGACAAATGTTATGATGATGAT
GACTATGAGAGTAAGATGATGCAATGTGGAAAGTGTGATCGCTGGGTCCATTCCAAATGTGAGAATCTTTCAGATGAGATGTATGAGATT
CTATCTAATCTGCCAGAAAGTGTGGCCTACACTTGTGTGAACTGTACTGAGCGGCACCCTGCAGAGTGGCGACTGGCCCTTGAAAAAGAG
CTGCAGATTTCTCTGAAGCAAGTTCTGACAGCTTTGTTGAATTCTCGGACTACCAGCCATTTGCTACGCTACCGGCAGGCTGCCAAGCCT
CCAGACTTAAATCCCGAGACAGAGGAGAGTATACCTTCCCGCAGCTCCCCCGAAGGACCTGATCCACCAGTTCTTACTGAGGTCAGCAAA
CAGGATGATCAGCAGCCTTTAGATCTAGAAGGAGTCAAGAGGAAGATGGACCAAGGGAATTACACATCTGTGTTGGAGTTCAGTGATGAT
ATTGTGAAGATCATTCAAGCAGCCATTAATTCAGATGGAGGACAGCCAGAAATTAAAAAAGCCAACAGCATGGTCAAGTCCTTCTTCATT
CGGCAAATGGAACGTGTTTTTCCATGGTTCAGTGTCAAAAAGTCCAGGTTTTGGGAGCCAAATAAAGTATCAAGCAACAGTGGGATGTTA
CCAAACGCAGTGCTTCCACCTTCACTTGACCATAATTATGCTCAGTGGCAGGAGCGAGAGGAAAACAGCCACACTGAGCAGCCTCCTTTA
ATGAAGAAAATCATTCCAGCTCCCAAACCCAAAGGTCCTGGAGAACCAGACTCACCAACTCCTCTGCATCCTCCTACACCACCAATTTTG
AGTACTGATAGGAGTCGAGAAGACAGTCCAGAGCTGAACCCACCCCCAGGCATAGAAGACAATAGACAGTGTGCGTTATGTTTGACTTAT
GGTGATGACAGTGCTAATGATGCTGGTCGTTTACTATATATTGGCCAAAATGAGTGGACACATGTAAATTGTGCTTTGTGGTCAGCGGAA
GTGTTTGAAGATGATGACGGATCACTAAAGAATGTGCATATGGCTGTGATCAGGGGCAAGCAGCTGAGATGTGAATTCTGCCAAAAGCCA
GGAGCCACCGTGGGTTGCTGTCTCACATCCTGCACCAGCAACTATCACTTCATGTGTTCCCGAGCCAAGAACTGTGTCTTTCTGGATGAT
AAAAAAGTATATTGCCAACGACATCGGGATTTGATCAAAGGCGAAGTGGTTCCTGAGAATGGATTTGAAGTTTTCAGAAGAGTGTTTGTG
GACTTTGAAGGAATCAGCTTGAGAAGGAAGTTTCTCAATGGCTTGGAACCAGAAAATATCCACATGATGATTGGGTCTATGACAATCGAC
TGCTTAGGAATTCTAAATGATCTCTCCGACTGTGAAGATAAGCTCTTTCCTATTGGATATCAGTGTTCCAGGGTATACTGGAGCACCACA
GATGCTCGCAAGCGCTGTGTATATACATGCAAGATAGTGGAGTGCCGTCCTCCAGTCGTAGAGCCGGATATCAACAGCACTGTTGAACAT
GATGAAAACAGGACCATTGCCCATAGTCCAACATCTTTTACAGAAAGTTCATCAAAAGAGAGTCAAAACACAGCTGAAATTATAAGTCCT
CCATCACCAGACCGACCTCCTCATTCACAAACCTCTGGCTCCTGTTATTATCATGTCATCTCAAAGGTCCCCAGGATTCGAACACCCAGT
TATTCTCCAACACAGAGATCCCCTGGCTGTCGACCGTTGCCTTCTGCAGGAAGTCCTACCCCAACCACTCATGAAATAGTCACAGTAGGT
GATCCTTTACTCTCCTCTGGACTTCGAAGCATTGGCTCCAGGCGTCACAGTACCTCTTCCTTATCACCCCAGCGGTCCAAACTCCGGATA
ATGTCTCCAATGAGAACTGGGAATACTTACTCTAGGAATAATGTTTCCTCAGTCTCCACCACCGGGACCGCTACTGATCTTGAATCAAGT
GCCAAAGTAGTTGATCATGTCTTAGGGCCACTGAATTCAAGTACTAGTTTAGGGCAAAACACTTCCACCTCTTCAAATTTGCAAAGGACA
GTGGTTACTGTAGGCAATAAAAACAGTCACTTGGATGGATCTTCATCTTCAGAAATGAAGCAGTCCAGTGCTTCAGACTTGGTGTCCAAG
AGCTCCTCTTTAAAGGGAGAGAAGACCAAAGTGCTGAGTTCCAAGAGCTCAGAGGGATCTGCACATAATGTGGCTTACCCTGGAATTCCT
AAACTGGCCCCACAGGTTCATAACACAACATCTAGAGAACTGAATGTTAGTAAAATCGGCTCCTTTGCTGAACCCTCTTCAGTGTCGTTT
TCTTCTAAAGAGGCCCTCTCCTTCCCACACCTCCATTTGAGAGGGCAAAGGAATGATCGAGACCAACACACAGATTCTACCCAATCAGCA
AACTCCTCTCCAGATGAAGATACTGAAGTCAAAACCTTGAAGCTATCTGGAATGAGCAACAGATCATCCATTATCAACGAACATATGGGA
TCTAGTTCCAGAGATAGGAGACAGAAAGGGAAAAAATCCTGTAAAGAAACTTTCAAAGAAAAGCATTCCAGTAAATCTTTTTTGGAACCT
GGTCAGGTGACAACTGGTGAGGAAGGAAACTTGAAGCCAGAGTTTATGGATGAGGTTTTGACTCCTGAGTATATGGGCCAACGACCATGT
AACAATGTTTCTTCTGATAAGATTGGTGATAAAGGCCTTTCTATGCCAGGAGTCCCCAAAGCTCCACCCATGCAAGTAGAAGGATCTGCC
AAGGAATTACAGGCACCACGGAAACGCACAGTCAAAGTGACACTGACACCTCTAAAAATGGAAAATGAGAGTCAATCCAAAAATGCCCTG
AAAGAAAGTAGTCCTGCTTCCCCTTTGCAAATAGAGTCAACATCTCCCACAGAACCAATTTCAGCCTCTGAAAATCCAGGAGATGGTCCA
GTGGCCCAACCAAGCCCCAATAATACCTCATGCCAGGATTCTCAAAGTAACAACTATCAGAATCTTCCAGTACAGGACAGAAACCTAATG
CTTCCAGATGGCCCCAAACCTCAGGAGGATGGCTCTTTTAAAAGGAGGTATCCCCGTCGCAGTGCCCGTGCACGTTCTAACATGTTTTTT
GGGCTTACCCCACTCTATGGAGTAAGATCCTATGGTGAAGAAGACATTCCATTCTACAGCAGCTCAACTGGGAAGAAGCGAGGCAAGAGA
TCAGCTGAAGGACAGGTGGATGGGGCCGATGACTTAAGCACTTCAGATGAAGACGACTTATACTATTACAACTTCACTAGAACAGTGATT
TCTTCAGGTGGAGAGGAACGACTGGCATCCCATAATTTATTTCGGGAGGAGGAACAGTGTGATCTTCCAAAAATCTCACAGTTGGATGGT
GTTGATGATGGGACAGAGAGTGATACTAGTGTCACAGCCACAACAAGGAAAAGCAGCCAGATTCCAAAAAGAAATGGTAAAGAAAATGGA
ACAGAGAACTTAAAGATTGATAGACCTGAAGATGCTGGGGAGAAAGAACATGTCACTAAGAGTTCTGTTGGCCACAAAAATGAGCCAAAG
ATGGATAACTGCCATTCTGTAAGCAGAGTTAAAACACAGGGACAAGATTCCTTGGAAGCTCAGCTCAGCTCATTGGAGTCAAGCCGCAGA
GTCCACACAAGTACCCCCTCCGACAAAAATTTACTGGACACCTATAATACTGAGCTCCTGAAATCAGATTCAGACAATAACAACAGTGAT
GACTGTGGGAATATCCTGCCTTCAGACATTATGGACTTTGTACTAAAGAATACTCCATCCATGCAGGCTTTGGGTGAGAGCCCAGAGTCA
TCTTCATCAGAACTCCTGAATCTTGGTGAAGGATTGGGTCTTGACAGTAATCGTGAAAAAGACATGGGTCTTTTTGAAGTATTTTCTCAG
CAGCTGCCTACAACAGAACCTGTGGATAGTAGTGTCTCTTCCTCTATCTCAGCAGAGGAACAGTTTGAGTTGCCTCTAGAGCTACCATCT
GATCTGTCTGTCTTGACCACCCGGAGTCCCACTGTCCCCAGCCAGAATCCCAGTAGACTAGCTGTTATCTCAGACTCAGGGGAGAAGAGA
GTAACCATCACAGAAAAATCTGTAGCCTCCTCTGAAAGTGACCCAGCACTGCTGAGCCCAGGAGTAGATCCAACTCCTGAAGGCCACATG
ACTCCTGATCATTTTATCCAAGGACACATGGATGCAGACCACATCTCTAGCCCTCCTTGTGGTTCAGTAGAGCAAGGTCATGGCAACAAT
CAGGATTTAACTAGGAACAGTAGCACCCCTGGCCTTCAGGTACCTGTTTCCCCAACTGTTCCCATCCAGAACCAGAAGTATGTGCCCAAT
TCTACTGATAGTCCTGGCCCGTCTCAGATTTCCAATGCAGCTGTCCAGACCACTCCACCCCACCTGAAGCCAGCCACTGAGAAACTCATA
GTTGTTAACCAGAACATGCAGCCACTTTATGTTCTCCAAACTCTTCCAAATGGAGTGACCCAAAAAATCCAATTGACCTCTTCTGTTAGT
TCTACACCCAGTGTGATGGAGACAAATACTTCAGTATTGGGACCCATGGGAGGTGGTCTCACCCTTACCACAGGACTAAATCCAAGCTTG
CCAACTTCTCAATCTTTGTTCCCTTCTGCTAGCAAAGGATTGCTACCCATGTCTCATCACCAGCACTTACATTCCTTCCCTGCAGCTACT
CAAAGTAGTTTCCCACCAAACATCAGCAATCCTCCTTCAGGCCTGCTTATTGGGGTTCAGCCTCCTCCGGATCCCCAACTTTTGGTTTCA
GAATCCAGCCAGAGGACAGACCTCAGTACCACAGTAGCCACTCCATCCTCTGGACTCAAGAAAAGACCCATATCTCGTCTACAGACCCGA
AAGAATAAAAAACTTGCTCCCTCTAGTACCCCTTCAAACATTGCCCCTTCTGATGTGGTTTCTAATATGACATTGATTAACTTCACACCC
TCCCAGCTTCCTAATCATCCAAGTCTGTTAGATTTGGGGTCACTTAATACTTCATCTCACCGAACTGTCCCCAACATCATAAAAAGATCT
AAATCTAGCATCATGTATTTTGAACCGGCACCCCTGTTACCACAGAGTGTGGGAGGAACTGCTGCCACAGCGGCAGGCACATCAACAATA
AGCCAGGATACTAGCCACCTCACATCAGGGTCTGTGTCTGGCTTGGCATCCAGTTCCTCTGTCTTGAATGTTGTATCCATGCAAACTACC
ACAACCCCTACAAGTAGTGCGTCAGTTCCAGGACACGTCACCTTAACCAACCCAAGGTTGCTTGGTACCCCAGATATTGGCTCAATAAGC
AATCTTTTAATCAAAGCTAGCCAGCAGAGCCTGGGGATTCAGGACCAGCCTGTGGCTTTACCGCCAAGTTCAGGAATGTTTCCACAACTG
GGGACATCACAGACCCCCTCTACTGCTGCAATAACAGCGGCATCTAGCATCTGTGTGCTCCCCTCCACTCAGACTACGGGCATAACAGCC
GCTTCACCTTCTGGGGAAGCAGACGAACACTATCAGCTTCAGCATGTGAACCAGCTCCTTGCCAGCAAAACTGGGATTCATTCTTCCCAG
CGTGATCTTGATTCTGCTTCAGGGCCCCAGGTATCCAACTTTACCCAGACGGTAGACGCTCCTAATAGCATGGGACTGGAGCAGAACAAG
GCTTTATCCTCAGCTGTGCAAGCCAGCCCCACCTCTCCTGGGGGTTCTCCATCCTCTCCATCTTCTGGACAGCGGTCAGCAAGCCCTTCA
GTGCCGGGTCCCACTAAACCCAAACCAAAAACCAAACGGTTTCAGCTGCCTCTAGACAAAGGGAATGGCAAGAAGCACAAAGTTTCCCAT
TTGCGGACCAGTTCTTCTGAAGCACACATTCCAGACCAAGAAACGACATCCCTGACCTCAGGCACAGGGACTCCAGGAGCAGAGGCTGAG
CAGCAGGATACAGCTAGCGTGGAGCAGTCCTCCCAGAAGGAGTGTGGGCAACCTGCAGGGCAAGTCGCTGTTCTTCCGGAAGTTCAGGTG
ACCCAAAATCCAGCAAATGAACAAGAAAGTGCAGAACCTAAAACAGTGGAAGAAGAGGAAAGTAATTTCAGCTCCCCACTGATGCTTTGG
CTTCAGCAAGAACAAAAGCGGAAGGAAAGCATTACTGAGAAAAAACCCAAGAAAGGACTTGTTTTTGAAATTTCCAGTGATGATGGCTTT
CAGATCTGTGCAGAAAGTATTGAAGATGCCTGGAAGTCATTGACAGATAAAGTCCAGGAAGCTCGATCAAATGCCCGCCTAAAGCAGCTC
TCATTTGCAGGTGTTAACGGTTTGAGGATGCTGGGGATTCTCCATGATGCAGTTGTGTTCCTCATTGAGCAGCTGTCTGGTGCCAAGCAC
TGTCGAAATTACAAATTCCGTTTCCACAAGCCAGAGGAGGCCAATGAACCCCCCTTGAACCCTCACGGCTCAGCCAGGGCTGAAGTCCAC
CTCAGGAAGTCAGCATTTGACATGTTTAACTTCCTGGCTTCTAAACATCGTCAGCCTCCTGAATACAACCCCAATGATGAAGAAGAGGAG
GAGGTACAGCTGAAGTCAGCTCGGAGGGCAACTAGCATGGATCTGCCAATGCCCATGCGCTTCCGGCACTTAAAAAAGACTTCTAAGGAG
GCAGTTGGTGTCTACAGGTCTCCCATCCATGGCCGGGGTCTTTTCTGTAAGAGAAACATTGATGCAGGTGAGATGGTGATTGAGTATGCC
GGCAACGTCATCCGCTCCATCCAGACTGACAAGCGGGAAAAGTATTACGACAGCAAGGGCATTGGTTGCTATATGTTCCGAATTGATGAC
TCAGAGGTAGTGGATGCCACCATGCATGGAAATGCTGCACGCTTCATCAATCACTCGTGTGAGCCTAACTGCTATTCTCGGGTCATCAAT
ATTGATGGGCAGAAGCACATTGTCATCTTTGCCATGCGTAAGATCTACCGAGGAGAGGAACTCACTTACGACTATAAGTTCCCCATTGAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_ELL_ENST00000262809_chr19_18632731_-_KMT2A_ENST00000534358_chr11_118359327_+_12446nt
GGCGGGGCGGGGCGTGGCCGGCGTGGCGGCGCTGGAGCCGGGAAGGGGGCGCGGGGGAGAGATGGTCGCAAGATGGCGGCGCTGAAGGAG
GATAGGAGCTACGGGCTGTCGTGCGGGCGGGTTAGCGACGGCAGCAAGGTGTCGGTGTTCCACGTGAAGCTCACCGACAGTGCCCTGAGG
GCCTTCGAGAGCTACCGCGCCAGACAGTTTGTGTATTGCCAAGTCTGTTGTGAGCCCTTCCACAAGTTTTGTTTAGAGGAGAACGAGCGC
CCTCTGGAGGACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCAAATTCTGTCACGTTTGTGGAAGGCAACATCAGGCTACAAAGCAGCTG
CTGGAGTGTAATAAGTGCCGAAACAGCTATCACCCTGAGTGCCTGGGACCAAACTACCCCACCAAACCCACAAAGAAGAAGAAAGTCTGG
ATCTGTACCAAGTGTGTTCGCTGTAAGAGCTGTGGATCCACAACTCCAGGCAAAGGGTGGGATGCACAGTGGTCTCATGATTTCTCACTG
TGTCATGATTGCGCCAAGCTCTTTGCTAAAGGAAACTTCTGCCCTCTCTGTGACAAATGTTATGATGATGATGACTATGAGAGTAAGATG
ATGCAATGTGGAAAGTGTGATCGCTGGGTCCATTCCAAATGTGAGAATCTTTCAGGTACAGAAGATGAGATGTATGAGATTCTATCTAAT
CTGCCAGAAAGTGTGGCCTACACTTGTGTGAACTGTACTGAGCGGCACCCTGCAGAGTGGCGACTGGCCCTTGAAAAAGAGCTGCAGATT
TCTCTGAAGCAAGTTCTGACAGCTTTGTTGAATTCTCGGACTACCAGCCATTTGCTACGCTACCGGCAGGCTGCCAAGCCTCCAGACTTA
AATCCCGAGACAGAGGAGAGTATACCTTCCCGCAGCTCCCCCGAAGGACCTGATCCACCAGTTCTTACTGAGGTCAGCAAACAGGATGAT
CAGCAGCCTTTAGATCTAGAAGGAGTCAAGAGGAAGATGGACCAAGGGAATTACACATCTGTGTTGGAGTTCAGTGATGATATTGTGAAG
ATCATTCAAGCAGCCATTAATTCAGATGGAGGACAGCCAGAAATTAAAAAAGCCAACAGCATGGTCAAGTCCTTCTTCATTCGGCAAATG
GAACGTGTTTTTCCATGGTTCAGTGTCAAAAAGTCCAGGTTTTGGGAGCCAAATAAAGTATCAAGCAACAGTGGGATGTTACCAAACGCA
GTGCTTCCACCTTCACTTGACCATAATTATGCTCAGTGGCAGGAGCGAGAGGAAAACAGCCACACTGAGCAGCCTCCTTTAATGAAGAAA
ATCATTCCAGCTCCCAAACCCAAAGGTCCTGGAGAACCAGACTCACCAACTCCTCTGCATCCTCCTACACCACCAATTTTGAGTACTGAT
AGGAGTCGAGAAGACAGTCCAGAGCTGAACCCACCCCCAGGCATAGAAGACAATAGACAGTGTGCGTTATGTTTGACTTATGGTGATGAC
AGTGCTAATGATGCTGGTCGTTTACTATATATTGGCCAAAATGAGTGGACACATGTAAATTGTGCTTTGTGGTCAGCGGAAGTGTTTGAA
GATGATGACGGATCACTAAAGAATGTGCATATGGCTGTGATCAGGGGCAAGCAGCTGAGATGTGAATTCTGCCAAAAGCCAGGAGCCACC
GTGGGTTGCTGTCTCACATCCTGCACCAGCAACTATCACTTCATGTGTTCCCGAGCCAAGAACTGTGTCTTTCTGGATGATAAAAAAGTA
TATTGCCAACGACATCGGGATTTGATCAAAGGCGAAGTGGTTCCTGAGAATGGATTTGAAGTTTTCAGAAGAGTGTTTGTGGACTTTGAA
GGAATCAGCTTGAGAAGGAAGTTTCTCAATGGCTTGGAACCAGAAAATATCCACATGATGATTGGGTCTATGACAATCGACTGCTTAGGA
ATTCTAAATGATCTCTCCGACTGTGAAGATAAGCTCTTTCCTATTGGATATCAGTGTTCCAGGGTATACTGGAGCACCACAGATGCTCGC
AAGCGCTGTGTATATACATGCAAGATAGTGGAGTGCCGTCCTCCAGTCGTAGAGCCGGATATCAACAGCACTGTTGAACATGATGAAAAC
AGGACCATTGCCCATAGTCCAACATCTTTTACAGAAAGTTCATCAAAAGAGAGTCAAAACACAGCTGAAATTATAAGTCCTCCATCACCA
GACCGACCTCCTCATTCACAAACCTCTGGCTCCTGTTATTATCATGTCATCTCAAAGGTCCCCAGGATTCGAACACCCAGTTATTCTCCA
ACACAGAGATCCCCTGGCTGTCGACCGTTGCCTTCTGCAGGAAGTCCTACCCCAACCACTCATGAAATAGTCACAGTAGGTGATCCTTTA
CTCTCCTCTGGACTTCGAAGCATTGGCTCCAGGCGTCACAGTACCTCTTCCTTATCACCCCAGCGGTCCAAACTCCGGATAATGTCTCCA
ATGAGAACTGGGAATACTTACTCTAGGAATAATGTTTCCTCAGTCTCCACCACCGGGACCGCTACTGATCTTGAATCAAGTGCCAAAGTA
GTTGATCATGTCTTAGGGCCACTGAATTCAAGTACTAGTTTAGGGCAAAACACTTCCACCTCTTCAAATTTGCAAAGGACAGTGGTTACT
GTAGGCAATAAAAACAGTCACTTGGATGGATCTTCATCTTCAGAAATGAAGCAGTCCAGTGCTTCAGACTTGGTGTCCAAGAGCTCCTCT
TTAAAGGGAGAGAAGACCAAAGTGCTGAGTTCCAAGAGCTCAGAGGGATCTGCACATAATGTGGCTTACCCTGGAATTCCTAAACTGGCC
CCACAGGTTCATAACACAACATCTAGAGAACTGAATGTTAGTAAAATCGGCTCCTTTGCTGAACCCTCTTCAGTGTCGTTTTCTTCTAAA
GAGGCCCTCTCCTTCCCACACCTCCATTTGAGAGGGCAAAGGAATGATCGAGACCAACACACAGATTCTACCCAATCAGCAAACTCCTCT
CCAGATGAAGATACTGAAGTCAAAACCTTGAAGCTATCTGGAATGAGCAACAGATCATCCATTATCAACGAACATATGGGATCTAGTTCC
AGAGATAGGAGACAGAAAGGGAAAAAATCCTGTAAAGAAACTTTCAAAGAAAAGCATTCCAGTAAATCTTTTTTGGAACCTGGTCAGGTG
ACAACTGGTGAGGAAGGAAACTTGAAGCCAGAGTTTATGGATGAGGTTTTGACTCCTGAGTATATGGGCCAACGACCATGTAACAATGTT
TCTTCTGATAAGATTGGTGATAAAGGCCTTTCTATGCCAGGAGTCCCCAAAGCTCCACCCATGCAAGTAGAAGGATCTGCCAAGGAATTA
CAGGCACCACGGAAACGCACAGTCAAAGTGACACTGACACCTCTAAAAATGGAAAATGAGAGTCAATCCAAAAATGCCCTGAAAGAAAGT
AGTCCTGCTTCCCCTTTGCAAATAGAGTCAACATCTCCCACAGAACCAATTTCAGCCTCTGAAAATCCAGGAGATGGTCCAGTGGCCCAA
CCAAGCCCCAATAATACCTCATGCCAGGATTCTCAAAGTAACAACTATCAGAATCTTCCAGTACAGGACAGAAACCTAATGCTTCCAGAT
GGCCCCAAACCTCAGGAGGATGGCTCTTTTAAAAGGAGGTATCCCCGTCGCAGTGCCCGTGCACGTTCTAACATGTTTTTTGGGCTTACC
CCACTCTATGGAGTAAGATCCTATGGTGAAGAAGACATTCCATTCTACAGCAGCTCAACTGGGAAGAAGCGAGGCAAGAGATCAGCTGAA
GGACAGGTGGATGGGGCCGATGACTTAAGCACTTCAGATGAAGACGACTTATACTATTACAACTTCACTAGAACAGTGATTTCTTCAGGT
GGAGAGGAACGACTGGCATCCCATAATTTATTTCGGGAGGAGGAACAGTGTGATCTTCCAAAAATCTCACAGTTGGATGGTGTTGATGAT
GGGACAGAGAGTGATACTAGTGTCACAGCCACAACAAGGAAAAGCAGCCAGATTCCAAAAAGAAATGGTAAAGAAAATGGAACAGAGAAC
TTAAAGATTGATAGACCTGAAGATGCTGGGGAGAAAGAACATGTCACTAAGAGTTCTGTTGGCCACAAAAATGAGCCAAAGATGGATAAC
TGCCATTCTGTAAGCAGAGTTAAAACACAGGGACAAGATTCCTTGGAAGCTCAGCTCAGCTCATTGGAGTCAAGCCGCAGAGTCCACACA
AGTACCCCCTCCGACAAAAATTTACTGGACACCTATAATACTGAGCTCCTGAAATCAGATTCAGACAATAACAACAGTGATGACTGTGGG
AATATCCTGCCTTCAGACATTATGGACTTTGTACTAAAGAATACTCCATCCATGCAGGCTTTGGGTGAGAGCCCAGAGTCATCTTCATCA
GAACTCCTGAATCTTGGTGAAGGATTGGGTCTTGACAGTAATCGTGAAAAAGACATGGGTCTTTTTGAAGTATTTTCTCAGCAGCTGCCT
ACAACAGAACCTGTGGATAGTAGTGTCTCTTCCTCTATCTCAGCAGAGGAACAGTTTGAGTTGCCTCTAGAGCTACCATCTGATCTGTCT
GTCTTGACCACCCGGAGTCCCACTGTCCCCAGCCAGAATCCCAGTAGACTAGCTGTTATCTCAGACTCAGGGGAGAAGAGAGTAACCATC
ACAGAAAAATCTGTAGCCTCCTCTGAAAGTGACCCAGCACTGCTGAGCCCAGGAGTAGATCCAACTCCTGAAGGCCACATGACTCCTGAT
CATTTTATCCAAGGACACATGGATGCAGACCACATCTCTAGCCCTCCTTGTGGTTCAGTAGAGCAAGGTCATGGCAACAATCAGGATTTA
ACTAGGAACAGTAGCACCCCTGGCCTTCAGGTACCTGTTTCCCCAACTGTTCCCATCCAGAACCAGAAGTATGTGCCCAATTCTACTGAT
AGTCCTGGCCCGTCTCAGATTTCCAATGCAGCTGTCCAGACCACTCCACCCCACCTGAAGCCAGCCACTGAGAAACTCATAGTTGTTAAC
CAGAACATGCAGCCACTTTATGTTCTCCAAACTCTTCCAAATGGAGTGACCCAAAAAATCCAATTGACCTCTTCTGTTAGTTCTACACCC
AGTGTGATGGAGACAAATACTTCAGTATTGGGACCCATGGGAGGTGGTCTCACCCTTACCACAGGACTAAATCCAAGCTTGCCAACTTCT
CAATCTTTGTTCCCTTCTGCTAGCAAAGGATTGCTACCCATGTCTCATCACCAGCACTTACATTCCTTCCCTGCAGCTACTCAAAGTAGT
TTCCCACCAAACATCAGCAATCCTCCTTCAGGCCTGCTTATTGGGGTTCAGCCTCCTCCGGATCCCCAACTTTTGGTTTCAGAATCCAGC
CAGAGGACAGACCTCAGTACCACAGTAGCCACTCCATCCTCTGGACTCAAGAAAAGACCCATATCTCGTCTACAGACCCGAAAGAATAAA
AAACTTGCTCCCTCTAGTACCCCTTCAAACATTGCCCCTTCTGATGTGGTTTCTAATATGACATTGATTAACTTCACACCCTCCCAGCTT
CCTAATCATCCAAGTCTGTTAGATTTGGGGTCACTTAATACTTCATCTCACCGAACTGTCCCCAACATCATAAAAAGATCTAAATCTAGC
ATCATGTATTTTGAACCGGCACCCCTGTTACCACAGAGTGTGGGAGGAACTGCTGCCACAGCGGCAGGCACATCAACAATAAGCCAGGAT
ACTAGCCACCTCACATCAGGGTCTGTGTCTGGCTTGGCATCCAGTTCCTCTGTCTTGAATGTTGTATCCATGCAAACTACCACAACCCCT
ACAAGTAGTGCGTCAGTTCCAGGACACGTCACCTTAACCAACCCAAGGTTGCTTGGTACCCCAGATATTGGCTCAATAAGCAATCTTTTA
ATCAAAGCTAGCCAGCAGAGCCTGGGGATTCAGGACCAGCCTGTGGCTTTACCGCCAAGTTCAGGAATGTTTCCACAACTGGGGACATCA
CAGACCCCCTCTACTGCTGCAATAACAGCGGCATCTAGCATCTGTGTGCTCCCCTCCACTCAGACTACGGGCATAACAGCCGCTTCACCT
TCTGGGGAAGCAGACGAACACTATCAGCTTCAGCATGTGAACCAGCTCCTTGCCAGCAAAACTGGGATTCATTCTTCCCAGCGTGATCTT
GATTCTGCTTCAGGGCCCCAGGTATCCAACTTTACCCAGACGGTAGACGCTCCTAATAGCATGGGACTGGAGCAGAACAAGGCTTTATCC
TCAGCTGTGCAAGCCAGCCCCACCTCTCCTGGGGGTTCTCCATCCTCTCCATCTTCTGGACAGCGGTCAGCAAGCCCTTCAGTGCCGGGT
CCCACTAAACCCAAACCAAAAACCAAACGGTTTCAGCTGCCTCTAGACAAAGGGAATGGCAAGAAGCACAAAGTTTCCCATTTGCGGACC
AGTTCTTCTGAAGCACACATTCCAGACCAAGAAACGACATCCCTGACCTCAGGCACAGGGACTCCAGGAGCAGAGGCTGAGCAGCAGGAT
ACAGCTAGCGTGGAGCAGTCCTCCCAGAAGGAGTGTGGGCAACCTGCAGGGCAAGTCGCTGTTCTTCCGGAAGTTCAGGTGACCCAAAAT
CCAGCAAATGAACAAGAAAGTGCAGAACCTAAAACAGTGGAAGAAGAGGAAAGTAATTTCAGCTCCCCACTGATGCTTTGGCTTCAGCAA
GAACAAAAGCGGAAGGAAAGCATTACTGAGAAAAAACCCAAGAAAGGACTTGTTTTTGAAATTTCCAGTGATGATGGCTTTCAGATCTGT
GCAGAAAGTATTGAAGATGCCTGGAAGTCATTGACAGATAAAGTCCAGGAAGCTCGATCAAATGCCCGCCTAAAGCAGCTCTCATTTGCA
GGTGTTAACGGTTTGAGGATGCTGGGGATTCTCCATGATGCAGTTGTGTTCCTCATTGAGCAGCTGTCTGGTGCCAAGCACTGTCGAAAT
TACAAATTCCGTTTCCACAAGCCAGAGGAGGCCAATGAACCCCCCTTGAACCCTCACGGCTCAGCCAGGGCTGAAGTCCACCTCAGGAAG
TCAGCATTTGACATGTTTAACTTCCTGGCTTCTAAACATCGTCAGCCTCCTGAATACAACCCCAATGATGAAGAAGAGGAGGAGGTACAG
CTGAAGTCAGCTCGGAGGGCAACTAGCATGGATCTGCCAATGCCCATGCGCTTCCGGCACTTAAAAAAGACTTCTAAGGAGGCAGTTGGT
GTCTACAGGTCTCCCATCCATGGCCGGGGTCTTTTCTGTAAGAGAAACATTGATGCAGGTGAGATGGTGATTGAGTATGCCGGCAACGTC
ATCCGCTCCATCCAGACTGACAAGCGGGAAAAGTATTACGACAGCAAGGGCATTGGTTGCTATATGTTCCGAATTGATGACTCAGAGGTA
GTGGATGCCACCATGCATGGAAATGCTGCACGCTTCATCAATCACTCGTGTGAGCCTAACTGCTATTCTCGGGTCATCAATATTGATGGG
CAGAAGCACATTGTCATCTTTGCCATGCGTAAGATCTACCGAGGAGAGGAACTCACTTACGACTATAAGTTCCCCATTGAGGATGCCAGC
AACAAGCTGCCCTGCAACTGTGGCGCCAAGAAATGCCGGAAGTTCCTAAACTAAAGCTGCTCTTCTCCCCCAGTGTTGGAGTGCAAGGAG
GCGGGGCCATCCAAAGCAACGCTGAAGGCCTTTTCCAGCAGCTGGGAGCTCCCGGATTGCGTGGCACAGCTGAGGGGCCTCTGTGATGGC
TGAGCTCTCTTATGTCCTATACTCACATCAGACATGTGATCATAGTCCCAGAGACAGAGTTGAGGTCTCGAAGAAAAGATCCATGATCGG
CTTTCTCCTGGGGCCCCTCCAATTGTTTACTGTTAGAAAGTGGGAATGGGGTCCCTAGCAGACTTGCCTGGAAGGAGCCTATTATAGAGG
GTTGGTTATGTTGGGAGATTGGGCCTGAATTTCTCCACAGAAATAAGTTGCCATCCTCAGGTTGGCCCTTTCCCAAGCACTGTAAGTGAG
TGGGTCAGGCAAAGCCCCAAATGGAGGGTTGGTTAGATTCCTGACAGTTTGCCAGCCAGGCCCCACCTACAGCGTCTGTCGAACAAACAG
AGGTCTGGTGGTTTTCCCTACTATCCTCCCACTCGAGAGTTCACTTCTGGTTGGGAGACAGGATTCCTAGCACCTCCGGTGTCAAAAGGC
TGTCATGGGGTTGTGCCAATTAATTACCAAACATTGAGCCTGCAGGCTTTGAGTGGGAGTGTTGCCCCCAGGAGCCTTATCTCAGCCAAT
TACCTTTCTTGACAGTAGGAGCGGCTTCCCTCTCCCATTCCCTCTTCACTCCCTTTTCTTCCTTTCCCCTGTCTTCATGCCACTGCTTTC
CCATGCTTCTTTCGGGTTGTAGGGGAGACTGACTGCCTGCTCAAGGACACTCCCTGCTGGGCATAGGATGTGCCTGCAAAAAGTTCCCTG
AGCCTGTAAGCACTCCAGGTGGGGAAGTGGACAGGAGCCATTGGTCATAACCAGACAGAATTTGGAAACATTTTCATAAAGCTCCATGGA
GAGTTTTAAAGAAACATATGTAGCATGATTTTGTAGGAGAGGAAAAAGATTATTTAAATAGGATTTAAATCATGCAACAACGAGAGTATC
ACAGCCAGGATGACCCTTGGGTCCCATTCCTAAGACATGGTTACTTTATTTTCCCCTTGTTAAGACATAGGAAGACTTAATTTTTAAACG
GTCAGTGTCCAGTTGAAGGCAGAACACTAATCAGATTTCAAGGCCCACAACTTGGGGACTAGACCACCTTATGTTGAGGGAACTCTGCCA
CCTGCGTGCAACCCACAGCTAAAGTAAATTCAATGACACTACTGCCCTGATTACTCCTTAGGATGTGGTCAAAACAGCATCAAATGTTTC
TTCTCTTCCTTTCCCCAAGACAGAGTCCTGAACCTGTTAAATTAAGTCATTGGATTTTACTCTGTTCTGTTTACAGTTTACTATTTAAGG
TTTTATAAATGTAAATATATTTTGTATATTTTTCTATGAGAAGCACTTCATAGGGAGAAGCACTTATGACAAGGCTATTTTTTAAACCGC
GGTATTATCCTAATTTAAAAGAAGATCGGTTTTTAATAATTTTTTATTTTCATAGGATGAAGTTAGAGAAAATATTCAGCTGTACACACA
AAGTCTGGTTTTTCCTGCCCAACTTCCCCCTGGAAGGTGTACTTTTTGTTGTTTAATGTGTAGCTTGTTTGTGCCCTGTTGACATAAATG
TTTCCTGGGTTTGCTCTTTGACAATAAATGGAGAAGGAAGGTCACCCAACTCCATTGGGCCACTCCCCTCCTTCCCCTATTGAAGCTCCT
CAAAAGGCTACAGTAATATCTTGATACAACAGATTCTCTTCTTTCCCGCCTCTCTCCTTTCCGGCGCAACTTCCAGAGTGGTGGGAGACG
GCAATCTTTACATTTCCCTCATCTTTCTTACTTCAGAGTTAGCAAACAACAAGTTGAATGGCAACTTGACATTTTTGCATCACCATCTGC
CTCATAGGCCACTCTTTCCTTTCCCTCTGCCCACCAAGTCCTCATATCTGCAGAGAACCCATTGATCACCTTGTGCCCTCTTTTGGGGCA
GCCTGTTGAAACTGAAGCACAGTCTGACCACTCACGATAAAGCAGATTTTTCTCTGCCTCTGCCACAAGGTTTCAGAGTAGTGTAGTCCA
AGTAGAGGGTGGGGCACCCTTTTCTCGCCGCAAGAAGCCCATTCCTATGGAAGTCTAGCAAAGCAATACGACTCAGCCCAGCACTCTCTG
CCCCAGGACTCATGGCTCTGCTGTGCCTTCCATCCTGGGCTCCCTTCTCTCCTGTGACCTTAAGAACTTTGTCTGGTGGCTTTGCTGGAA
CATTGTCACTGTTTTCACTGTCATGCAGGGAGCCCAGCACTGTGGCCAGGATGGCAGAGACTTCCTTGTCATCATGGAGAAGTGCCAGCA
GGGGACTGGGAAAAGCACTCTACCCAGACCTCACCTCCCTTCCTCCTTTTGCCCATGAACAAGATGCAGTGGCCCTAGGGGTTCCACTAG
TGTCTGCTTTCCTTTATTATTGCACTGTGTGAGGTTTTTTTGTAAATCCTTGTATTCCTATTTTTTTTAAAGAAAAAAAAAAAACCTTAA
GCTGCATTTGTTACTGAAATGATTAATGCACTGATGGGTCCTGAATTCACCTTGAGAAAGACCCAAAGGCCAGTCAGGGGGTGGGGGGAA
CTCAGCTAAATAGACCTAGTTACTGCCCTGCTAGGCCATGCTGTACTGTGAGCCCCTCCTCACTCTCTACCAACCCTAAACCCTGAGGAC
AGGGGAGGAACCCACAGCTTCCTTCTCCTGCCAGCTGCAGATGGTTTGCCTTGCCTTTCCACCCCCTAATTGTCAACCACAAAAATGAGA
AATTCCTCTTCTAGCTCAGCCTTGAGTCCATTGCCAAATTTTCAGCACACCTGCCAGCAACTTGGGGGAATAAGCGAAGGTTTCCCTACA
AGAGGGAAAGAAGGCAAAAACGGCACAGCTATCTCCAAACACATCTGAGTTCATTTCAAAAGTGACCAAGGGAATCTCCGCACAAAAGTG
CAGATTGAGGAATTGTGATGGGTCATTCCCAAGAATCCCCCAAGGGGCATCCCAAATCCCTGAGGAGTAACAGCTGCAAACCTGGTCAGT
TCTCAGTGAGAGCCAGCTCACTTATAGCTTTGCTGCTAGAACCTGTTGTGGCTGCATTTCCTGGTGGCCAGTGACAACTGTGTAACCAGA
ATAGCTGCATGGCGCTGACCCTTTGGCCGGAACTTGGTCTCTTGGCTCCCTCCTTGGCCACCCACCACCTCTCGCACAGCCCCTCTGTTT
TTACACCAATAACAAGAATTAAGGGGGAAGCCCTGGCAGCTATACGTTTTCAACCAGACTCCTTTGCCGGGACCCAGCCCGCCACCCTGC
TCGCCTCCGTCAAACCCCCGGCCAATGCAGTGAGCACCATGTAGCTCCCTTGATTTAAAAAAAATAAAAAATAAAAAAAAAAGGAAAAAA
AAATACAACACACACACAAAAATAAAAAAAATATTCTAATGAATGTATCTTTCTAAAGGACTGACGTTCAATCAAATATCTGAAAATACT
AAAGGTCAAAACCTTGTCAGATGTTAACTTCTAAGTTCGGTTTGGGATTTTTTTTTTTTAATAGAAATCAAGTTGTTTTTGTTTTTAAGG
AAAAGCGGGTCATTGCAAAGGGCTGGGTGTAATTTTATGTTTCATTTCCTTCATTTTAAAGCAATACAAGGTTATGGAGCAGATGGTTTT
GTGCCGAATCATGAATACTAGTCAAGTCACACACTCTGGAAACTTGCAACTTTTTGTTTGTTTTGGTTTTCAAATAAATATAAATATGAT
ATATATAGGAACTAATATAGTAATGCACCATGTAACAAAGCCTAGTTCAGTCCATGGCTTTTAATTCTCTTAACACTATAGATAAGGATT
GTGTTACAGTTGCTAGTAGCGGCAGGAAGATGTCAGGCTCACTTTCCTCTGATTCCCGAAATGGGGGGAACCTCTAACCATAAAGGAATG
GTAGAACAGTCCATTCCTCGGATCAGAGAAAAATGCAGACATGGTGTCACCTGGATTTTTTTCTGCCCATGAATGTTGCCAGTCAGTACC
TGTCCTCCTTGTTTCTCTATTTTTGGTTATGAATGTTGGGGTTACCACCTGCATTTAGGGGAAAATTGTGTTCTGTGCTTTCCTGGTATC
TTGTTCCGAGGTACTCTAGTTCTGTCTTTCAACCAAGAAAATAGAATTGTGGTGTTTCTTTTATTGAACTTTTAACAGTCTCTTTAGTAA
ATACAGGTAGTTGAATAATTGTTTCAAGAGCTCAACAGATGACAAGCTTCTTTTCTAGAAATAAGACATTTTTTGACAACTTTATCATGT
ATAACAGATCTGTTTTTTTTCCTTGTGTTCTTCCAAGCTTCTGGTTAGAGAAAAAGAGAAAAAAAAAAAAGGAAAATGTGTCTAAAGTCC
ATCAGTGTTAACTCCCTGTGACAGGGATGAAGGAAAATACTTTAATAGTTCAAAAAATAATAATGCTGAAAGCTCTCTACGAAAGACTGA
ATGTAAAAGTAAAAAGTGTACATAGTTGTAAAAAAAAGGAGTTTTTAAACATGTTTATTTTCTATGCACTTTTTTTTATTTAAGTGATAG

>In-frame_ELL_ENST00000262809_chr19_18632731_-_KMT2A_ENST00000389506_chr11_118359327_+_9530nt
GGCGGGGCGGGGCGTGGCCGGCGTGGCGGCGCTGGAGCCGGGAAGGGGGCGCGGGGGAGAGATGGTCGCAAGATGGCGGCGCTGAAGGAG
GATAGGAGCTACGGGCTGTCGTGCGGGCGGGTTAGCGACGGCAGCAAGGTGTCGGTGTTCCACGTGAAGCTCACCGACAGTGCCCTGAGG
GCCTTCGAGAGCTACCGCGCCAGACAGTTTGTGTATTGCCAAGTCTGTTGTGAGCCCTTCCACAAGTTTTGTTTAGAGGAGAACGAGCGC
CCTCTGGAGGACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCAAATTCTGTCACGTTTGTGGAAGGCAACATCAGGCTACAAAGCAGCTG
CTGGAGTGTAATAAGTGCCGAAACAGCTATCACCCTGAGTGCCTGGGACCAAACTACCCCACCAAACCCACAAAGAAGAAGAAAGTCTGG
ATCTGTACCAAGTGTGTTCGCTGTAAGAGCTGTGGATCCACAACTCCAGGCAAAGGGTGGGATGCACAGTGGTCTCATGATTTCTCACTG
TGTCATGATTGCGCCAAGCTCTTTGCTAAAGGAAACTTCTGCCCTCTCTGTGACAAATGTTATGATGATGATGACTATGAGAGTAAGATG
ATGCAATGTGGAAAGTGTGATCGCTGGGTCCATTCCAAATGTGAGAATCTTTCAGATGAGATGTATGAGATTCTATCTAATCTGCCAGAA
AGTGTGGCCTACACTTGTGTGAACTGTACTGAGCGGCACCCTGCAGAGTGGCGACTGGCCCTTGAAAAAGAGCTGCAGATTTCTCTGAAG
CAAGTTCTGACAGCTTTGTTGAATTCTCGGACTACCAGCCATTTGCTACGCTACCGGCAGGCTGCCAAGCCTCCAGACTTAAATCCCGAG
ACAGAGGAGAGTATACCTTCCCGCAGCTCCCCCGAAGGACCTGATCCACCAGTTCTTACTGAGGTCAGCAAACAGGATGATCAGCAGCCT
TTAGATCTAGAAGGAGTCAAGAGGAAGATGGACCAAGGGAATTACACATCTGTGTTGGAGTTCAGTGATGATATTGTGAAGATCATTCAA
GCAGCCATTAATTCAGATGGAGGACAGCCAGAAATTAAAAAAGCCAACAGCATGGTCAAGTCCTTCTTCATTCGGCAAATGGAACGTGTT
TTTCCATGGTTCAGTGTCAAAAAGTCCAGGTTTTGGGAGCCAAATAAAGTATCAAGCAACAGTGGGATGTTACCAAACGCAGTGCTTCCA
CCTTCACTTGACCATAATTATGCTCAGTGGCAGGAGCGAGAGGAAAACAGCCACACTGAGCAGCCTCCTTTAATGAAGAAAATCATTCCA
GCTCCCAAACCCAAAGGTCCTGGAGAACCAGACTCACCAACTCCTCTGCATCCTCCTACACCACCAATTTTGAGTACTGATAGGAGTCGA
GAAGACAGTCCAGAGCTGAACCCACCCCCAGGCATAGAAGACAATAGACAGTGTGCGTTATGTTTGACTTATGGTGATGACAGTGCTAAT
GATGCTGGTCGTTTACTATATATTGGCCAAAATGAGTGGACACATGTAAATTGTGCTTTGTGGTCAGCGGAAGTGTTTGAAGATGATGAC
GGATCACTAAAGAATGTGCATATGGCTGTGATCAGGGGCAAGCAGCTGAGATGTGAATTCTGCCAAAAGCCAGGAGCCACCGTGGGTTGC
TGTCTCACATCCTGCACCAGCAACTATCACTTCATGTGTTCCCGAGCCAAGAACTGTGTCTTTCTGGATGATAAAAAAGTATATTGCCAA
CGACATCGGGATTTGATCAAAGGCGAAGTGGTTCCTGAGAATGGATTTGAAGTTTTCAGAAGAGTGTTTGTGGACTTTGAAGGAATCAGC
TTGAGAAGGAAGTTTCTCAATGGCTTGGAACCAGAAAATATCCACATGATGATTGGGTCTATGACAATCGACTGCTTAGGAATTCTAAAT
GATCTCTCCGACTGTGAAGATAAGCTCTTTCCTATTGGATATCAGTGTTCCAGGGTATACTGGAGCACCACAGATGCTCGCAAGCGCTGT
GTATATACATGCAAGATAGTGGAGTGCCGTCCTCCAGTCGTAGAGCCGGATATCAACAGCACTGTTGAACATGATGAAAACAGGACCATT
GCCCATAGTCCAACATCTTTTACAGAAAGTTCATCAAAAGAGAGTCAAAACACAGCTGAAATTATAAGTCCTCCATCACCAGACCGACCT
CCTCATTCACAAACCTCTGGCTCCTGTTATTATCATGTCATCTCAAAGGTCCCCAGGATTCGAACACCCAGTTATTCTCCAACACAGAGA
TCCCCTGGCTGTCGACCGTTGCCTTCTGCAGGAAGTCCTACCCCAACCACTCATGAAATAGTCACAGTAGGTGATCCTTTACTCTCCTCT
GGACTTCGAAGCATTGGCTCCAGGCGTCACAGTACCTCTTCCTTATCACCCCAGCGGTCCAAACTCCGGATAATGTCTCCAATGAGAACT
GGGAATACTTACTCTAGGAATAATGTTTCCTCAGTCTCCACCACCGGGACCGCTACTGATCTTGAATCAAGTGCCAAAGTAGTTGATCAT
GTCTTAGGGCCACTGAATTCAAGTACTAGTTTAGGGCAAAACACTTCCACCTCTTCAAATTTGCAAAGGACAGTGGTTACTGTAGGCAAT
AAAAACAGTCACTTGGATGGATCTTCATCTTCAGAAATGAAGCAGTCCAGTGCTTCAGACTTGGTGTCCAAGAGCTCCTCTTTAAAGGGA
GAGAAGACCAAAGTGCTGAGTTCCAAGAGCTCAGAGGGATCTGCACATAATGTGGCTTACCCTGGAATTCCTAAACTGGCCCCACAGGTT
CATAACACAACATCTAGAGAACTGAATGTTAGTAAAATCGGCTCCTTTGCTGAACCCTCTTCAGTGTCGTTTTCTTCTAAAGAGGCCCTC
TCCTTCCCACACCTCCATTTGAGAGGGCAAAGGAATGATCGAGACCAACACACAGATTCTACCCAATCAGCAAACTCCTCTCCAGATGAA
GATACTGAAGTCAAAACCTTGAAGCTATCTGGAATGAGCAACAGATCATCCATTATCAACGAACATATGGGATCTAGTTCCAGAGATAGG
AGACAGAAAGGGAAAAAATCCTGTAAAGAAACTTTCAAAGAAAAGCATTCCAGTAAATCTTTTTTGGAACCTGGTCAGGTGACAACTGGT
GAGGAAGGAAACTTGAAGCCAGAGTTTATGGATGAGGTTTTGACTCCTGAGTATATGGGCCAACGACCATGTAACAATGTTTCTTCTGAT
AAGATTGGTGATAAAGGCCTTTCTATGCCAGGAGTCCCCAAAGCTCCACCCATGCAAGTAGAAGGATCTGCCAAGGAATTACAGGCACCA
CGGAAACGCACAGTCAAAGTGACACTGACACCTCTAAAAATGGAAAATGAGAGTCAATCCAAAAATGCCCTGAAAGAAAGTAGTCCTGCT
TCCCCTTTGCAAATAGAGTCAACATCTCCCACAGAACCAATTTCAGCCTCTGAAAATCCAGGAGATGGTCCAGTGGCCCAACCAAGCCCC
AATAATACCTCATGCCAGGATTCTCAAAGTAACAACTATCAGAATCTTCCAGTACAGGACAGAAACCTAATGCTTCCAGATGGCCCCAAA
CCTCAGGAGGATGGCTCTTTTAAAAGGAGGTATCCCCGTCGCAGTGCCCGTGCACGTTCTAACATGTTTTTTGGGCTTACCCCACTCTAT
GGAGTAAGATCCTATGGTGAAGAAGACATTCCATTCTACAGCAGCTCAACTGGGAAGAAGCGAGGCAAGAGATCAGCTGAAGGACAGGTG
GATGGGGCCGATGACTTAAGCACTTCAGATGAAGACGACTTATACTATTACAACTTCACTAGAACAGTGATTTCTTCAGGTGGAGAGGAA
CGACTGGCATCCCATAATTTATTTCGGGAGGAGGAACAGTGTGATCTTCCAAAAATCTCACAGTTGGATGGTGTTGATGATGGGACAGAG
AGTGATACTAGTGTCACAGCCACAACAAGGAAAAGCAGCCAGATTCCAAAAAGAAATGGTAAAGAAAATGGAACAGAGAACTTAAAGATT
GATAGACCTGAAGATGCTGGGGAGAAAGAACATGTCACTAAGAGTTCTGTTGGCCACAAAAATGAGCCAAAGATGGATAACTGCCATTCT
GTAAGCAGAGTTAAAACACAGGGACAAGATTCCTTGGAAGCTCAGCTCAGCTCATTGGAGTCAAGCCGCAGAGTCCACACAAGTACCCCC
TCCGACAAAAATTTACTGGACACCTATAATACTGAGCTCCTGAAATCAGATTCAGACAATAACAACAGTGATGACTGTGGGAATATCCTG
CCTTCAGACATTATGGACTTTGTACTAAAGAATACTCCATCCATGCAGGCTTTGGGTGAGAGCCCAGAGTCATCTTCATCAGAACTCCTG
AATCTTGGTGAAGGATTGGGTCTTGACAGTAATCGTGAAAAAGACATGGGTCTTTTTGAAGTATTTTCTCAGCAGCTGCCTACAACAGAA
CCTGTGGATAGTAGTGTCTCTTCCTCTATCTCAGCAGAGGAACAGTTTGAGTTGCCTCTAGAGCTACCATCTGATCTGTCTGTCTTGACC
ACCCGGAGTCCCACTGTCCCCAGCCAGAATCCCAGTAGACTAGCTGTTATCTCAGACTCAGGGGAGAAGAGAGTAACCATCACAGAAAAA
TCTGTAGCCTCCTCTGAAAGTGACCCAGCACTGCTGAGCCCAGGAGTAGATCCAACTCCTGAAGGCCACATGACTCCTGATCATTTTATC
CAAGGACACATGGATGCAGACCACATCTCTAGCCCTCCTTGTGGTTCAGTAGAGCAAGGTCATGGCAACAATCAGGATTTAACTAGGAAC
AGTAGCACCCCTGGCCTTCAGGTACCTGTTTCCCCAACTGTTCCCATCCAGAACCAGAAGTATGTGCCCAATTCTACTGATAGTCCTGGC
CCGTCTCAGATTTCCAATGCAGCTGTCCAGACCACTCCACCCCACCTGAAGCCAGCCACTGAGAAACTCATAGTTGTTAACCAGAACATG
CAGCCACTTTATGTTCTCCAAACTCTTCCAAATGGAGTGACCCAAAAAATCCAATTGACCTCTTCTGTTAGTTCTACACCCAGTGTGATG
GAGACAAATACTTCAGTATTGGGACCCATGGGAGGTGGTCTCACCCTTACCACAGGACTAAATCCAAGCTTGCCAACTTCTCAATCTTTG
TTCCCTTCTGCTAGCAAAGGATTGCTACCCATGTCTCATCACCAGCACTTACATTCCTTCCCTGCAGCTACTCAAAGTAGTTTCCCACCA
AACATCAGCAATCCTCCTTCAGGCCTGCTTATTGGGGTTCAGCCTCCTCCGGATCCCCAACTTTTGGTTTCAGAATCCAGCCAGAGGACA
GACCTCAGTACCACAGTAGCCACTCCATCCTCTGGACTCAAGAAAAGACCCATATCTCGTCTACAGACCCGAAAGAATAAAAAACTTGCT
CCCTCTAGTACCCCTTCAAACATTGCCCCTTCTGATGTGGTTTCTAATATGACATTGATTAACTTCACACCCTCCCAGCTTCCTAATCAT
CCAAGTCTGTTAGATTTGGGGTCACTTAATACTTCATCTCACCGAACTGTCCCCAACATCATAAAAAGATCTAAATCTAGCATCATGTAT
TTTGAACCGGCACCCCTGTTACCACAGAGTGTGGGAGGAACTGCTGCCACAGCGGCAGGCACATCAACAATAAGCCAGGATACTAGCCAC
CTCACATCAGGGTCTGTGTCTGGCTTGGCATCCAGTTCCTCTGTCTTGAATGTTGTATCCATGCAAACTACCACAACCCCTACAAGTAGT
GCGTCAGTTCCAGGACACGTCACCTTAACCAACCCAAGGTTGCTTGGTACCCCAGATATTGGCTCAATAAGCAATCTTTTAATCAAAGCT
AGCCAGCAGAGCCTGGGGATTCAGGACCAGCCTGTGGCTTTACCGCCAAGTTCAGGAATGTTTCCACAACTGGGGACATCACAGACCCCC
TCTACTGCTGCAATAACAGCGGCATCTAGCATCTGTGTGCTCCCCTCCACTCAGACTACGGGCATAACAGCCGCTTCACCTTCTGGGGAA
GCAGACGAACACTATCAGCTTCAGCATGTGAACCAGCTCCTTGCCAGCAAAACTGGGATTCATTCTTCCCAGCGTGATCTTGATTCTGCT
TCAGGGCCCCAGGTATCCAACTTTACCCAGACGGTAGACGCTCCTAATAGCATGGGACTGGAGCAGAACAAGGCTTTATCCTCAGCTGTG
CAAGCCAGCCCCACCTCTCCTGGGGGTTCTCCATCCTCTCCATCTTCTGGACAGCGGTCAGCAAGCCCTTCAGTGCCGGGTCCCACTAAA
CCCAAACCAAAAACCAAACGGTTTCAGCTGCCTCTAGACAAAGGGAATGGCAAGAAGCACAAAGTTTCCCATTTGCGGACCAGTTCTTCT
GAAGCACACATTCCAGACCAAGAAACGACATCCCTGACCTCAGGCACAGGGACTCCAGGAGCAGAGGCTGAGCAGCAGGATACAGCTAGC
GTGGAGCAGTCCTCCCAGAAGGAGTGTGGGCAACCTGCAGGGCAAGTCGCTGTTCTTCCGGAAGTTCAGGTGACCCAAAATCCAGCAAAT
GAACAAGAAAGTGCAGAACCTAAAACAGTGGAAGAAGAGGAAAGTAATTTCAGCTCCCCACTGATGCTTTGGCTTCAGCAAGAACAAAAG
CGGAAGGAAAGCATTACTGAGAAAAAACCCAAGAAAGGACTTGTTTTTGAAATTTCCAGTGATGATGGCTTTCAGATCTGTGCAGAAAGT
ATTGAAGATGCCTGGAAGTCATTGACAGATAAAGTCCAGGAAGCTCGATCAAATGCCCGCCTAAAGCAGCTCTCATTTGCAGGTGTTAAC
GGTTTGAGGATGCTGGGGATTCTCCATGATGCAGTTGTGTTCCTCATTGAGCAGCTGTCTGGTGCCAAGCACTGTCGAAATTACAAATTC
CGTTTCCACAAGCCAGAGGAGGCCAATGAACCCCCCTTGAACCCTCACGGCTCAGCCAGGGCTGAAGTCCACCTCAGGAAGTCAGCATTT
GACATGTTTAACTTCCTGGCTTCTAAACATCGTCAGCCTCCTGAATACAACCCCAATGATGAAGAAGAGGAGGAGGTACAGCTGAAGTCA
GCTCGGAGGGCAACTAGCATGGATCTGCCAATGCCCATGCGCTTCCGGCACTTAAAAAAGACTTCTAAGGAGGCAGTTGGTGTCTACAGG
TCTCCCATCCATGGCCGGGGTCTTTTCTGTAAGAGAAACATTGATGCAGGTGAGATGGTGATTGAGTATGCCGGCAACGTCATCCGCTCC
ATCCAGACTGACAAGCGGGAAAAGTATTACGACAGCAAGGGCATTGGTTGCTATATGTTCCGAATTGATGACTCAGAGGTAGTGGATGCC
ACCATGCATGGAAATGCTGCACGCTTCATCAATCACTCGTGTGAGCCTAACTGCTATTCTCGGGTCATCAATATTGATGGGCAGAAGCAC
ATTGTCATCTTTGCCATGCGTAAGATCTACCGAGGAGAGGAACTCACTTACGACTATAAGTTCCCCATTGAGGATGCCAGCAACAAGCTG
CCCTGCAACTGTGGCGCCAAGAAATGCCGGAAGTTCCTAAACTAAAGCTGCTCTTCTCCCCCAGTGTTGGAGTGCAAGGAGGCGGGGCCA
TCCAAAGCAACGCTGAAGGCCTTTTCCAGCAGCTGGGAGCTCCCGGATTGCGTGGCACAGCTGAGGGGCCTCTGTGATGGCTGAGCTCTC
TTATGTCCTATACTCACATCAGACATGTGATCATAGTCCCAGAGACAGAGTTGAGGTCTCGAAGAAAAGATCCATGATCGGCTTTCTCCT
GGGGCCCCTCCAATTGTTTACTGTTAGAAAGTGGGAATGGGGTCCCTAGCAGACTTGCCTGGAAGGAGCCTATTATAGAGGGTTGGTTAT
GTTGGGAGATTGGGCCTGAATTTCTCCACAGAAATAAGTTGCCATCCTCAGGTTGGCCCTTTCCCAAGCACTGTAAGTGAGTGGGTCAGG
CAAAGCCCCAAATGGAGGGTTGGTTAGATTCCTGACAGTTTGCCAGCCAGGCCCCACCTACAGCGTCTGTCGAACAAACAGAGGTCTGGT
GGTTTTCCCTACTATCCTCCCACTCGAGAGTTCACTTCTGGTTGGGAGACAGGATTCCTAGCACCTCCGGTGTCAAAAGGCTGTCATGGG
GTTGTGCCAATTAATTACCAAACATTGAGCCTGCAGGCTTTGAGTGGGAGTGTTGCCCCCAGGAGCCTTATCTCAGCCAATTACCTTTCT
TGACAGTAGGAGCGGCTTCCCTCTCCCATTCCCTCTTCACTCCCTTTTCTTCCTTTCCCCTGTCTTCATGCCACTGCTTTCCCATGCTTC
TTTCGGGTTGTAGGGGAGACTGACTGCCTGCTCAAGGACACTCCCTGCTGGGCATAGGATGTGCCTGCAAAAAGTTCCCTGAGCCTGTAA
GCACTCCAGGTGGGGAAGTGGACAGGAGCCATTGGTCATAACCAGACAGAATTTGGAAACATTTTCATAAAGCTCCATGGAGAGTTTTAA
AGAAACATATGTAGCATGATTTTGTAGGAGAGGAAAAAGATTATTTAAATAGGATTTAAATCATGCAACAACGAGAGTATCACAGCCAGG
ATGACCCTTGGGTCCCATTCCTAAGACATGGTTACTTTATTTTCCCCTTGTTAAGACATAGGAAGACTTAATTTTTAAACGGTCAGTGTC
CAGTTGAAGGCAGAACACTAATCAGATTTCAAGGCCCACAACTTGGGGACTAGACCACCTTATGTTGAGGGAACTCTGCCACCTGCGTGC
AACCCACAGCTAAAGTAAATTCAATGACACTACTGCCCTGATTACTCCTTAGGATGTGGTCAAAACAGCATCAAATGTTTCTTCTCTTCC
TTTCCCCAAGACAGAGTCCTGAACCTGTTAAATTAAGTCATTGGATTTTACTCTGTTCTGTTTACAGTTTACTATTTAAGGTTTTATAAA
TGTAAATATATTTTGTATATTTTTCTATGAGAAGCACTTCATAGGGAGAAGCACTTATGACAAGGCTATTTTTTAAACCGCGGTATTATC
CTAATTTAAAAGAAGATCGGTTTTTAATAATTTTTTATTTTCATAGGATGAAGTTAGAGAAAATATTCAGCTGTACACACAAAGTCTGGT
TTTTCCTGCCCAACTTCCCCCTGGAAGGTGTACTTTTTGTTGTTTAATGTGTAGCTTGTTTGTGCCCTGTTGACATAAATGTTTCCTGGG

>In-frame_ELL_ENST00000262809_chr19_18632731_-_KMT2A_ENST00000354520_chr11_118359327_+_10309nt
GGCGGGGCGGGGCGTGGCCGGCGTGGCGGCGCTGGAGCCGGGAAGGGGGCGCGGGGGAGAGATGGTCGCAAGATGGCGGCGCTGAAGGAG
GATAGGAGCTACGGGCTGTCGTGCGGGCGGGTTAGCGACGGCAGCAAGGTGTCGGTGTTCCACGTGAAGCTCACCGACAGTGCCCTGAGG
GCCTTCGAGAGCTACCGCGCCAGACAGTTTGTGTATTGCCAAGTCTGTTGTGAGCCCTTCCACAAGTTTTGTTTAGAGGAGAACGAGCGC
CCTCTGGAGGACCAGCTGGAAAATTGGTGTTGTCGTCGTTGCAAATTCTGTCACGTTTGTGGAAGGCAACATCAGGCTACAAAGCAGCTG
CTGGAGTGTAATAAGTGCCGAAACAGCTATCACCCTGAGTGCCTGGGACCAAACTACCCCACCAAACCCACAAAGAAGAAGAAAGTCTGG
ATCTGTACCAAGTGTGTTCGCTGTAAGAGCTGTGGATCCACAACTCCAGGCAAAGGGTGGGATGCACAGTGGTCTCATGATTTCTCACTG
TGTCATGATTGCGCCAAGCTCTTTGCTAAAGGAAACTTCTGCCCTCTCTGTGACAAATGTTATGATGATGATGACTATGAGAGTAAGATG
ATGCAATGTGGAAAGTGTGATCGCTGGGTCCATTCCAAATGTGAGAATCTTTCAGATGAGATGTATGAGATTCTATCTAATCTGCCAGAA
AGTGTGGCCTACACTTGTGTGAACTGTACTGAGCGGCACCCTGCAGAGTGGCGACTGGCCCTTGAAAAAGAGCTGCAGATTTCTCTGAAG
CAAGTTCTGACAGCTTTGTTGAATTCTCGGACTACCAGCCATTTGCTACGCTACCGGCAGGCTGCCAAGCCTCCAGACTTAAATCCCGAG
ACAGAGGAGAGTATACCTTCCCGCAGCTCCCCCGAAGGACCTGATCCACCAGTTCTTACTGAGGTCAGCAAACAGGATGATCAGCAGCCT
TTAGATCTAGAAGGAGTCAAGAGGAAGATGGACCAAGGGAATTACACATCTGTGTTGGAGTTCAGTGATGATATTGTGAAGATCATTCAA
GCAGCCATTAATTCAGATGGAGGACAGCCAGAAATTAAAAAAGCCAACAGCATGGTCAAGTCCTTCTTCATTCGGCAAATGGAACGTGTT
TTTCCATGGTTCAGTGTCAAAAAGTCCAGGTTTTGGGAGCCAAATAAAGTATCAAGCAACAGTGGGATGTTACCAAACGCAGTGCTTCCA
CCTTCACTTGACCATAATTATGCTCAGTGGCAGGAGCGAGAGGAAAACAGCCACACTGAGCAGCCTCCTTTAATGAAGAAAATCATTCCA
GCTCCCAAACCCAAAGGTCCTGGAGAACCAGACTCACCAACTCCTCTGCATCCTCCTACACCACCAATTTTGAGTACTGATAGGAGTCGA
GAAGACAGTCCAGAGCTGAACCCACCCCCAGGCATAGAAGACAATAGACAGTGTGCGTTATGTTTGACTTATGGTGATGACAGTGCTAAT
GATGCTGGTCGTTTACTATATATTGGCCAAAATGAGTGGACACATGTAAATTGTGCTTTGTGGTCAGCGGAAGTGTTTGAAGATGATGAC
GGATCACTAAAGAATGTGCATATGGCTGTGATCAGGGGCAAGCAGCTGAGATGTGAATTCTGCCAAAAGCCAGGAGCCACCGTGGGTTGC
TGTCTCACATCCTGCACCAGCAACTATCACTTCATGTGTTCCCGAGCCAAGAACTGTGTCTTTCTGGATGATAAAAAAGTATATTGCCAA
CGACATCGGGATTTGATCAAAGGCGAAGTGGTTCCTGAGAATGGATTTGAAGTTTTCAGAAGAGTGTTTGTGGACTTTGAAGGAATCAGC
TTGAGAAGGAAGTTTCTCAATGGCTTGGAACCAGAAAATATCCACATGATGATTGGGTCTATGACAATCGACTGCTTAGGAATTCTAAAT
GATCTCTCCGACTGTGAAGATAAGCTCTTTCCTATTGGATATCAGTGTTCCAGGGTATACTGGAGCACCACAGATGCTCGCAAGCGCTGT
GTATATACATGCAAGATAGTGGAGTGCCGTCCTCCAGTCGTAGAGCCGGATATCAACAGCACTGTTGAACATGATGAAAACAGGACCATT
GCCCATAGTCCAACATCTTTTACAGAAAGTTCATCAAAAGAGAGTCAAAACACAGCTGAAATTATAAGTCCTCCATCACCAGACCGACCT
CCTCATTCACAAACCTCTGGCTCCTGTTATTATCATGTCATCTCAAAGGTCCCCAGGATTCGAACACCCAGTTATTCTCCAACACAGAGA
TCCCCTGGCTGTCGACCGTTGCCTTCTGCAGGAAGTCCTACCCCAACCACTCATGAAATAGTCACAGTAGGTGATCCTTTACTCTCCTCT
GGACTTCGAAGCATTGGCTCCAGGCGTCACAGTACCTCTTCCTTATCACCCCAGCGGTCCAAACTCCGGATAATGTCTCCAATGAGAACT
GGGAATACTTACTCTAGGAATAATGTTTCCTCAGTCTCCACCACCGGGACCGCTACTGATCTTGAATCAAGTGCCAAAGTAGTTGATCAT
GTCTTAGGGCCACTGAATTCAAGTACTAGTTTAGGGCAAAACACTTCCACCTCTTCAAATTTGCAAAGGACAGTGGTTACTGTAGGCAAT
AAAAACAGTCACTTGGATGGATCTTCATCTTCAGAAATGAAGCAGTCCAGTGCTTCAGACTTGGTGTCCAAGAGCTCCTCTTTAAAGGGA
GAGAAGACCAAAGTGCTGAGTTCCAAGAGCTCAGAGGGATCTGCACATAATGTGGCTTACCCTGGAATTCCTAAACTGGCCCCACAGGTT
CATAACACAACATCTAGAGAACTGAATGTTAGTAAAATCGGCTCCTTTGCTGAACCCTCTTCAGTGTCGTTTTCTTCTAAAGAGGCCCTC
TCCTTCCCACACCTCCATTTGAGAGGGCAAAGGAATGATCGAGACCAACACACAGATTCTACCCAATCAGCAAACTCCTCTCCAGATGAA
GATACTGAAGTCAAAACCTTGAAGCTATCTGGAATGAGCAACAGATCATCCATTATCAACGAACATATGGGATCTAGTTCCAGAGATAGG
AGACAGAAAGGGAAAAAATCCTGTAAAGAAACTTTCAAAGAAAAGCATTCCAGTAAATCTTTTTTGGAACCTGGTCAGGTGACAACTGGT
GAGGAAGGAAACTTGAAGCCAGAGTTTATGGATGAGGTTTTGACTCCTGAGTATATGGGCCAACGACCATGTAACAATGTTTCTTCTGAT
AAGATTGGTGATAAAGGCCTTTCTATGCCAGGAGTCCCCAAAGCTCCACCCATGCAAGTAGAAGGATCTGCCAAGGAATTACAGGCACCA
CGGAAACGCACAGTCAAAGTGACACTGACACCTCTAAAAATGGAAAATGAGAGTCAATCCAAAAATGCCCTGAAAGAAAGTAGTCCTGCT
TCCCCTTTGCAAATAGAGTCAACATCTCCCACAGAACCAATTTCAGCCTCTGAAAATCCAGGAGATGGTCCAGTGGCCCAACCAAGCCCC
AATAATACCTCATGCCAGGATTCTCAAAGTAACAACTATCAGAATCTTCCAGTACAGGACAGAAACCTAATGCTTCCAGATGGCCCCAAA
CCTCAGGAGGATGGCTCTTTTAAAAGGAGGTATCCCCGTCGCAGTGCCCGTGCACGTTCTAACATGTTTTTTGGGCTTACCCCACTCTAT
GGAGTAAGATCCTATGGTGAAGAAGACATTCCATTCTACAGCAGCTCAACTGGGAAGAAGCGAGGCAAGAGATCAGCTGAAGGACAGGTG
GATGGGGCCGATGACTTAAGCACTTCAGATGAAGACGACTTATACTATTACAACTTCACTAGAACAGTGATTTCTTCAGGTGGAGAGGAA
CGACTGGCATCCCATAATTTATTTCGGGAGGAGGAACAGTGTGATCTTCCAAAAATCTCACAGTTGGATGGTGTTGATGATGGGACAGAG
AGTGATACTAGTGTCACAGCCACAACAAGGAAAAGCAGCCAGATTCCAAAAAGAAATGGTAAAGAAAATGGAACAGAGAACTTAAAGATT
GATAGACCTGAAGATGCTGGGGAGAAAGAACATGTCACTAAGAGTTCTGTTGGCCACAAAAATGAGCCAAAGATGGATAACTGCCATTCT
GTAAGCAGAGTTAAAACACAGGGACAAGATTCCTTGGAAGCTCAGCTCAGCTCATTGGAGTCAAGCCGCAGAGTCCACACAAGTACCCCC
TCCGACAAAAATTTACTGGACACCTATAATACTGAGCTCCTGAAATCAGATTCAGACAATAACAACAGTGATGACTGTGGGAATATCCTG
CCTTCAGACATTATGGACTTTGTACTAAAGAATACTCCATCCATGCAGGCTTTGGGTGAGAGCCCAGAGTCATCTTCATCAGAACTCCTG
AATCTTGGTGAAGGATTGGGTCTTGACAGTAATCGTGAAAAAGACATGGGTCTTTTTGAAGTATTTTCTCAGCAGCTGCCTACAACAGAA
CCTGTGGATAGTAGTGTCTCTTCCTCTATCTCAGCAGAGGAACAGTTTGAGTTGCCTCTAGAGCTACCATCTGATCTGTCTGTCTTGACC
ACCCGGAGTCCCACTGTCCCCAGCCAGAATCCCAGTAGACTAGCTGTTATCTCAGACTCAGGGGAGAAGAGAGTAACCATCACAGAAAAA
TCTGTAGCCTCCTCTGAAAGTGACCCAGCACTGCTGAGCCCAGGAGTAGATCCAACTCCTGAAGGCCACATGACTCCTGATCATTTTATC
CAAGGACACATGGATGCAGACCACATCTCTAGCCCTCCTTGTGGTTCAGTAGAGCAAGGTCATGGCAACAATCAGGATTTAACTAGGAAC
AGTAGCACCCCTGGCCTTCAGGTACCTGTTTCCCCAACTGTTCCCATCCAGAACCAGAAGTATGTGCCCAATTCTACTGATAGTCCTGGC
CCGTCTCAGATTTCCAATGCAGCTGTCCAGACCACTCCACCCCACCTGAAGCCAGCCACTGAGAAACTCATAGTTGTTAACCAGAACATG
CAGCCACTTTATGTTCTCCAAACTCTTCCAAATGGAGTGACCCAAAAAATCCAATTGACCTCTTCTGTTAGTTCTACACCCAGTGTGATG
GAGACAAATACTTCAGTATTGGGACCCATGGGAGGTGGTCTCACCCTTACCACAGGACTAAATCCAAGCTTGCCAACTTCTCAATCTTTG
TTCCCTTCTGCTAGCAAAGGATTGCTACCCATGTCTCATCACCAGCACTTACATTCCTTCCCTGCAGCTACTCAAAGTAGTTTCCCACCA
AACATCAGCAATCCTCCTTCAGGCCTGCTTATTGGGGTTCAGCCTCCTCCGGATCCCCAACTTTTGGTTTCAGAATCCAGCCAGAGGACA
GACCTCAGTACCACAGTAGCCACTCCATCCTCTGGACTCAAGAAAAGACCCATATCTCGTCTACAGACCCGAAAGAATAAAAAACTTGCT
CCCTCTAGTACCCCTTCAAACATTGCCCCTTCTGATGTGGTTTCTAATATGACATTGATTAACTTCACACCCTCCCAGCTTCCTAATCAT
CCAAGTCTGTTAGATTTGGGGTCACTTAATACTTCATCTCACCGAACTGTCCCCAACATCATAAAAAGATCTAAATCTAGCATCATGTAT
TTTGAACCGGCACCCCTGTTACCACAGAGTGTGGGAGGAACTGCTGCCACAGCGGCAGGCACATCAACAATAAGCCAGGATACTAGCCAC
CTCACATCAGGGTCTGTGTCTGGCTTGGCATCCAGTTCCTCTGTCTTGAATGTTGTATCCATGCAAACTACCACAACCCCTACAAGTAGT
GCGTCAGTTCCAGGACACGTCACCTTAACCAACCCAAGGTTGCTTGGTACCCCAGATATTGGCTCAATAAGCAATCTTTTAATCAAAGCT
AGCCAGCAGAGCCTGGGGATTCAGGACCAGCCTGTGGCTTTACCGCCAAGTTCAGGAATGTTTCCACAACTGGGGACATCACAGACCCCC
TCTACTGCTGCAATAACAGCGGCATCTAGCATCTGTGTGCTCCCCTCCACTCAGACTACGGGCATAACAGCCGCTTCACCTTCTGGGGAA
GCAGACGAACACTATCAGCTTCAGCATGTGAACCAGCTCCTTGCCAGCAAAACTGGGATTCATTCTTCCCAGCGTGATCTTGATTCTGCT
TCAGGGCCCCAGGTATCCAACTTTACCCAGACGGTAGACGCTCCTAATAGCATGGGACTGGAGCAGAACAAGGCTTTATCCTCAGCTGTG
CAAGCCAGCCCCACCTCTCCTGGGGGTTCTCCATCCTCTCCATCTTCTGGACAGCGGTCAGCAAGCCCTTCAGTGCCGGGTCCCACTAAA
CCCAAACCAAAAACCAAACGGTTTCAGCTGCCTCTAGACAAAGGGAATGGCAAGAAGCACAAAGTTTCCCATTTGCGGACCAGTTCTTCT
GAAGCACACATTCCAGACCAAGAAACGACATCCCTGACCTCAGGCACAGGGACTCCAGGAGCAGAGGCTGAGCAGCAGGATACAGCTAGC
GTGGAGCAGTCCTCCCAGAAGGAGTGTGGGCAACCTGCAGGGCAAGTCGCTGTTCTTCCGGAAGTTCAGGTGACCCAAAATCCAGCAAAT
GAACAAGAAAGTGCAGAACCTAAAACAGTGGAAGAAGAGGAAAGTAATTTCAGCTCCCCACTGATGCTTTGGCTTCAGCAAGAACAAAAG
CGGAAGGAAAGCATTACTGAGAAAAAACCCAAGAAAGGACTTGTTTTTGAAATTTCCAGTGATGATGGCTTTCAGATCTGTGCAGAAAGT
ATTGAAGATGCCTGGAAGTCATTGACAGATAAAGTCCAGGAAGCTCGATCAAATGCCCGCCTAAAGCAGCTCTCATTTGCAGGTGTTAAC
GGTTTGAGGATGCTGGGGATTCTCCATGATGCAGTTGTGTTCCTCATTGAGCAGCTGTCTGGTGCCAAGCACTGTCGAAATTACAAATTC
CGTTTCCACAAGCCAGAGGAGGCCAATGAACCCCCCTTGAACCCTCACGGCTCAGCCAGGGCTGAAGTCCACCTCAGGAAGTCAGCATTT
GACATGTTTAACTTCCTGGCTTCTAAACATCGTCAGCCTCCTGAATACAACCCCAATGATGAAGAAGAGGAGGAGGTACAGCTGAAGTCA
GCTCGGAGGGCAACTAGCATGGATCTGCCAATGCCCATGCGCTTCCGGCACTTAAAAAAGACTTCTAAGGAGGCAGTTGGTGTCTACAGG
TCTCCCATCCATGGCCGGGGTCTTTTCTGTAAGAGAAACATTGATGCAGGTGAGATGGTGATTGAGTATGCCGGCAACGTCATCCGCTCC
ATCCAGACTGACAAGCGGGAAAAGTATTACGACAGCAAGGGCATTGGTTGCTATATGTTCCGAATTGATGACTCAGAGGTAGTGGATGCC
ACCATGCATGGAAATGCTGCACGCTTCATCAATCACTCGTGTGAGCCTAACTGCTATTCTCGGGTCATCAATATTGATGGGCAGAAGCAC
ATTGTCATCTTTGCCATGCGTAAGATCTACCGAGGAGAGGAACTCACTTACGACTATAAGTTCCCCATTGAGGATGCCAGCAACAAGCTG
CCCTGCAACTGTGGCGCCAAGAAATGCCGGAAGTTCCTAAACTAAAGCTGCTCTTCTCCCCCAGTGTTGGAGTGCAAGGAGGCGGGGCCA
TCCAAAGCAACGCTGAAGGCCTTTTCCAGCAGCTGGGAGCTCCCGGATTGCGTGGCACAGCTGAGGGGCCTCTGTGATGGCTGAGCTCTC
TTATGTCCTATACTCACATCAGACATGTGATCATAGTCCCAGAGACAGAGTTGAGGTCTCGAAGAAAAGATCCATGATCGGCTTTCTCCT
GGGGCCCCTCCAATTGTTTACTGTTAGAAAGTGGGAATGGGGTCCCTAGCAGACTTGCCTGGAAGGAGCCTATTATAGAGGGTTGGTTAT
GTTGGGAGATTGGGCCTGAATTTCTCCACAGAAATAAGTTGCCATCCTCAGGTTGGCCCTTTCCCAAGCACTGTAAGTGAGTGGGTCAGG
CAAAGCCCCAAATGGAGGGTTGGTTAGATTCCTGACAGTTTGCCAGCCAGGCCCCACCTACAGCGTCTGTCGAACAAACAGAGGTCTGGT
GGTTTTCCCTACTATCCTCCCACTCGAGAGTTCACTTCTGGTTGGGAGACAGGATTCCTAGCACCTCCGGTGTCAAAAGGCTGTCATGGG
GTTGTGCCAATTAATTACCAAACATTGAGCCTGCAGGCTTTGAGTGGGAGTGTTGCCCCCAGGAGCCTTATCTCAGCCAATTACCTTTCT
TGACAGTAGGAGCGGCTTCCCTCTCCCATTCCCTCTTCACTCCCTTTTCTTCCTTTCCCCTGTCTTCATGCCACTGCTTTCCCATGCTTC
TTTCGGGTTGTAGGGGAGACTGACTGCCTGCTCAAGGACACTCCCTGCTGGGCATAGGATGTGCCTGCAAAAAGTTCCCTGAGCCTGTAA
GCACTCCAGGTGGGGAAGTGGACAGGAGCCATTGGTCATAACCAGACAGAATTTGGAAACATTTTCATAAAGCTCCATGGAGAGTTTTAA
AGAAACATATGTAGCATGATTTTGTAGGAGAGGAAAAAGATTATTTAAATAGGATTTAAATCATGCAACAACGAGAGTATCACAGCCAGG
ATGACCCTTGGGTCCCATTCCTAAGACATGGTTACTTTATTTTCCCCTTGTTAAGACATAGGAAGACTTAATTTTTAAACGGTCAGTGTC
CAGTTGAAGGCAGAACACTAATCAGATTTCAAGGCCCACAACTTGGGGACTAGACCACCTTATGTTGAGGGAACTCTGCCACCTGCGTGC
AACCCACAGCTAAAGTAAATTCAATGACACTACTGCCCTGATTACTCCTTAGGATGTGGTCAAAACAGCATCAAATGTTTCTTCTCTTCC
TTTCCCCAAGACAGAGTCCTGAACCTGTTAAATTAAGTCATTGGATTTTACTCTGTTCTGTTTACAGTTTACTATTTAAGGTTTTATAAA
TGTAAATATATTTTGTATATTTTTCTATGAGAAGCACTTCATAGGGAGAAGCACTTATGACAAGGCTATTTTTTAAACCGCGGTATTATC
CTAATTTAAAAGAAGATCGGTTTTTAATAATTTTTTATTTTCATAGGATGAAGTTAGAGAAAATATTCAGCTGTACACACAAAGTCTGGT
TTTTCCTGCCCAACTTCCCCCTGGAAGGTGTACTTTTTGTTGTTTAATGTGTAGCTTGTTTGTGCCCTGTTGACATAAATGTTTCCTGGG
TTTGCTCTTTGACAATAAATGGAGAAGGAAGGTCACCCAACTCCATTGGGCCACTCCCCTCCTTCCCCTATTGAAGCTCCTCAAAAGGCT
ACAGTAATATCTTGATACAACAGATTCTCTTCTTTCCCGCCTCTCTCCTTTCCGGCGCAACTTCCAGAGTGGTGGGAGACGGCAATCTTT
ACATTTCCCTCATCTTTCTTACTTCAGAGTTAGCAAACAACAAGTTGAATGGCAACTTGACATTTTTGCATCACCATCTGCCTCATAGGC
CACTCTTTCCTTTCCCTCTGCCCACCAAGTCCTCATATCTGCAGAGAACCCATTGATCACCTTGTGCCCTCTTTTGGGGCAGCCTGTTGA
AACTGAAGCACAGTCTGACCACTCACGATAAAGCAGATTTTTCTCTGCCTCTGCCACAAGGTTTCAGAGTAGTGTAGTCCAAGTAGAGGG
TGGGGCACCCTTTTCTCGCCGCAAGAAGCCCATTCCTATGGAAGTCTAGCAAAGCAATACGACTCAGCCCAGCACTCTCTGCCCCAGGAC
TCATGGCTCTGCTGTGCCTTCCATCCTGGGCTCCCTTCTCTCCTGTGACCTTAAGAACTTTGTCTGGTGGCTTTGCTGGAACATTGTCAC
TGTTTTCACTGTCATGCAGGGAGCCCAGCACTGTGGCCAGGATGGCAGAGACTTCCTTGTCATCATGGAGAAGTGCCAGCAGGGGACTGG
GAAAAGCACTCTACCCAGACCTCACCTCCCTTCCTCCTTTTGCCCATGAACAAGATGCAGTGGCCCTAGGGGTTCCACTAGTGTCTGCTT


Top

FusionGenePPI for ELL_KMT2A


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
ELLSIRT2, ZHX1, TP53, EAF1, EAF2, SNF8, USPL1, MLLT3, MLLT1, KMT2A, TFPT, UBC, MED26, ICE2, ICE1, AFF4, CDK9, MCM2, SNRPA1, ELL3, DENND2D, OFD1, DYNLL1, CTR9, HUWE1, NCBP2, FGFR1OP2, SIKE1, VWA9, ASPM, CAMKV, PIP4K2A, TRIM25KMT2APPIE, PPP1R15A, KMT2A, ASH2L, HCFC1, HCFC2, MEN1, RBBP5, WDR5, AVP, INS, OXT, MAP3K5, HDAC1, CTBP1, CBX4, BMI1, CREBBP, SMARCB1, CXXC1, MYB, CTNNB1, SNW1, E2F2, E2F4, E2F6, PSIP1, MLLT4, POLR2A, KAT8, RNF2, TP53, SBF1, MTM1, SET, HIST1H3A, HIST1H4A, KAT6A, ELL, AFF1, AFF4, CDK9, CCNT1, CTR9, LEO1, PAF1, CDC73, WDR61, MLLT3, DOT1L, SKP2, HIST3H3, SVIL, HIST2H3C, SIN3A, MLLT1, RUNX1, CBFB, H3F3A, SIRT7, ASB2, TCEB1, TCEB2, CBX8, TOP1, TAF6, NCL, HECW2, LGR4, CSNK2A2, SENP3, SYMPK, PKN1, PIH1D1, KRAS, TAF1, CHD3, SMARCA2, SMARCC2, SMARCC1, HDAC2, RBBP4, RBBP7, TBP, MBD3, SAP30, RAN, TAF9, TASP1, HIST1H2BG, EWSR1, DYNLT1, KIF11, ING4, ZNF131, ASB7


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with
TgeneKMT2Achr19:18632731chr11:118359327ENST00000354520+8351584_160014063932histone H3K4me3
TgeneKMT2Achr19:18632731chr11:118359327ENST00000389506+9361584_160014443970histone H3K4me3
TgeneKMT2Achr19:18632731chr11:118359327ENST00000534358+9361584_160014443973histone H3K4me3
TgeneKMT2Achr19:18632731chr11:118359327ENST00000354520+8353764_377114063932WDR5
TgeneKMT2Achr19:18632731chr11:118359327ENST00000389506+9363764_377114443970WDR5
TgeneKMT2Achr19:18632731chr11:118359327ENST00000534358+9363764_377114443973WDR5


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for ELL_KMT2A


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for ELL_KMT2A


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneKMT2AC0023418leukemia2CTD_human
TgeneKMT2AC0023467Leukemia, Myelocytic, Acute2CTD_human
TgeneKMT2AC0023470Myeloid Leukemia2CTD_human
TgeneKMT2AC1961102Precursor Cell Lymphoblastic Leukemia Lymphoma2CTD_human
TgeneKMT2AC0001418Adenocarcinoma1CTD_human
TgeneKMT2AC0005695Bladder Neoplasm1CTD_human
TgeneKMT2AC0007138Carcinoma, Transitional Cell1CTD_human
TgeneKMT2AC0008625Chromosome Aberrations1CTD_human
TgeneKMT2AC0023448Lymphoid leukemia1CTD_human
TgeneKMT2AC0023465Acute monocytic leukemia1CTD_human
TgeneKMT2AC0023479Acute myelomonocytic leukemia1CTD_human
TgeneKMT2AC0036341Schizophrenia1PSYGENET
TgeneKMT2AC0038356Stomach Neoplasms1CTD_human
TgeneKMT2AC0149925Small cell carcinoma of lung1CTD_human
TgeneKMT2AC2239176Liver carcinoma1CTD_human