FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 11293

FusionGeneSummary for EIF3M_CSTF3

check button Fusion gene summary
Fusion gene informationFusion gene name: EIF3M_CSTF3
Fusion gene ID: 11293
HgeneTgene
Gene symbol

EIF3M

CSTF3

Gene ID

10480

1479

Gene nameeukaryotic translation initiation factor 3 subunit Mcleavage stimulation factor subunit 3
SynonymsB5|GA17|PCID1|TANGO7|hfl-B5CSTF-77
Cytomap

11p13

11p13

Type of geneprotein-codingprotein-coding
Descriptioneukaryotic translation initiation factor 3 subunit MB5 receptorPCI domain containing 1 (herpesvirus entry mediator)PCI domain-containing protein 1dendritic cell proteinfetal lung protein B5transport and golgi organization 7 homologcleavage stimulation factor subunit 3CF-1 77 kDa subunitCSTF 77 kDa subunitcleavage stimulation factor 77 kDa subunitcleavage stimulation factor, 3' pre-RNA, subunit 3, 77kDcleavage stimulation factor, 3' pre-RNA, subunit 3, 77kDa
Modification date2018052320180523
UniProtAcc

Q7L2H7

Q12996

Ensembl transtripts involved in fusion geneENST00000531120, ENST00000524896, 
ENST00000532054, 
ENST00000323959, 
ENST00000524827, ENST00000526480, 
ENST00000438862, ENST00000431742, 
Fusion gene scores* DoF score6 X 7 X 3=1264 X 2 X 3=24
# samples 74
** MAII scorelog2(7/126*10)=-0.84799690655495
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/24*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: EIF3M [Title/Abstract] AND CSTF3 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDOVTCGA-57-1993-01AEIF3Mchr11

32605475

+CSTF3chr11

33163532

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000531120ENST00000323959EIF3Mchr11

32605475

+CSTF3chr11

33163532

-
In-frameENST00000531120ENST00000524827EIF3Mchr11

32605475

+CSTF3chr11

33163532

-
5CDS-5UTRENST00000531120ENST00000526480EIF3Mchr11

32605475

+CSTF3chr11

33163532

-
5CDS-5UTRENST00000531120ENST00000438862EIF3Mchr11

32605475

+CSTF3chr11

33163532

-
5CDS-5UTRENST00000531120ENST00000431742EIF3Mchr11

32605475

+CSTF3chr11

33163532

-
In-frameENST00000524896ENST00000323959EIF3Mchr11

32605475

+CSTF3chr11

33163532

-
In-frameENST00000524896ENST00000524827EIF3Mchr11

32605475

+CSTF3chr11

33163532

-
5CDS-5UTRENST00000524896ENST00000526480EIF3Mchr11

32605475

+CSTF3chr11

33163532

-
5CDS-5UTRENST00000524896ENST00000438862EIF3Mchr11

32605475

+CSTF3chr11

33163532

-
5CDS-5UTRENST00000524896ENST00000431742EIF3Mchr11

32605475

+CSTF3chr11

33163532

-
intron-3CDSENST00000532054ENST00000323959EIF3Mchr11

32605475

+CSTF3chr11

33163532

-
intron-3CDSENST00000532054ENST00000524827EIF3Mchr11

32605475

+CSTF3chr11

33163532

-
intron-5UTRENST00000532054ENST00000526480EIF3Mchr11

32605475

+CSTF3chr11

33163532

-
intron-5UTRENST00000532054ENST00000438862EIF3Mchr11

32605475

+CSTF3chr11

33163532

-
intron-5UTRENST00000532054ENST00000431742EIF3Mchr11

32605475

+CSTF3chr11

33163532

-

Top

FusionProtFeatures for EIF3M_CSTF3


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
EIF3M

Q7L2H7

CSTF3

Q12996

Component of the eukaryotic translation initiationfactor 3 (eIF-3) complex, which is required for several steps inthe initiation of protein synthesis (PubMed:17403899,PubMed:25849773, PubMed:27462815). The eIF-3 complex associateswith the 40S ribosome and facilitates the recruitment of eIF-1,eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNArecruitment to the 43S PIC and scanning of the mRNA for AUGrecognition. The eIF-3 complex is also required for disassemblyand recycling of post-termination ribosomal complexes andsubsequently prevents premature joining of the 40S and 60Sribosomal subunits prior to initiation (PubMed:17403899). The eIF-3 complex specifically targets and initiates translation of asubset of mRNAs involved in cell proliferation, including cellcycling, differentiation and apoptosis, and uses different modesof RNA stem-loop binding to exert either translational activationor repression (PubMed:25849773). {ECO:0000255|HAMAP-Rule:MF_03012,ECO:0000269|PubMed:17403899, ECO:0000269|PubMed:25849773,ECO:0000269|PubMed:27462815}. (Microbial infection) May favor virus entry in case ofinfection with herpes simplex virus 1 (HSV1) or herpes simplexvirus 2 (HSV2). {ECO:0000269|PubMed:15919898}. One of the multiple factors required for polyadenylationand 3'-end cleavage of mammalian pre-mRNAs.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneCSTF3chr11:32605475chr11:33163532ENST00000323959-021559_6269718Compositional biasNote=Pro-rich
TgeneCSTF3chr11:32605475chr11:33163532ENST00000431742-02559_626945Compositional biasNote=Pro-rich
TgeneCSTF3chr11:32605475chr11:33163532ENST00000438862-03559_6269104Compositional biasNote=Pro-rich
TgeneCSTF3chr11:32605475chr11:33163532ENST00000323959-021117_1529718RepeatNote=HAT 3
TgeneCSTF3chr11:32605475chr11:33163532ENST00000323959-021163_1969718RepeatNote=HAT 4
TgeneCSTF3chr11:32605475chr11:33163532ENST00000323959-021221_2619718RepeatNote=HAT 5
TgeneCSTF3chr11:32605475chr11:33163532ENST00000323959-021271_3039718RepeatNote=HAT 6
TgeneCSTF3chr11:32605475chr11:33163532ENST00000323959-021319_3529718RepeatNote=HAT 7
TgeneCSTF3chr11:32605475chr11:33163532ENST00000323959-021354_3879718RepeatNote=HAT 8
TgeneCSTF3chr11:32605475chr11:33163532ENST00000323959-021458_4949718RepeatNote=HAT 9
TgeneCSTF3chr11:32605475chr11:33163532ENST00000323959-02145_779718RepeatNote=HAT 1
TgeneCSTF3chr11:32605475chr11:33163532ENST00000323959-02179_1109718RepeatNote=HAT 2
TgeneCSTF3chr11:32605475chr11:33163532ENST00000431742-02117_152945RepeatNote=HAT 3
TgeneCSTF3chr11:32605475chr11:33163532ENST00000431742-02163_196945RepeatNote=HAT 4
TgeneCSTF3chr11:32605475chr11:33163532ENST00000431742-02221_261945RepeatNote=HAT 5
TgeneCSTF3chr11:32605475chr11:33163532ENST00000431742-02271_303945RepeatNote=HAT 6
TgeneCSTF3chr11:32605475chr11:33163532ENST00000431742-02319_352945RepeatNote=HAT 7
TgeneCSTF3chr11:32605475chr11:33163532ENST00000431742-02354_387945RepeatNote=HAT 8
TgeneCSTF3chr11:32605475chr11:33163532ENST00000431742-02458_494945RepeatNote=HAT 9
TgeneCSTF3chr11:32605475chr11:33163532ENST00000431742-0245_77945RepeatNote=HAT 1
TgeneCSTF3chr11:32605475chr11:33163532ENST00000431742-0279_110945RepeatNote=HAT 2
TgeneCSTF3chr11:32605475chr11:33163532ENST00000438862-03117_1529104RepeatNote=HAT 3
TgeneCSTF3chr11:32605475chr11:33163532ENST00000438862-03163_1969104RepeatNote=HAT 4
TgeneCSTF3chr11:32605475chr11:33163532ENST00000438862-03221_2619104RepeatNote=HAT 5
TgeneCSTF3chr11:32605475chr11:33163532ENST00000438862-03271_3039104RepeatNote=HAT 6
TgeneCSTF3chr11:32605475chr11:33163532ENST00000438862-03319_3529104RepeatNote=HAT 7
TgeneCSTF3chr11:32605475chr11:33163532ENST00000438862-03354_3879104RepeatNote=HAT 8
TgeneCSTF3chr11:32605475chr11:33163532ENST00000438862-03458_4949104RepeatNote=HAT 9
TgeneCSTF3chr11:32605475chr11:33163532ENST00000438862-0345_779104RepeatNote=HAT 1
TgeneCSTF3chr11:32605475chr11:33163532ENST00000438862-0379_1109104RepeatNote=HAT 2

- In-frame and not-retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneEIF3Mchr11:32605475chr11:33163532ENST00000531120+111180_33914375DomainPCI


Top

FusionGeneSequence for EIF3M_CSTF3


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_EIF3M_ENST00000531120_chr11_32605475_+_CSTF3_ENST00000323959_chr11_33163532_-_723aa
MSVPAFIDISEEDQAAEYVPEKVKKAEKKLEENPYDLDAWSILIREAQNQPIDKARKTYERLVAQFPSSGRFWKLYIEAEIKAKNYDKVE
KLFQRCLMKVLHIDLWKCYLSYVRETKGKLPSYKEKMAQAYDFALDKIGMEIMSYQIWVDYINFLKGVEAVGSYAENQRITAVRRVYQRG
CVNPMINIEQLWRDYNKYEEGINIHLAKKMIEDRSRDYMNARRVAKEYETVMKGLDRNAPSVPPQNTPQEAQQVDMWKKYIQWEKSNPLR
TEDQTLITKRVMFAYEQCLLVLGHHPDIWYEAAQYLEQSSKLLAEKGDMNNAKLFSDEAANIYERAISTLLKKNMLLYFAYADYEESRMK
YEKVHSIYNRLLAIEDIDPTLVYIQYMKFARRAEGIKSGRMIFKKAREDTRTRHHVYVTAALMEYYCSKDKSVAFKIFELGLKKYGDIPE
YVLAYIDYLSHLNEDNNTRVLFERVLTSGSLPPEKSGEIWARFLAFESNIGDLASILKVEKRRFTAFKEEYEGKETALLVDRYKFMDLYP
CSASELKALGYKDVSRAKLAAIIPDPVVAPSIVPVLKDEVDRKPEYPKPDTQQMIPFQPRHLAPPGLHPVPGGVFPVPPAAVVLMKLLPP
PICFQGPFVQVDELMEIFRRCKIPNTVEEAVRIITGGAPELAVEGNGPVESNAVLTKAVKRPNEDSDEDEEKGAVVPPVHDIYRARQQKR

>In-frame_EIF3M_ENST00000531120_chr11_32605475_+_CSTF3_ENST00000524827_chr11_33163532_-_159aa
MSVPAFIDISEEDQAAEYVPEKVKKAEKKLEENPYDLDAWSILIREAQNQPIDKARKTYERLVAQFPSSGRFWKLYIEAEIKAKNYDKVE

>In-frame_EIF3M_ENST00000524896_chr11_32605475_+_CSTF3_ENST00000323959_chr11_33163532_-_723aa
MSVPAFIDISEEDQAAEYVPEKVKKAEKKLEENPYDLDAWSILIREAQNQPIDKARKTYERLVAQFPSSGRFWKLYIEAEIKAKNYDKVE
KLFQRCLMKVLHIDLWKCYLSYVRETKGKLPSYKEKMAQAYDFALDKIGMEIMSYQIWVDYINFLKGVEAVGSYAENQRITAVRRVYQRG
CVNPMINIEQLWRDYNKYEEGINIHLAKKMIEDRSRDYMNARRVAKEYETVMKGLDRNAPSVPPQNTPQEAQQVDMWKKYIQWEKSNPLR
TEDQTLITKRVMFAYEQCLLVLGHHPDIWYEAAQYLEQSSKLLAEKGDMNNAKLFSDEAANIYERAISTLLKKNMLLYFAYADYEESRMK
YEKVHSIYNRLLAIEDIDPTLVYIQYMKFARRAEGIKSGRMIFKKAREDTRTRHHVYVTAALMEYYCSKDKSVAFKIFELGLKKYGDIPE
YVLAYIDYLSHLNEDNNTRVLFERVLTSGSLPPEKSGEIWARFLAFESNIGDLASILKVEKRRFTAFKEEYEGKETALLVDRYKFMDLYP
CSASELKALGYKDVSRAKLAAIIPDPVVAPSIVPVLKDEVDRKPEYPKPDTQQMIPFQPRHLAPPGLHPVPGGVFPVPPAAVVLMKLLPP
PICFQGPFVQVDELMEIFRRCKIPNTVEEAVRIITGGAPELAVEGNGPVESNAVLTKAVKRPNEDSDEDEEKGAVVPPVHDIYRARQQKR

>In-frame_EIF3M_ENST00000524896_chr11_32605475_+_CSTF3_ENST00000524827_chr11_33163532_-_159aa
MSVPAFIDISEEDQAAEYVPEKVKKAEKKLEENPYDLDAWSILIREAQNQPIDKARKTYERLVAQFPSSGRFWKLYIEAEIKAKNYDKVE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_EIF3M_ENST00000531120_chr11_32605475_+_CSTF3_ENST00000323959_chr11_33163532_-_2169nt
ATGAGCGTCCCGGCCTTCATCGACATCAGTGAAGAAGATCAGGCAGCTGAGTATGTCCCAGAGAAGGTGAAGAAAGCGGAAAAGAAATTA
GAAGAGAATCCATATGACCTTGATGCTTGGAGCATTCTCATTCGAGAGGCACAGAATCAACCTATAGACAAAGCACGGAAGACTTATGAA
CGCCTTGTTGCCCAGTTCCCCAGTTCTGGCAGATTCTGGAAACTGTACATTGAAGCAGAGATTAAAGCTAAAAATTATGACAAGGTTGAA
AAGCTATTTCAGAGATGCCTTATGAAGGTTTTGCACATTGATTTATGGAAGTGTTATCTTTCATATGTCCGAGAAACCAAGGGTAAACTA
CCAAGTTACAAAGAAAAAATGGCTCAAGCATATGACTTTGCACTGGATAAAATTGGAATGGAAATTATGTCCTATCAGATTTGGGTGGAT
TACATCAATTTCCTAAAAGGCGTGGAAGCTGTAGGATCTTATGCAGAAAATCAAAGAATAACAGCTGTCCGAAGAGTTTATCAACGAGGT
TGTGTTAATCCGATGATCAACATTGAACAGCTCTGGAGAGACTATAACAAGTATGAAGAGGGTATCAATATTCATTTAGCTAAAAAAATG
ATTGAAGATCGGAGTAGAGATTATATGAATGCTAGACGTGTAGCAAAGGAATATGAGACAGTAATGAAAGGCTTGGACCGTAATGCTCCC
TCGGTGCCTCCTCAGAATACTCCTCAAGAAGCTCAACAAGTAGATATGTGGAAGAAATATATACAGTGGGAAAAGAGCAACCCTCTTCGT
ACAGAGGATCAGACCCTTATAACAAAAAGAGTTATGTTTGCTTATGAACAGTGCCTGCTTGTGCTGGGCCATCACCCTGATATTTGGTAT
GAAGCTGCCCAGTATCTTGAGCAGTCAAGTAAACTGCTCGCAGAAAAGGGAGATATGAATAATGCCAAATTATTTAGTGATGAAGCTGCT
AATATATATGAAAGAGCCATAAGCACTTTATTGAAGAAGAATATGCTTCTTTATTTTGCATATGCAGATTATGAAGAGAGTCGCATGAAG
TATGAAAAGGTTCACAGTATATATAACAGACTTCTGGCAATTGAGGATATTGACCCTACCTTGGTATATATCCAATATATGAAATTTGCA
CGGAGAGCAGAAGGCATCAAATCTGGAAGAATGATATTTAAAAAAGCAAGAGAAGATACCAGAACCCGCCACCATGTCTATGTTACTGCA
GCACTCATGGAATATTACTGTAGTAAGGACAAATCTGTTGCCTTTAAGATTTTTGAGCTGGGGCTAAAAAAATATGGAGACATTCCAGAG
TATGTCCTGGCCTATATTGACTATCTTTCTCACCTCAATGAGGACAATAATACCCGAGTTTTGTTTGAACGAGTTTTAACATCTGGAAGC
CTTCCTCCTGAGAAGTCTGGAGAAATCTGGGCCCGATTTCTAGCATTTGAAAGTAATATTGGTGATCTAGCTAGTATACTCAAAGTGGAG
AAAAGACGGTTTACAGCATTCAAAGAAGAGTATGAAGGGAAAGAAACGGCTTTACTAGTAGATAGATACAAGTTCATGGATTTATATCCT
TGCTCTGCAAGTGAATTAAAAGCACTTGGTTATAAGGATGTCTCCCGTGCTAAGCTAGCAGCTATAATTCCGGACCCAGTTGTAGCTCCT
TCTATAGTGCCTGTTCTGAAAGATGAAGTGGATAGAAAACCAGAATACCCTAAACCAGACACTCAGCAGATGATTCCATTTCAGCCACGA
CATTTAGCACCTCCAGGTTTACACCCTGTACCTGGTGGAGTGTTCCCAGTCCCTCCTGCAGCTGTTGTTTTAATGAAACTTCTCCCTCCT
CCTATCTGTTTCCAGGGTCCTTTTGTACAAGTGGATGAACTGATGGAAATTTTCCGAAGATGCAAGATACCAAATACTGTTGAGGAAGCT
GTGAGGATCATTACTGGTGGGGCCCCAGAGCTAGCTGTAGAAGGCAACGGCCCCGTGGAAAGTAATGCAGTACTCACCAAGGCCGTCAAA
AGGCCCAACGAGGATTCAGATGAAGATGAAGAAAAGGGAGCCGTTGTCCCCCCTGTTCATGACATTTACAGAGCACGGCAGCAGAAGCGG

>In-frame_EIF3M_ENST00000531120_chr11_32605475_+_CSTF3_ENST00000524827_chr11_33163532_-_477nt
ATGAGCGTCCCGGCCTTCATCGACATCAGTGAAGAAGATCAGGCAGCTGAGTATGTCCCAGAGAAGGTGAAGAAAGCGGAAAAGAAATTA
GAAGAGAATCCATATGACCTTGATGCTTGGAGCATTCTCATTCGAGAGGCACAGAATCAACCTATAGACAAAGCACGGAAGACTTATGAA
CGCCTTGTTGCCCAGTTCCCCAGTTCTGGCAGATTCTGGAAACTGTACATTGAAGCAGAGATTAAAGCTAAAAATTATGACAAGGTTGAA
AAGCTATTTCAGAGATGCCTTATGAAGGTTTTGCACATTGATTTATGGAAGTGTTATCTTTCATATGTCCGAGAAACCAAGGGTAAACTA
CCAAGTTACAAAGAAAAAATGGCTCAAGCATATGACTTTGCACTGGATAAAATTGGAATGGAAATTATGTCCTATCAGATTTGGGTGGAT

>In-frame_EIF3M_ENST00000524896_chr11_32605475_+_CSTF3_ENST00000323959_chr11_33163532_-_2169nt
ATGAGCGTCCCGGCCTTCATCGACATCAGTGAAGAAGATCAGGCAGCTGAGTATGTCCCAGAGAAGGTGAAGAAAGCGGAAAAGAAATTA
GAAGAGAATCCATATGACCTTGATGCTTGGAGCATTCTCATTCGAGAGGCACAGAATCAACCTATAGACAAAGCACGGAAGACTTATGAA
CGCCTTGTTGCCCAGTTCCCCAGTTCTGGCAGATTCTGGAAACTGTACATTGAAGCAGAGATTAAAGCTAAAAATTATGACAAGGTTGAA
AAGCTATTTCAGAGATGCCTTATGAAGGTTTTGCACATTGATTTATGGAAGTGTTATCTTTCATATGTCCGAGAAACCAAGGGTAAACTA
CCAAGTTACAAAGAAAAAATGGCTCAAGCATATGACTTTGCACTGGATAAAATTGGAATGGAAATTATGTCCTATCAGATTTGGGTGGAT
TACATCAATTTCCTAAAAGGCGTGGAAGCTGTAGGATCTTATGCAGAAAATCAAAGAATAACAGCTGTCCGAAGAGTTTATCAACGAGGT
TGTGTTAATCCGATGATCAACATTGAACAGCTCTGGAGAGACTATAACAAGTATGAAGAGGGTATCAATATTCATTTAGCTAAAAAAATG
ATTGAAGATCGGAGTAGAGATTATATGAATGCTAGACGTGTAGCAAAGGAATATGAGACAGTAATGAAAGGCTTGGACCGTAATGCTCCC
TCGGTGCCTCCTCAGAATACTCCTCAAGAAGCTCAACAAGTAGATATGTGGAAGAAATATATACAGTGGGAAAAGAGCAACCCTCTTCGT
ACAGAGGATCAGACCCTTATAACAAAAAGAGTTATGTTTGCTTATGAACAGTGCCTGCTTGTGCTGGGCCATCACCCTGATATTTGGTAT
GAAGCTGCCCAGTATCTTGAGCAGTCAAGTAAACTGCTCGCAGAAAAGGGAGATATGAATAATGCCAAATTATTTAGTGATGAAGCTGCT
AATATATATGAAAGAGCCATAAGCACTTTATTGAAGAAGAATATGCTTCTTTATTTTGCATATGCAGATTATGAAGAGAGTCGCATGAAG
TATGAAAAGGTTCACAGTATATATAACAGACTTCTGGCAATTGAGGATATTGACCCTACCTTGGTATATATCCAATATATGAAATTTGCA
CGGAGAGCAGAAGGCATCAAATCTGGAAGAATGATATTTAAAAAAGCAAGAGAAGATACCAGAACCCGCCACCATGTCTATGTTACTGCA
GCACTCATGGAATATTACTGTAGTAAGGACAAATCTGTTGCCTTTAAGATTTTTGAGCTGGGGCTAAAAAAATATGGAGACATTCCAGAG
TATGTCCTGGCCTATATTGACTATCTTTCTCACCTCAATGAGGACAATAATACCCGAGTTTTGTTTGAACGAGTTTTAACATCTGGAAGC
CTTCCTCCTGAGAAGTCTGGAGAAATCTGGGCCCGATTTCTAGCATTTGAAAGTAATATTGGTGATCTAGCTAGTATACTCAAAGTGGAG
AAAAGACGGTTTACAGCATTCAAAGAAGAGTATGAAGGGAAAGAAACGGCTTTACTAGTAGATAGATACAAGTTCATGGATTTATATCCT
TGCTCTGCAAGTGAATTAAAAGCACTTGGTTATAAGGATGTCTCCCGTGCTAAGCTAGCAGCTATAATTCCGGACCCAGTTGTAGCTCCT
TCTATAGTGCCTGTTCTGAAAGATGAAGTGGATAGAAAACCAGAATACCCTAAACCAGACACTCAGCAGATGATTCCATTTCAGCCACGA
CATTTAGCACCTCCAGGTTTACACCCTGTACCTGGTGGAGTGTTCCCAGTCCCTCCTGCAGCTGTTGTTTTAATGAAACTTCTCCCTCCT
CCTATCTGTTTCCAGGGTCCTTTTGTACAAGTGGATGAACTGATGGAAATTTTCCGAAGATGCAAGATACCAAATACTGTTGAGGAAGCT
GTGAGGATCATTACTGGTGGGGCCCCAGAGCTAGCTGTAGAAGGCAACGGCCCCGTGGAAAGTAATGCAGTACTCACCAAGGCCGTCAAA
AGGCCCAACGAGGATTCAGATGAAGATGAAGAAAAGGGAGCCGTTGTCCCCCCTGTTCATGACATTTACAGAGCACGGCAGCAGAAGCGG

>In-frame_EIF3M_ENST00000524896_chr11_32605475_+_CSTF3_ENST00000524827_chr11_33163532_-_477nt
ATGAGCGTCCCGGCCTTCATCGACATCAGTGAAGAAGATCAGGCAGCTGAGTATGTCCCAGAGAAGGTGAAGAAAGCGGAAAAGAAATTA
GAAGAGAATCCATATGACCTTGATGCTTGGAGCATTCTCATTCGAGAGGCACAGAATCAACCTATAGACAAAGCACGGAAGACTTATGAA
CGCCTTGTTGCCCAGTTCCCCAGTTCTGGCAGATTCTGGAAACTGTACATTGAAGCAGAGATTAAAGCTAAAAATTATGACAAGGTTGAA
AAGCTATTTCAGAGATGCCTTATGAAGGTTTTGCACATTGATTTATGGAAGTGTTATCTTTCATATGTCCGAGAAACCAAGGGTAAACTA
CCAAGTTACAAAGAAAAAATGGCTCAAGCATATGACTTTGCACTGGATAAAATTGGAATGGAAATTATGTCCTATCAGATTTGGGTGGAT


* Fusion transcript sequences (Full-length transcript).
>In-frame_EIF3M_ENST00000531120_chr11_32605475_+_CSTF3_ENST00000323959_chr11_33163532_-_2735nt
AGTTCCCTTTTCCGGTCGGCGTGGTCTTGCGAGTGGAGTGTCCGCTGTGCCCGGGCCTGCACCATGAGCGTCCCGGCCTTCATCGACATC
AGTGAAGAAGATCAGGCAGCTGAGTATGTCCCAGAGAAGGTGAAGAAAGCGGAAAAGAAATTAGAAGAGAATCCATATGACCTTGATGCT
TGGAGCATTCTCATTCGAGAGGCACAGAATCAACCTATAGACAAAGCACGGAAGACTTATGAACGCCTTGTTGCCCAGTTCCCCAGTTCT
GGCAGATTCTGGAAACTGTACATTGAAGCAGAGATTAAAGCTAAAAATTATGACAAGGTTGAAAAGCTATTTCAGAGATGCCTTATGAAG
GTTTTGCACATTGATTTATGGAAGTGTTATCTTTCATATGTCCGAGAAACCAAGGGTAAACTACCAAGTTACAAAGAAAAAATGGCTCAA
GCATATGACTTTGCACTGGATAAAATTGGAATGGAAATTATGTCCTATCAGATTTGGGTGGATTACATCAATTTCCTAAAAGGCGTGGAA
GCTGTAGGATCTTATGCAGAAAATCAAAGAATAACAGCTGTCCGAAGAGTTTATCAACGAGGTTGTGTTAATCCGATGATCAACATTGAA
CAGCTCTGGAGAGACTATAACAAGTATGAAGAGGGTATCAATATTCATTTAGCTAAAAAAATGATTGAAGATCGGAGTAGAGATTATATG
AATGCTAGACGTGTAGCAAAGGAATATGAGACAGTAATGAAAGGCTTGGACCGTAATGCTCCCTCGGTGCCTCCTCAGAATACTCCTCAA
GAAGCTCAACAAGTAGATATGTGGAAGAAATATATACAGTGGGAAAAGAGCAACCCTCTTCGTACAGAGGATCAGACCCTTATAACAAAA
AGAGTTATGTTTGCTTATGAACAGTGCCTGCTTGTGCTGGGCCATCACCCTGATATTTGGTATGAAGCTGCCCAGTATCTTGAGCAGTCA
AGTAAACTGCTCGCAGAAAAGGGAGATATGAATAATGCCAAATTATTTAGTGATGAAGCTGCTAATATATATGAAAGAGCCATAAGCACT
TTATTGAAGAAGAATATGCTTCTTTATTTTGCATATGCAGATTATGAAGAGAGTCGCATGAAGTATGAAAAGGTTCACAGTATATATAAC
AGACTTCTGGCAATTGAGGATATTGACCCTACCTTGGTATATATCCAATATATGAAATTTGCACGGAGAGCAGAAGGCATCAAATCTGGA
AGAATGATATTTAAAAAAGCAAGAGAAGATACCAGAACCCGCCACCATGTCTATGTTACTGCAGCACTCATGGAATATTACTGTAGTAAG
GACAAATCTGTTGCCTTTAAGATTTTTGAGCTGGGGCTAAAAAAATATGGAGACATTCCAGAGTATGTCCTGGCCTATATTGACTATCTT
TCTCACCTCAATGAGGACAATAATACCCGAGTTTTGTTTGAACGAGTTTTAACATCTGGAAGCCTTCCTCCTGAGAAGTCTGGAGAAATC
TGGGCCCGATTTCTAGCATTTGAAAGTAATATTGGTGATCTAGCTAGTATACTCAAAGTGGAGAAAAGACGGTTTACAGCATTCAAAGAA
GAGTATGAAGGGAAAGAAACGGCTTTACTAGTAGATAGATACAAGTTCATGGATTTATATCCTTGCTCTGCAAGTGAATTAAAAGCACTT
GGTTATAAGGATGTCTCCCGTGCTAAGCTAGCAGCTATAATTCCGGACCCAGTTGTAGCTCCTTCTATAGTGCCTGTTCTGAAAGATGAA
GTGGATAGAAAACCAGAATACCCTAAACCAGACACTCAGCAGATGATTCCATTTCAGCCACGACATTTAGCACCTCCAGGTTTACACCCT
GTACCTGGTGGAGTGTTCCCAGTCCCTCCTGCAGCTGTTGTTTTAATGAAACTTCTCCCTCCTCCTATCTGTTTCCAGGGTCCTTTTGTA
CAAGTGGATGAACTGATGGAAATTTTCCGAAGATGCAAGATACCAAATACTGTTGAGGAAGCTGTGAGGATCATTACTGGTGGGGCCCCA
GAGCTAGCTGTAGAAGGCAACGGCCCCGTGGAAAGTAATGCAGTACTCACCAAGGCCGTCAAAAGGCCCAACGAGGATTCAGATGAAGAT
GAAGAAAAGGGAGCCGTTGTCCCCCCTGTTCATGACATTTACAGAGCACGGCAGCAGAAGCGGATTCGGTAGGGTTTTAAACGCCTCTGC
AGAAAACTCCTGTCCAGGATTCCTTTTGCCTCAAGTGGTATGTTTAAAAGAGACAACGCTTTGTTACAAGGTTCTTGGAAACAAAGTTGT
ATTGTCATTGGTGCCTCTATCACATGGTTCTTGAGAAAAAACAAACCAACCTGTGTGAATTTTAGAATACGGAACAGACCTATGCTCTAA
GCAAAATTAGGTTTTCAAAAATGTGAGAACAGTACAAAGTGGCAGAACCACATTTTGTTCCCTCTTCAAGGGTGTCTTGTATGTGCCGCT
TGAAGATTTGTGAGTTTTTCAACAGTTTTATTTTAAAAACTGGATGGCTTATGATTGTAAAGCATTTTATCACATTTTCTGAAAACAATT
GTTCTTGGTTTGCTTATGTAGAGTCCTGCCTTATTGTTTGTTTTTATTTATGGCAGAATGTATGAAATCCGTTTTGTAGTTTCAAATTTT

>In-frame_EIF3M_ENST00000531120_chr11_32605475_+_CSTF3_ENST00000524827_chr11_33163532_-_540nt
AGTTCCCTTTTCCGGTCGGCGTGGTCTTGCGAGTGGAGTGTCCGCTGTGCCCGGGCCTGCACCATGAGCGTCCCGGCCTTCATCGACATC
AGTGAAGAAGATCAGGCAGCTGAGTATGTCCCAGAGAAGGTGAAGAAAGCGGAAAAGAAATTAGAAGAGAATCCATATGACCTTGATGCT
TGGAGCATTCTCATTCGAGAGGCACAGAATCAACCTATAGACAAAGCACGGAAGACTTATGAACGCCTTGTTGCCCAGTTCCCCAGTTCT
GGCAGATTCTGGAAACTGTACATTGAAGCAGAGATTAAAGCTAAAAATTATGACAAGGTTGAAAAGCTATTTCAGAGATGCCTTATGAAG
GTTTTGCACATTGATTTATGGAAGTGTTATCTTTCATATGTCCGAGAAACCAAGGGTAAACTACCAAGTTACAAAGAAAAAATGGCTCAA
GCATATGACTTTGCACTGGATAAAATTGGAATGGAAATTATGTCCTATCAGATTTGGGTGGATTACATCAATTTCCTAAAAGGCGTGTAA

>In-frame_EIF3M_ENST00000524896_chr11_32605475_+_CSTF3_ENST00000323959_chr11_33163532_-_2726nt
TTCCGGTCGGCGTGGTCTTGCGAGTGGAGTGTCCGCTGTGCCCGGGCCTGCACCATGAGCGTCCCGGCCTTCATCGACATCAGTGAAGAA
GATCAGGCAGCTGAGTATGTCCCAGAGAAGGTGAAGAAAGCGGAAAAGAAATTAGAAGAGAATCCATATGACCTTGATGCTTGGAGCATT
CTCATTCGAGAGGCACAGAATCAACCTATAGACAAAGCACGGAAGACTTATGAACGCCTTGTTGCCCAGTTCCCCAGTTCTGGCAGATTC
TGGAAACTGTACATTGAAGCAGAGATTAAAGCTAAAAATTATGACAAGGTTGAAAAGCTATTTCAGAGATGCCTTATGAAGGTTTTGCAC
ATTGATTTATGGAAGTGTTATCTTTCATATGTCCGAGAAACCAAGGGTAAACTACCAAGTTACAAAGAAAAAATGGCTCAAGCATATGAC
TTTGCACTGGATAAAATTGGAATGGAAATTATGTCCTATCAGATTTGGGTGGATTACATCAATTTCCTAAAAGGCGTGGAAGCTGTAGGA
TCTTATGCAGAAAATCAAAGAATAACAGCTGTCCGAAGAGTTTATCAACGAGGTTGTGTTAATCCGATGATCAACATTGAACAGCTCTGG
AGAGACTATAACAAGTATGAAGAGGGTATCAATATTCATTTAGCTAAAAAAATGATTGAAGATCGGAGTAGAGATTATATGAATGCTAGA
CGTGTAGCAAAGGAATATGAGACAGTAATGAAAGGCTTGGACCGTAATGCTCCCTCGGTGCCTCCTCAGAATACTCCTCAAGAAGCTCAA
CAAGTAGATATGTGGAAGAAATATATACAGTGGGAAAAGAGCAACCCTCTTCGTACAGAGGATCAGACCCTTATAACAAAAAGAGTTATG
TTTGCTTATGAACAGTGCCTGCTTGTGCTGGGCCATCACCCTGATATTTGGTATGAAGCTGCCCAGTATCTTGAGCAGTCAAGTAAACTG
CTCGCAGAAAAGGGAGATATGAATAATGCCAAATTATTTAGTGATGAAGCTGCTAATATATATGAAAGAGCCATAAGCACTTTATTGAAG
AAGAATATGCTTCTTTATTTTGCATATGCAGATTATGAAGAGAGTCGCATGAAGTATGAAAAGGTTCACAGTATATATAACAGACTTCTG
GCAATTGAGGATATTGACCCTACCTTGGTATATATCCAATATATGAAATTTGCACGGAGAGCAGAAGGCATCAAATCTGGAAGAATGATA
TTTAAAAAAGCAAGAGAAGATACCAGAACCCGCCACCATGTCTATGTTACTGCAGCACTCATGGAATATTACTGTAGTAAGGACAAATCT
GTTGCCTTTAAGATTTTTGAGCTGGGGCTAAAAAAATATGGAGACATTCCAGAGTATGTCCTGGCCTATATTGACTATCTTTCTCACCTC
AATGAGGACAATAATACCCGAGTTTTGTTTGAACGAGTTTTAACATCTGGAAGCCTTCCTCCTGAGAAGTCTGGAGAAATCTGGGCCCGA
TTTCTAGCATTTGAAAGTAATATTGGTGATCTAGCTAGTATACTCAAAGTGGAGAAAAGACGGTTTACAGCATTCAAAGAAGAGTATGAA
GGGAAAGAAACGGCTTTACTAGTAGATAGATACAAGTTCATGGATTTATATCCTTGCTCTGCAAGTGAATTAAAAGCACTTGGTTATAAG
GATGTCTCCCGTGCTAAGCTAGCAGCTATAATTCCGGACCCAGTTGTAGCTCCTTCTATAGTGCCTGTTCTGAAAGATGAAGTGGATAGA
AAACCAGAATACCCTAAACCAGACACTCAGCAGATGATTCCATTTCAGCCACGACATTTAGCACCTCCAGGTTTACACCCTGTACCTGGT
GGAGTGTTCCCAGTCCCTCCTGCAGCTGTTGTTTTAATGAAACTTCTCCCTCCTCCTATCTGTTTCCAGGGTCCTTTTGTACAAGTGGAT
GAACTGATGGAAATTTTCCGAAGATGCAAGATACCAAATACTGTTGAGGAAGCTGTGAGGATCATTACTGGTGGGGCCCCAGAGCTAGCT
GTAGAAGGCAACGGCCCCGTGGAAAGTAATGCAGTACTCACCAAGGCCGTCAAAAGGCCCAACGAGGATTCAGATGAAGATGAAGAAAAG
GGAGCCGTTGTCCCCCCTGTTCATGACATTTACAGAGCACGGCAGCAGAAGCGGATTCGGTAGGGTTTTAAACGCCTCTGCAGAAAACTC
CTGTCCAGGATTCCTTTTGCCTCAAGTGGTATGTTTAAAAGAGACAACGCTTTGTTACAAGGTTCTTGGAAACAAAGTTGTATTGTCATT
GGTGCCTCTATCACATGGTTCTTGAGAAAAAACAAACCAACCTGTGTGAATTTTAGAATACGGAACAGACCTATGCTCTAAGCAAAATTA
GGTTTTCAAAAATGTGAGAACAGTACAAAGTGGCAGAACCACATTTTGTTCCCTCTTCAAGGGTGTCTTGTATGTGCCGCTTGAAGATTT
GTGAGTTTTTCAACAGTTTTATTTTAAAAACTGGATGGCTTATGATTGTAAAGCATTTTATCACATTTTCTGAAAACAATTGTTCTTGGT
TTGCTTATGTAGAGTCCTGCCTTATTGTTTGTTTTTATTTATGGCAGAATGTATGAAATCCGTTTTGTAGTTTCAAATTTTAAAAGTCCT

>In-frame_EIF3M_ENST00000524896_chr11_32605475_+_CSTF3_ENST00000524827_chr11_33163532_-_531nt
TTCCGGTCGGCGTGGTCTTGCGAGTGGAGTGTCCGCTGTGCCCGGGCCTGCACCATGAGCGTCCCGGCCTTCATCGACATCAGTGAAGAA
GATCAGGCAGCTGAGTATGTCCCAGAGAAGGTGAAGAAAGCGGAAAAGAAATTAGAAGAGAATCCATATGACCTTGATGCTTGGAGCATT
CTCATTCGAGAGGCACAGAATCAACCTATAGACAAAGCACGGAAGACTTATGAACGCCTTGTTGCCCAGTTCCCCAGTTCTGGCAGATTC
TGGAAACTGTACATTGAAGCAGAGATTAAAGCTAAAAATTATGACAAGGTTGAAAAGCTATTTCAGAGATGCCTTATGAAGGTTTTGCAC
ATTGATTTATGGAAGTGTTATCTTTCATATGTCCGAGAAACCAAGGGTAAACTACCAAGTTACAAAGAAAAAATGGCTCAAGCATATGAC


Top

FusionGenePPI for EIF3M_CSTF3


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
EIF3MEIF1B, EIF4A2, EIF3A, EIF3F, EIF3H, TADA2A, EIF3B, APP, EIF3C, EIF3E, EIF3D, EIF3I, EIF3K, EIF3L, EIF3G, MMS19, NPM1, EXOSC10, SRPK1, FAM96B, HUWE1, EGFR, EIF3CL, USP34, HSPB1, AHCYL1, COPS4, RPN1, EIF3J, NTRK1, MED4, HERC2, NF2, PTP4A1, PSMD12, EIF4A1, GPBP1L1, UBE2N, CYLD, DLD, TRIM25, G3BP1, BRCA1CSTF3VHL, CSTF2, CDC73, CPSF1, HNRNPA1, CUL3, POLR2A, CSTF2T, GAPDH, CSTF1, HECW2, WWOX, RBBP6, CUL7, CCNL2, CYP1A1, UNK, NTRK1, PAPOLA, XPO1, PABPC1, PABPC3, PAPOLB, SCARNA22, FIP1L1, SYMPK, RNPS1, CPSF3, CEP170P1, MACROD1, SNW1, CDC5L, EGFR, SSU72, BMP1, GTF2E2, HSPA8, C1QL4, DLD, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with
HgeneEIF3Mchr11:32605475chr11:33163532ENST00000531120+111344_37414375HSV-1 and HSV-2


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for EIF3M_CSTF3


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for EIF3M_CSTF3


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource