FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 11284

FusionGeneSummary for EIF3L_AK7

check button Fusion gene summary
Fusion gene informationFusion gene name: EIF3L_AK7
Fusion gene ID: 11284
HgeneTgene
Gene symbol

EIF3L

AK7

Gene ID

51386

122481

Gene nameeukaryotic translation initiation factor 3 subunit Ladenylate kinase 7
SynonymsEIF3EIP|EIF3S11|EIF3S6IP|HSPC021|HSPC025|MSTP005AK 7|SPGF27
Cytomap

22q13.1

14q32.2

Type of geneprotein-codingprotein-coding
Descriptioneukaryotic translation initiation factor 3 subunit LeIEF associated protein HSPC021eukaryotic translation initiation factor 3 subunit 6-interacting proteineukaryotic translation initiation factor 3 subunit E-interacting proteinadenylate kinase 7ATP-AMP transphosphorylase 7putative adenylate kinase 7
Modification date2018052320180519
UniProtAcc

Q9Y262

Q96M32

Ensembl transtripts involved in fusion geneENST00000412331, ENST00000381683, 
ENST00000406934, ENST00000476955, 
ENST00000267584, ENST00000555570, 
ENST00000554313, 
Fusion gene scores* DoF score9 X 5 X 8=3603 X 3 X 3=27
# samples 114
** MAII scorelog2(11/360*10)=-1.71049338280502
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(4/27*10)=0.567040592723894
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: EIF3L [Title/Abstract] AND AK7 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationKinase involved fusion gene, inframe and retained kinase domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneEIF3L

GO:0006413

translational initiation

17581632

HgeneEIF3L

GO:0075525

viral translational termination-reinitiation

21347434

TgeneAK7

GO:0006165

nucleoside diphosphate phosphorylation

23416111

TgeneAK7

GO:0009142

nucleoside triphosphate biosynthetic process

23416111


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLIHCTCGA-BC-A10R-01AEIF3Lchr22

38270531

+AK7chr14

96922684

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000412331ENST00000267584EIF3Lchr22

38270531

+AK7chr14

96922684

+
5CDS-intronENST00000412331ENST00000555570EIF3Lchr22

38270531

+AK7chr14

96922684

+
5CDS-intronENST00000412331ENST00000554313EIF3Lchr22

38270531

+AK7chr14

96922684

+
In-frameENST00000381683ENST00000267584EIF3Lchr22

38270531

+AK7chr14

96922684

+
5CDS-intronENST00000381683ENST00000555570EIF3Lchr22

38270531

+AK7chr14

96922684

+
5CDS-intronENST00000381683ENST00000554313EIF3Lchr22

38270531

+AK7chr14

96922684

+
In-frameENST00000406934ENST00000267584EIF3Lchr22

38270531

+AK7chr14

96922684

+
5CDS-intronENST00000406934ENST00000555570EIF3Lchr22

38270531

+AK7chr14

96922684

+
5CDS-intronENST00000406934ENST00000554313EIF3Lchr22

38270531

+AK7chr14

96922684

+
intron-3CDSENST00000476955ENST00000267584EIF3Lchr22

38270531

+AK7chr14

96922684

+
intron-intronENST00000476955ENST00000555570EIF3Lchr22

38270531

+AK7chr14

96922684

+
intron-intronENST00000476955ENST00000554313EIF3Lchr22

38270531

+AK7chr14

96922684

+

Top

FusionProtFeatures for EIF3L_AK7


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
EIF3L

Q9Y262

AK7

Q96M32

Nucleoside monophosphate (NMP) kinase that catalyzes thereversible transfer of the terminal phosphate group betweennucleoside triphosphates and monophosphates. Has highest activitytoward AMP, and weaker activity toward dAMP, CMP and dCMP. Alsodisplays broad nucleoside diphosphate kinase activity. Involved inmaintaining ciliary structure and function.{ECO:0000269|PubMed:21080915, ECO:0000269|PubMed:23416111}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneAK7chr22:38270531chr14:96922684ENST00000267584+918609_677366724Coiled coilOntology_term=ECO:0000255
TgeneAK7chr22:38270531chr14:96922684ENST00000267584+918420_432366724Compositional biasNote=Poly-Glu
TgeneAK7chr22:38270531chr14:96922684ENST00000267584+918497_502366724Compositional biasNote=Poly-Glu
TgeneAK7chr22:38270531chr14:96922684ENST00000267584+918616_674366724Compositional biasNote=Glu-rich
TgeneAK7chr22:38270531chr14:96922684ENST00000267584+918377_382366724Nucleotide bindingATP
TgeneAK7chr22:38270531chr14:96922684ENST00000267584+918432_455366724Nucleotide bindingAMP
TgeneAK7chr22:38270531chr14:96922684ENST00000267584+918482_485366724Nucleotide bindingAMP
TgeneAK7chr22:38270531chr14:96922684ENST00000267584+918367_612366724RegionAdenylate kinase
TgeneAK7chr22:38270531chr14:96922684ENST00000267584+918397_455366724RegionNMPbind
TgeneAK7chr22:38270531chr14:96922684ENST00000267584+918537_547366724RegionLID
TgeneAK7chr22:38270531chr14:96922684ENST00000267584+918679_723366724RegionDPY-30

- In-frame and not-retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneEIF3Lchr22:38270531chr14:96922684ENST00000381683+711331_537254517DomainPCI
HgeneEIF3Lchr22:38270531chr14:96922684ENST00000412331+913331_537302565DomainPCI
TgeneAK7chr22:38270531chr14:96922684ENST00000267584+91846_458366724Coiled coilOntology_term=ECO:0000255
TgeneAK7chr22:38270531chr14:96922684ENST00000267584+9183_6366724Compositional biasNote=Poly-Glu
TgeneAK7chr22:38270531chr14:96922684ENST00000267584+91851_58366724Compositional biasNote=Poly-Glu


Top

FusionGeneSequence for EIF3L_AK7


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_EIF3L_ENST00000412331_chr22_38270531_+_AK7_ENST00000267584_chr14_96922684_+_660aa
MSYPADDYESEAAYDPYAYPSDYDMHTGDPKQDLAYERQYEQQTYQVIPEVIKNFIQYFHKTVSDLIDQKVYELQASRVSSDVIDQKVYE
IQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPSLEQRFESYYNYCNLFNYILNADGPAPLELPN
QWLWDIIDEFIYQFQSFSQYRCKTAKKSEEEIDFLRSNPKIWNVHSVLNVLHSLVDKSNINRQLEVYTSGGDPESVAGEYGRHSLYKMLG
YFSLVGLLRLHSLLGDYYQAIKVLENIELNKKPIKICILGPPAVGKSSIAKELANYYKLHHIQLKDVISEAIAKLEAIVAPNDVGEGEEE
VEEEEEEENVEDAQELLDGIKESMEQNAGQLDDQYIIRFMKEKLKSMPCRNQGYILDGFPKTYDQAKDLFNQEDEEEEDDVRGRMFPFDK
LIIPEFVCALDASDEFLKERVINLPESIVAGTHYSQDRFLRALSNYRDINIDDETVFNYFDELEIHPIHIDVGKLEDAQNRLAIKQLIKE
IGEPRNYGLTDEEKAEEERKAAEERLAREAAEEAEREHQEAVEMAEKIARWEEWNKRLEEVKREERELLEAQSIPLRNYLMTYVMPTLIQ

>In-frame_EIF3L_ENST00000381683_chr22_38270531_+_AK7_ENST00000267584_chr14_96922684_+_612aa
MSYPADDYESEAAYDPYAYPSDYDMHTGDPKQDLAYERQYEQQTYQVIPEVIKNFIQYFHKTVSDLIDQKVYELQASRVSSDVIDQKVYE
IQDIYENSWTKLTERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSFQSFSQYRCKTAKKSEEEIDFLRSNPKIWNVHSVL
NVLHSLVDKSNINRQLEVYTSGGDPESVAGEYGRHSLYKMLGYFSLVGLLRLHSLLGDYYQAIKVLENIELNKKPIKICILGPPAVGKSS
IAKELANYYKLHHIQLKDVISEAIAKLEAIVAPNDVGEGEEEVEEEEEEENVEDAQELLDGIKESMEQNAGQLDDQYIIRFMKEKLKSMP
CRNQGYILDGFPKTYDQAKDLFNQEDEEEEDDVRGRMFPFDKLIIPEFVCALDASDEFLKERVINLPESIVAGTHYSQDRFLRALSNYRD
INIDDETVFNYFDELEIHPIHIDVGKLEDAQNRLAIKQLIKEIGEPRNYGLTDEEKAEEERKAAEERLAREAAEEAEREHQEAVEMAEKI

>In-frame_EIF3L_ENST00000406934_chr22_38270531_+_AK7_ENST00000267584_chr14_96922684_+_562aa
MSYRPVVSPVMSLTRRCMRSRTSMRTDAVFLILYKELYYRHIYAKVSGGPSLEQRFESYYNYCNLFNYILNADGPAPLELPNQWLWDIID
EFIYQFQSFSQYRCKTAKKSEEEIDFLRSNPKIWNVHSVLNVLHSLVDKSNINRQLEVYTSGGDPESVAGEYGRHSLYKMLGYFSLVGLL
RLHSLLGDYYQAIKVLENIELNKKPIKICILGPPAVGKSSIAKELANYYKLHHIQLKDVISEAIAKLEAIVAPNDVGEGEEEVEEEEEEE
NVEDAQELLDGIKESMEQNAGQLDDQYIIRFMKEKLKSMPCRNQGYILDGFPKTYDQAKDLFNQEDEEEEDDVRGRMFPFDKLIIPEFVC
ALDASDEFLKERVINLPESIVAGTHYSQDRFLRALSNYRDINIDDETVFNYFDELEIHPIHIDVGKLEDAQNRLAIKQLIKEIGEPRNYG
LTDEEKAEEERKAAEERLAREAAEEAEREHQEAVEMAEKIARWEEWNKRLEEVKREERELLEAQSIPLRNYLMTYVMPTLIQGLNECCNV


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_EIF3L_ENST00000412331_chr22_38270531_+_AK7_ENST00000267584_chr14_96922684_+_1980nt
ATGTCTTATCCCGCTGATGATTATGAGTCTGAGGCGGCTTATGACCCCTACGCTTATCCCAGCGACTATGATATGCACACAGGAGATCCA
AAGCAGGACCTTGCTTATGAACGTCAGTATGAACAGCAAACCTATCAGGTGATCCCTGAGGTGATCAAAAACTTCATCCAGTATTTCCAC
AAAACTGTCTCAGATTTGATTGACCAGAAAGTGTATGAGCTACAGGCCAGTCGTGTCTCCAGTGATGTCATTGACCAGAAGGTGTATGAG
ATCCAGGACATCTATGAGAACAGCTGGACCAAGCTGACTGAAAGATTCTTCAAGAATACACCTTGGCCCGAGGCTGAAGCCATTGCTCCA
CAGGTTGGCAATGATGCTGTCTTCCTGATTTTATACAAAGAATTATACTACAGGCACATATATGCCAAAGTCAGTGGGGGACCTTCCTTG
GAGCAGAGGTTTGAATCCTATTACAACTACTGCAATCTCTTCAACTACATTCTTAATGCCGATGGTCCTGCTCCCCTTGAACTACCCAAC
CAGTGGCTCTGGGATATTATCGATGAGTTCATCTACCAGTTTCAGTCATTCAGTCAGTACCGCTGTAAGACTGCCAAGAAGTCAGAGGAG
GAGATTGACTTTCTTCGTTCCAATCCCAAAATCTGGAATGTTCATAGTGTCCTCAATGTCCTTCATTCCCTGGTAGACAAATCCAACATC
AACCGACAGTTGGAGGTATACACAAGCGGAGGTGACCCTGAGAGTGTGGCTGGGGAGTATGGGCGGCACTCCCTCTACAAAATGCTTGGT
TACTTCAGCCTGGTCGGGCTTCTCCGCCTGCACTCCCTGTTAGGAGATTACTACCAGGCCATCAAGGTGCTGGAGAACATCGAACTGAAC
AAGAAGCCAATCAAGATCTGCATTCTTGGTCCCCCTGCTGTGGGAAAATCCAGTATTGCTAAAGAATTGGCCAACTACTACAAACTGCAT
CACATCCAACTGAAGGATGTCATTTCTGAAGCCATAGCAAAACTGGAGGCGATTGTTGCCCCTAACGATGTAGGGGAAGGAGAAGAAGAA
GTCGAAGAGGAAGAGGAGGAGGAGAATGTGGAAGATGCACAGGAGCTCCTAGATGGCATCAAGGAGAGCATGGAGCAGAATGCAGGTCAA
CTAGACGATCAATATATAATTAGATTTATGAAAGAAAAGCTAAAATCAATGCCTTGCAGGAATCAAGGTTATATTTTGGATGGATTCCCA
AAGACCTATGATCAAGCAAAAGACCTGTTCAATCAGGAAGATGAGGAGGAGGAAGATGATGTCAGAGGCAGAATGTTTCCCTTTGATAAA
TTAATTATACCTGAATTCGTTTGTGCACTGGATGCTTCGGATGAGTTTCTGAAGGAGCGTGTGATAAACCTTCCTGAGAGCATCGTGGCG
GGGACCCACTACAGCCAAGACCGATTCCTCCGGGCTCTGAGCAACTACCGGGACATCAATATCGACGATGAGACTGTCTTCAACTATTTT
GATGAACTTGAAATTCACCCGATACATATTGATGTAGGAAAACTTGAAGATGCTCAGAATAGACTTGCTATCAAACAGCTCATCAAAGAG
ATTGGGGAGCCTCGAAATTATGGTTTAACAGACGAAGAAAAGGCAGAAGAGGAGCGGAAGGCTGCGGAGGAGCGGCTGGCCAGGGAGGCT
GCTGAGGAAGCAGAACGCGAGCACCAGGAGGCCGTGGAGATGGCAGAGAAGATAGCTCGCTGGGAGGAGTGGAATAAACGACTGGAGGAA
GTGAAAAGAGAAGAAAGAGAATTACTGGAGGCTCAGTCAATTCCCCTGAGAAACTATTTAATGACCTATGTGATGCCAACTCTTATTCAG
GGCCTGAATGAATGTTGCAACGTCCGACCCGAAGACCCTGTTGATTTTCTGGCAGAATATCTCTTCAAGAACAATCCTGAAGCACAGTGA

>In-frame_EIF3L_ENST00000381683_chr22_38270531_+_AK7_ENST00000267584_chr14_96922684_+_1836nt
ATGTCTTATCCCGCTGATGATTATGAGTCTGAGGCGGCTTATGACCCCTACGCTTATCCCAGCGACTATGATATGCACACAGGAGATCCA
AAGCAGGACCTTGCTTATGAACGTCAGTATGAACAGCAAACCTATCAGGTGATCCCTGAGGTGATCAAAAACTTCATCCAGTATTTCCAC
AAAACTGTCTCAGATTTGATTGACCAGAAAGTGTATGAGCTACAGGCCAGTCGTGTCTCCAGTGATGTCATTGACCAGAAGGTGTATGAG
ATCCAGGACATCTATGAGAACAGCTGGACCAAGCTGACTGAAAGATTCTTCAAGAATACACCTTGGCCCGAGGCTGAAGCCATTGCTCCA
CAGGTTGGCAATGATGCTGTCTTCCTGATTTTATACAAAGAATTATACTACAGGCACATATATGCCAAAGTCAGTTTTCAGTCATTCAGT
CAGTACCGCTGTAAGACTGCCAAGAAGTCAGAGGAGGAGATTGACTTTCTTCGTTCCAATCCCAAAATCTGGAATGTTCATAGTGTCCTC
AATGTCCTTCATTCCCTGGTAGACAAATCCAACATCAACCGACAGTTGGAGGTATACACAAGCGGAGGTGACCCTGAGAGTGTGGCTGGG
GAGTATGGGCGGCACTCCCTCTACAAAATGCTTGGTTACTTCAGCCTGGTCGGGCTTCTCCGCCTGCACTCCCTGTTAGGAGATTACTAC
CAGGCCATCAAGGTGCTGGAGAACATCGAACTGAACAAGAAGCCAATCAAGATCTGCATTCTTGGTCCCCCTGCTGTGGGAAAATCCAGT
ATTGCTAAAGAATTGGCCAACTACTACAAACTGCATCACATCCAACTGAAGGATGTCATTTCTGAAGCCATAGCAAAACTGGAGGCGATT
GTTGCCCCTAACGATGTAGGGGAAGGAGAAGAAGAAGTCGAAGAGGAAGAGGAGGAGGAGAATGTGGAAGATGCACAGGAGCTCCTAGAT
GGCATCAAGGAGAGCATGGAGCAGAATGCAGGTCAACTAGACGATCAATATATAATTAGATTTATGAAAGAAAAGCTAAAATCAATGCCT
TGCAGGAATCAAGGTTATATTTTGGATGGATTCCCAAAGACCTATGATCAAGCAAAAGACCTGTTCAATCAGGAAGATGAGGAGGAGGAA
GATGATGTCAGAGGCAGAATGTTTCCCTTTGATAAATTAATTATACCTGAATTCGTTTGTGCACTGGATGCTTCGGATGAGTTTCTGAAG
GAGCGTGTGATAAACCTTCCTGAGAGCATCGTGGCGGGGACCCACTACAGCCAAGACCGATTCCTCCGGGCTCTGAGCAACTACCGGGAC
ATCAATATCGACGATGAGACTGTCTTCAACTATTTTGATGAACTTGAAATTCACCCGATACATATTGATGTAGGAAAACTTGAAGATGCT
CAGAATAGACTTGCTATCAAACAGCTCATCAAAGAGATTGGGGAGCCTCGAAATTATGGTTTAACAGACGAAGAAAAGGCAGAAGAGGAG
CGGAAGGCTGCGGAGGAGCGGCTGGCCAGGGAGGCTGCTGAGGAAGCAGAACGCGAGCACCAGGAGGCCGTGGAGATGGCAGAGAAGATA
GCTCGCTGGGAGGAGTGGAATAAACGACTGGAGGAAGTGAAAAGAGAAGAAAGAGAATTACTGGAGGCTCAGTCAATTCCCCTGAGAAAC
TATTTAATGACCTATGTGATGCCAACTCTTATTCAGGGCCTGAATGAATGTTGCAACGTCCGACCCGAAGACCCTGTTGATTTTCTGGCA

>In-frame_EIF3L_ENST00000406934_chr22_38270531_+_AK7_ENST00000267584_chr14_96922684_+_1686nt
ATGAGCTACAGGCCAGTCGTGTCTCCAGTGATGTCATTGACCAGAAGGTGTATGAGATCCAGGACATCTATGAGAACAGATGCTGTCTTC
CTGATTTTATACAAAGAATTATACTACAGGCACATATATGCCAAAGTCAGTGGGGGACCTTCCTTGGAGCAGAGGTTTGAATCCTATTAC
AACTACTGCAATCTCTTCAACTACATTCTTAATGCCGATGGTCCTGCTCCCCTTGAACTACCCAACCAGTGGCTCTGGGATATTATCGAT
GAGTTCATCTACCAGTTTCAGTCATTCAGTCAGTACCGCTGTAAGACTGCCAAGAAGTCAGAGGAGGAGATTGACTTTCTTCGTTCCAAT
CCCAAAATCTGGAATGTTCATAGTGTCCTCAATGTCCTTCATTCCCTGGTAGACAAATCCAACATCAACCGACAGTTGGAGGTATACACA
AGCGGAGGTGACCCTGAGAGTGTGGCTGGGGAGTATGGGCGGCACTCCCTCTACAAAATGCTTGGTTACTTCAGCCTGGTCGGGCTTCTC
CGCCTGCACTCCCTGTTAGGAGATTACTACCAGGCCATCAAGGTGCTGGAGAACATCGAACTGAACAAGAAGCCAATCAAGATCTGCATT
CTTGGTCCCCCTGCTGTGGGAAAATCCAGTATTGCTAAAGAATTGGCCAACTACTACAAACTGCATCACATCCAACTGAAGGATGTCATT
TCTGAAGCCATAGCAAAACTGGAGGCGATTGTTGCCCCTAACGATGTAGGGGAAGGAGAAGAAGAAGTCGAAGAGGAAGAGGAGGAGGAG
AATGTGGAAGATGCACAGGAGCTCCTAGATGGCATCAAGGAGAGCATGGAGCAGAATGCAGGTCAACTAGACGATCAATATATAATTAGA
TTTATGAAAGAAAAGCTAAAATCAATGCCTTGCAGGAATCAAGGTTATATTTTGGATGGATTCCCAAAGACCTATGATCAAGCAAAAGAC
CTGTTCAATCAGGAAGATGAGGAGGAGGAAGATGATGTCAGAGGCAGAATGTTTCCCTTTGATAAATTAATTATACCTGAATTCGTTTGT
GCACTGGATGCTTCGGATGAGTTTCTGAAGGAGCGTGTGATAAACCTTCCTGAGAGCATCGTGGCGGGGACCCACTACAGCCAAGACCGA
TTCCTCCGGGCTCTGAGCAACTACCGGGACATCAATATCGACGATGAGACTGTCTTCAACTATTTTGATGAACTTGAAATTCACCCGATA
CATATTGATGTAGGAAAACTTGAAGATGCTCAGAATAGACTTGCTATCAAACAGCTCATCAAAGAGATTGGGGAGCCTCGAAATTATGGT
TTAACAGACGAAGAAAAGGCAGAAGAGGAGCGGAAGGCTGCGGAGGAGCGGCTGGCCAGGGAGGCTGCTGAGGAAGCAGAACGCGAGCAC
CAGGAGGCCGTGGAGATGGCAGAGAAGATAGCTCGCTGGGAGGAGTGGAATAAACGACTGGAGGAAGTGAAAAGAGAAGAAAGAGAATTA
CTGGAGGCTCAGTCAATTCCCCTGAGAAACTATTTAATGACCTATGTGATGCCAACTCTTATTCAGGGCCTGAATGAATGTTGCAACGTC


* Fusion transcript sequences (Full-length transcript).
>In-frame_EIF3L_ENST00000412331_chr22_38270531_+_AK7_ENST00000267584_chr14_96922684_+_3646nt
AACTTTGCCTCTCCTTTACGCCAAATACGTGTCCTTATATCTGAATCTACACCACTATTATAGATTCACCTTCTTTGAGAAGTCCCTATT
TGAAGAGAGGAAAATTCAGGCTACTTGTAACCCTCTTATTCTTTTTAGACGGAGTTTTCCCTCTTGTTGCCCAGGCTAGAGTGCAATGGC
GCGATCTCGGCTCACCGCAACCTCCGCCTCCCGGGTTCAAGCGACTCTCCTGCCTCAGCCTCCCGAGTAGCTGGAATTACAGGCATGCGC
CACCACTCCCGGCTAATTTTGTATTTTTAGTAGAGACGGGGTTTCTCCATATTGGTCAGGCTGGTCTCAAACCCCCGGCCTCAGCCTCAG
GTGATCCGCCCGCCTCGGCCTCCCAAACTGGTGGGGTTACAGGTGTGAGCCACGGAACGCGGCTCCTCTTCCTTCTGGATATGGCTGTCT
CAGATGGCCAGAGGCCTCGGAAAGGCTTCCGGTTTCCCGGCAGGCCCGAGTGGGGCTGAACTTCCGGCCTCAGGACGCAGGCGCGGGCCG
CTCATTTCGCTCTTTCCGGCGGTGCTCGCAAGCGAGGCAGCCATGTCTTATCCCGCTGATGATTATGAGTCTGAGGCGGCTTATGACCCC
TACGCTTATCCCAGCGACTATGATATGCACACAGGAGATCCAAAGCAGGACCTTGCTTATGAACGTCAGTATGAACAGCAAACCTATCAG
GTGATCCCTGAGGTGATCAAAAACTTCATCCAGTATTTCCACAAAACTGTCTCAGATTTGATTGACCAGAAAGTGTATGAGCTACAGGCC
AGTCGTGTCTCCAGTGATGTCATTGACCAGAAGGTGTATGAGATCCAGGACATCTATGAGAACAGCTGGACCAAGCTGACTGAAAGATTC
TTCAAGAATACACCTTGGCCCGAGGCTGAAGCCATTGCTCCACAGGTTGGCAATGATGCTGTCTTCCTGATTTTATACAAAGAATTATAC
TACAGGCACATATATGCCAAAGTCAGTGGGGGACCTTCCTTGGAGCAGAGGTTTGAATCCTATTACAACTACTGCAATCTCTTCAACTAC
ATTCTTAATGCCGATGGTCCTGCTCCCCTTGAACTACCCAACCAGTGGCTCTGGGATATTATCGATGAGTTCATCTACCAGTTTCAGTCA
TTCAGTCAGTACCGCTGTAAGACTGCCAAGAAGTCAGAGGAGGAGATTGACTTTCTTCGTTCCAATCCCAAAATCTGGAATGTTCATAGT
GTCCTCAATGTCCTTCATTCCCTGGTAGACAAATCCAACATCAACCGACAGTTGGAGGTATACACAAGCGGAGGTGACCCTGAGAGTGTG
GCTGGGGAGTATGGGCGGCACTCCCTCTACAAAATGCTTGGTTACTTCAGCCTGGTCGGGCTTCTCCGCCTGCACTCCCTGTTAGGAGAT
TACTACCAGGCCATCAAGGTGCTGGAGAACATCGAACTGAACAAGAAGCCAATCAAGATCTGCATTCTTGGTCCCCCTGCTGTGGGAAAA
TCCAGTATTGCTAAAGAATTGGCCAACTACTACAAACTGCATCACATCCAACTGAAGGATGTCATTTCTGAAGCCATAGCAAAACTGGAG
GCGATTGTTGCCCCTAACGATGTAGGGGAAGGAGAAGAAGAAGTCGAAGAGGAAGAGGAGGAGGAGAATGTGGAAGATGCACAGGAGCTC
CTAGATGGCATCAAGGAGAGCATGGAGCAGAATGCAGGTCAACTAGACGATCAATATATAATTAGATTTATGAAAGAAAAGCTAAAATCA
ATGCCTTGCAGGAATCAAGGTTATATTTTGGATGGATTCCCAAAGACCTATGATCAAGCAAAAGACCTGTTCAATCAGGAAGATGAGGAG
GAGGAAGATGATGTCAGAGGCAGAATGTTTCCCTTTGATAAATTAATTATACCTGAATTCGTTTGTGCACTGGATGCTTCGGATGAGTTT
CTGAAGGAGCGTGTGATAAACCTTCCTGAGAGCATCGTGGCGGGGACCCACTACAGCCAAGACCGATTCCTCCGGGCTCTGAGCAACTAC
CGGGACATCAATATCGACGATGAGACTGTCTTCAACTATTTTGATGAACTTGAAATTCACCCGATACATATTGATGTAGGAAAACTTGAA
GATGCTCAGAATAGACTTGCTATCAAACAGCTCATCAAAGAGATTGGGGAGCCTCGAAATTATGGTTTAACAGACGAAGAAAAGGCAGAA
GAGGAGCGGAAGGCTGCGGAGGAGCGGCTGGCCAGGGAGGCTGCTGAGGAAGCAGAACGCGAGCACCAGGAGGCCGTGGAGATGGCAGAG
AAGATAGCTCGCTGGGAGGAGTGGAATAAACGACTGGAGGAAGTGAAAAGAGAAGAAAGAGAATTACTGGAGGCTCAGTCAATTCCCCTG
AGAAACTATTTAATGACCTATGTGATGCCAACTCTTATTCAGGGCCTGAATGAATGTTGCAACGTCCGACCCGAAGACCCTGTTGATTTT
CTGGCAGAATATCTCTTCAAGAACAATCCTGAAGCACAGTGAAACTTGAAAGATCTGGTATTATCTACCTTTACAGAACCACAGATCACT
TATTATACTTTGAAAAATTGCTTTGAAAAATGCTTTTCCAGTTCTTAGAAAATTCTTTTTTTGTAGACAAATATTCTATAAACTAGAATC
TCTATTAAAAGCTATATGACATGACTATGTCATTAAAACTATATTTGAAATGTAAATTGATAAAGACATTTGTGCATAGCTCATGAGACA
AATACTGATTTAATATTTTATTCTTTAGTCAGATCTAAATATACCGCTTCTGTACACTAATGTTTATAGGTATTTATAGCATGAAGAAAA
TCAGACTATATATTGTAGACTATGTATTATTCTAACATGTAGGCTAATTTACATGACTTGTTATCGCCCCAATAACAATGTTATTAGAAA
TGGAAATAAATTGAAGTGATTTATGCCTGTTGACTCACAGTAAATCAGACAAGATTGGTGCCTGTAAGGTGGCTTTTTTTTTTTTTTTTT
TTAAATGAAGCAATGGTTAGGGAAAGGTTGCTTTGAGTTCAGGGTCAGGATCCCAGACAATGAATCGGAGAGAACTGTAAACCTTTAGGC
GGAGAAATCTGCATAACAGGATAATTCCAATCTTTGTGATAAGTGAGAAGTTGCTAAATATTTTCAACACACTTTATAACATAGGCATAA
GTTATCAATCCTATAGTCTTTTCCAGTTCTAAAAATCCCATAAGATTCCTAGAATTACCCTAAATGAGAAATTAGTTTAGGTTTAATGGC
ATATGTATTTTATCTCTTTAAATAATGTAACCTAATATAACTGCCCGACTTTTTATTTGTGCTAAAATACATGTAACATAAAATTGACCA
CTGTAACCATTTTAAAGTGTATAATTCAGTGGCACTAAGTTCATTCACAATGATCTGCAGCCACCACTATCTAGTCCAGAACTTTCTCAT
CACCCCAAATGGAAACCCAGCACCTATTAGGCAGTCACGCTCCATTATTCCCTCCCCCCAGTTCCAGGCAACCACGAATCTGCTTTCTGT

>In-frame_EIF3L_ENST00000381683_chr22_38270531_+_AK7_ENST00000267584_chr14_96922684_+_2953nt
CTCTTTCCGGCGGTGCTCGCAAGCGAGGCAGCCATGTCTTATCCCGCTGATGATTATGAGTCTGAGGCGGCTTATGACCCCTACGCTTAT
CCCAGCGACTATGATATGCACACAGGAGATCCAAAGCAGGACCTTGCTTATGAACGTCAGTATGAACAGCAAACCTATCAGGTGATCCCT
GAGGTGATCAAAAACTTCATCCAGTATTTCCACAAAACTGTCTCAGATTTGATTGACCAGAAAGTGTATGAGCTACAGGCCAGTCGTGTC
TCCAGTGATGTCATTGACCAGAAGGTGTATGAGATCCAGGACATCTATGAGAACAGCTGGACCAAGCTGACTGAAAGATTCTTCAAGAAT
ACACCTTGGCCCGAGGCTGAAGCCATTGCTCCACAGGTTGGCAATGATGCTGTCTTCCTGATTTTATACAAAGAATTATACTACAGGCAC
ATATATGCCAAAGTCAGTTTTCAGTCATTCAGTCAGTACCGCTGTAAGACTGCCAAGAAGTCAGAGGAGGAGATTGACTTTCTTCGTTCC
AATCCCAAAATCTGGAATGTTCATAGTGTCCTCAATGTCCTTCATTCCCTGGTAGACAAATCCAACATCAACCGACAGTTGGAGGTATAC
ACAAGCGGAGGTGACCCTGAGAGTGTGGCTGGGGAGTATGGGCGGCACTCCCTCTACAAAATGCTTGGTTACTTCAGCCTGGTCGGGCTT
CTCCGCCTGCACTCCCTGTTAGGAGATTACTACCAGGCCATCAAGGTGCTGGAGAACATCGAACTGAACAAGAAGCCAATCAAGATCTGC
ATTCTTGGTCCCCCTGCTGTGGGAAAATCCAGTATTGCTAAAGAATTGGCCAACTACTACAAACTGCATCACATCCAACTGAAGGATGTC
ATTTCTGAAGCCATAGCAAAACTGGAGGCGATTGTTGCCCCTAACGATGTAGGGGAAGGAGAAGAAGAAGTCGAAGAGGAAGAGGAGGAG
GAGAATGTGGAAGATGCACAGGAGCTCCTAGATGGCATCAAGGAGAGCATGGAGCAGAATGCAGGTCAACTAGACGATCAATATATAATT
AGATTTATGAAAGAAAAGCTAAAATCAATGCCTTGCAGGAATCAAGGTTATATTTTGGATGGATTCCCAAAGACCTATGATCAAGCAAAA
GACCTGTTCAATCAGGAAGATGAGGAGGAGGAAGATGATGTCAGAGGCAGAATGTTTCCCTTTGATAAATTAATTATACCTGAATTCGTT
TGTGCACTGGATGCTTCGGATGAGTTTCTGAAGGAGCGTGTGATAAACCTTCCTGAGAGCATCGTGGCGGGGACCCACTACAGCCAAGAC
CGATTCCTCCGGGCTCTGAGCAACTACCGGGACATCAATATCGACGATGAGACTGTCTTCAACTATTTTGATGAACTTGAAATTCACCCG
ATACATATTGATGTAGGAAAACTTGAAGATGCTCAGAATAGACTTGCTATCAAACAGCTCATCAAAGAGATTGGGGAGCCTCGAAATTAT
GGTTTAACAGACGAAGAAAAGGCAGAAGAGGAGCGGAAGGCTGCGGAGGAGCGGCTGGCCAGGGAGGCTGCTGAGGAAGCAGAACGCGAG
CACCAGGAGGCCGTGGAGATGGCAGAGAAGATAGCTCGCTGGGAGGAGTGGAATAAACGACTGGAGGAAGTGAAAAGAGAAGAAAGAGAA
TTACTGGAGGCTCAGTCAATTCCCCTGAGAAACTATTTAATGACCTATGTGATGCCAACTCTTATTCAGGGCCTGAATGAATGTTGCAAC
GTCCGACCCGAAGACCCTGTTGATTTTCTGGCAGAATATCTCTTCAAGAACAATCCTGAAGCACAGTGAAACTTGAAAGATCTGGTATTA
TCTACCTTTACAGAACCACAGATCACTTATTATACTTTGAAAAATTGCTTTGAAAAATGCTTTTCCAGTTCTTAGAAAATTCTTTTTTTG
TAGACAAATATTCTATAAACTAGAATCTCTATTAAAAGCTATATGACATGACTATGTCATTAAAACTATATTTGAAATGTAAATTGATAA
AGACATTTGTGCATAGCTCATGAGACAAATACTGATTTAATATTTTATTCTTTAGTCAGATCTAAATATACCGCTTCTGTACACTAATGT
TTATAGGTATTTATAGCATGAAGAAAATCAGACTATATATTGTAGACTATGTATTATTCTAACATGTAGGCTAATTTACATGACTTGTTA
TCGCCCCAATAACAATGTTATTAGAAATGGAAATAAATTGAAGTGATTTATGCCTGTTGACTCACAGTAAATCAGACAAGATTGGTGCCT
GTAAGGTGGCTTTTTTTTTTTTTTTTTTTAAATGAAGCAATGGTTAGGGAAAGGTTGCTTTGAGTTCAGGGTCAGGATCCCAGACAATGA
ATCGGAGAGAACTGTAAACCTTTAGGCGGAGAAATCTGCATAACAGGATAATTCCAATCTTTGTGATAAGTGAGAAGTTGCTAAATATTT
TCAACACACTTTATAACATAGGCATAAGTTATCAATCCTATAGTCTTTTCCAGTTCTAAAAATCCCATAAGATTCCTAGAATTACCCTAA
ATGAGAAATTAGTTTAGGTTTAATGGCATATGTATTTTATCTCTTTAAATAATGTAACCTAATATAACTGCCCGACTTTTTATTTGTGCT
AAAATACATGTAACATAAAATTGACCACTGTAACCATTTTAAAGTGTATAATTCAGTGGCACTAAGTTCATTCACAATGATCTGCAGCCA
CCACTATCTAGTCCAGAACTTTCTCATCACCCCAAATGGAAACCCAGCACCTATTAGGCAGTCACGCTCCATTATTCCCTCCCCCCAGTT

>In-frame_EIF3L_ENST00000406934_chr22_38270531_+_AK7_ENST00000267584_chr14_96922684_+_3485nt
AGGTAAGGTGGCCGTAAGGGCGCGGTGGGCTCCACGACGGGGTGATCTCTGGGACCACTGGATGTGGGTCCCGGCGCGAGGCAGCTTCCG
GGTCGCGGCCAGCTCCGGCCGACCTCCCGCCCGGCCCTCAGGCTGCTCCCACAGTTCCCGGTCCCTAGACAACCCTGGCTCTGCCCGCCC
ACTTCGCGTGTTCGATTGGCTTGTCCTTCCCCTTTCTAAGACCGGAGACTAAGGCCTGTTAGACGTTTCTGTGTTTCTGCACCTGAGTTT
TTTTGGTCTAGGCTCCGTCTGGTCAAATCTCGCTGATTCCCACAGCCTCTTGTCCTTTGCTCCACCTCATTGCACCCGTAATGTTGTATT
GTCATTGTCTGTTTACTGTCCCTTTTCTCTAAGGCGTGTGAGTTCCTCAAAGGCAGGCACAGTGTCTTATTCGCCTCTGTATCCTTAGCT
CTCTGCTTGGCATCTAGACTCTAGGATGAGCGTTTTGAATTCACGACTTGGCGGCTGTCCTTGACTGTGTCTCTTTCCTTCTAGGCGGCT
TATGACCCCTACGCTTATCCCAGCGACTATGATATGCACACAGGAGATCCAAAGCAGGACCTTGCTTATGAACGTCAGTATGAACAGCAA
ACCTATCAGGTGATCCCTGAGGTGATCAAAAACTTCATCCAGTATTTCCACAAAACTGTCTCAGATTTGATTGACCAGAAAGTGTATGAG
CTACAGGCCAGTCGTGTCTCCAGTGATGTCATTGACCAGAAGGTGTATGAGATCCAGGACATCTATGAGAACAGATGCTGTCTTCCTGAT
TTTATACAAAGAATTATACTACAGGCACATATATGCCAAAGTCAGTGGGGGACCTTCCTTGGAGCAGAGGTTTGAATCCTATTACAACTA
CTGCAATCTCTTCAACTACATTCTTAATGCCGATGGTCCTGCTCCCCTTGAACTACCCAACCAGTGGCTCTGGGATATTATCGATGAGTT
CATCTACCAGTTTCAGTCATTCAGTCAGTACCGCTGTAAGACTGCCAAGAAGTCAGAGGAGGAGATTGACTTTCTTCGTTCCAATCCCAA
AATCTGGAATGTTCATAGTGTCCTCAATGTCCTTCATTCCCTGGTAGACAAATCCAACATCAACCGACAGTTGGAGGTATACACAAGCGG
AGGTGACCCTGAGAGTGTGGCTGGGGAGTATGGGCGGCACTCCCTCTACAAAATGCTTGGTTACTTCAGCCTGGTCGGGCTTCTCCGCCT
GCACTCCCTGTTAGGAGATTACTACCAGGCCATCAAGGTGCTGGAGAACATCGAACTGAACAAGAAGCCAATCAAGATCTGCATTCTTGG
TCCCCCTGCTGTGGGAAAATCCAGTATTGCTAAAGAATTGGCCAACTACTACAAACTGCATCACATCCAACTGAAGGATGTCATTTCTGA
AGCCATAGCAAAACTGGAGGCGATTGTTGCCCCTAACGATGTAGGGGAAGGAGAAGAAGAAGTCGAAGAGGAAGAGGAGGAGGAGAATGT
GGAAGATGCACAGGAGCTCCTAGATGGCATCAAGGAGAGCATGGAGCAGAATGCAGGTCAACTAGACGATCAATATATAATTAGATTTAT
GAAAGAAAAGCTAAAATCAATGCCTTGCAGGAATCAAGGTTATATTTTGGATGGATTCCCAAAGACCTATGATCAAGCAAAAGACCTGTT
CAATCAGGAAGATGAGGAGGAGGAAGATGATGTCAGAGGCAGAATGTTTCCCTTTGATAAATTAATTATACCTGAATTCGTTTGTGCACT
GGATGCTTCGGATGAGTTTCTGAAGGAGCGTGTGATAAACCTTCCTGAGAGCATCGTGGCGGGGACCCACTACAGCCAAGACCGATTCCT
CCGGGCTCTGAGCAACTACCGGGACATCAATATCGACGATGAGACTGTCTTCAACTATTTTGATGAACTTGAAATTCACCCGATACATAT
TGATGTAGGAAAACTTGAAGATGCTCAGAATAGACTTGCTATCAAACAGCTCATCAAAGAGATTGGGGAGCCTCGAAATTATGGTTTAAC
AGACGAAGAAAAGGCAGAAGAGGAGCGGAAGGCTGCGGAGGAGCGGCTGGCCAGGGAGGCTGCTGAGGAAGCAGAACGCGAGCACCAGGA
GGCCGTGGAGATGGCAGAGAAGATAGCTCGCTGGGAGGAGTGGAATAAACGACTGGAGGAAGTGAAAAGAGAAGAAAGAGAATTACTGGA
GGCTCAGTCAATTCCCCTGAGAAACTATTTAATGACCTATGTGATGCCAACTCTTATTCAGGGCCTGAATGAATGTTGCAACGTCCGACC
CGAAGACCCTGTTGATTTTCTGGCAGAATATCTCTTCAAGAACAATCCTGAAGCACAGTGAAACTTGAAAGATCTGGTATTATCTACCTT
TACAGAACCACAGATCACTTATTATACTTTGAAAAATTGCTTTGAAAAATGCTTTTCCAGTTCTTAGAAAATTCTTTTTTTGTAGACAAA
TATTCTATAAACTAGAATCTCTATTAAAAGCTATATGACATGACTATGTCATTAAAACTATATTTGAAATGTAAATTGATAAAGACATTT
GTGCATAGCTCATGAGACAAATACTGATTTAATATTTTATTCTTTAGTCAGATCTAAATATACCGCTTCTGTACACTAATGTTTATAGGT
ATTTATAGCATGAAGAAAATCAGACTATATATTGTAGACTATGTATTATTCTAACATGTAGGCTAATTTACATGACTTGTTATCGCCCCA
ATAACAATGTTATTAGAAATGGAAATAAATTGAAGTGATTTATGCCTGTTGACTCACAGTAAATCAGACAAGATTGGTGCCTGTAAGGTG
GCTTTTTTTTTTTTTTTTTTTAAATGAAGCAATGGTTAGGGAAAGGTTGCTTTGAGTTCAGGGTCAGGATCCCAGACAATGAATCGGAGA
GAACTGTAAACCTTTAGGCGGAGAAATCTGCATAACAGGATAATTCCAATCTTTGTGATAAGTGAGAAGTTGCTAAATATTTTCAACACA
CTTTATAACATAGGCATAAGTTATCAATCCTATAGTCTTTTCCAGTTCTAAAAATCCCATAAGATTCCTAGAATTACCCTAAATGAGAAA
TTAGTTTAGGTTTAATGGCATATGTATTTTATCTCTTTAAATAATGTAACCTAATATAACTGCCCGACTTTTTATTTGTGCTAAAATACA
TGTAACATAAAATTGACCACTGTAACCATTTTAAAGTGTATAATTCAGTGGCACTAAGTTCATTCACAATGATCTGCAGCCACCACTATC
TAGTCCAGAACTTTCTCATCACCCCAAATGGAAACCCAGCACCTATTAGGCAGTCACGCTCCATTATTCCCTCCCCCCAGTTCCAGGCAA


Top

FusionGenePPI for EIF3L_AK7


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
EIF3LEIF3K, EIF3A, EIF1B, EIF4A2, EIF3D, EIF3E, EIF3H, EIF3F, H2AFX, TADA2A, AGO3, HDAC5, EIF3B, RGS2, SIRT7, CUL1, EIF3C, EIF3G, EIF3M, EIF3I, NCL, FN1, VCAM1, SMAD2, ITGA4, RRN3, CD81, IGSF8, ICAM1, XRN2, DDX3X, KCMF1, LARP1, RPS13, RPS16, RPS18, RPS20, RPS25, RPS28, RPS4X, RPS5, RPS8, RPS9, RIOK2, RNF2, EIF3CL, EIF2B5, NUMA1, NTRK1, HERC2, XPO1, AHSA1, NPM1, RPL10, CEP170P1, GAN, MCM2, C1orf131, ZNF746, PRRC2B, PSMD12, GNB2, PTP4A1, TTC21B, CYLD, G3BP1, BRCA1, YAP1AK7TNPO3, GPKOW, MUC13, ZC3H14


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for EIF3L_AK7


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for EIF3L_AK7


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource