FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 11161

FusionGeneSummary for EHF_CAT

check button Fusion gene summary
Fusion gene informationFusion gene name: EHF_CAT
Fusion gene ID: 11161
HgeneTgene
Gene symbol

EHF

CAT

Gene ID

26298

10249

Gene nameETS homologous factorglycine-N-acyltransferase
SynonymsESE3|ESE3B|ESEJACGNAT|CAT|GAT
Cytomap

11p13

11q12.1

Type of geneprotein-codingprotein-coding
DescriptionETS homologous factorESE3 transcription factorETS domain-containing transcription factorepithelium-specific Ets transcription factor 3hEHFglycine N-acyltransferaseAAcHRP-1(CLP)acyl-CoA:glycine N-acyltransferasearalkyl acyl-CoA N-acyltransferasearalkyl acyl-CoA:amino acid N-acyltransferasearalkyl-CoA N-acyltransferasebenzoyl-coenzyme A:glycine N-acyltransferaseglycine N-benzoyltransf
Modification date2018052320180519
UniProtAcc

Q9NZC4

P04040

Ensembl transtripts involved in fusion geneENST00000527001, ENST00000257831, 
ENST00000450654, ENST00000530286, 
ENST00000533754, ENST00000531728, 
ENST00000531794, ENST00000527935, 
ENST00000241052, ENST00000534710, 
Fusion gene scores* DoF score8 X 9 X 4=28810 X 6 X 6=360
# samples 912
** MAII scorelog2(9/288*10)=-1.67807190511264
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(12/360*10)=-1.58496250072116
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: EHF [Title/Abstract] AND CAT [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotation
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneEHF

GO:0045893

positive regulation of transcription, DNA-templated

10644770

HgeneEHF

GO:0045944

positive regulation of transcription by RNA polymerase II

17027647

TgeneCAT

GO:0006544

glycine metabolic process

22475485

TgeneCAT

GO:1901787

benzoyl-CoA metabolic process

22475485


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDBRCATCGA-BH-A0B9-01AEHFchr11

34668231

+CATchr11

34485652

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
intron-3CDSENST00000527001ENST00000241052EHFchr11

34668231

+CATchr11

34485652

+
intron-intronENST00000527001ENST00000534710EHFchr11

34668231

+CATchr11

34485652

+
In-frameENST00000257831ENST00000241052EHFchr11

34668231

+CATchr11

34485652

+
5CDS-intronENST00000257831ENST00000534710EHFchr11

34668231

+CATchr11

34485652

+
In-frameENST00000450654ENST00000241052EHFchr11

34668231

+CATchr11

34485652

+
5CDS-intronENST00000450654ENST00000534710EHFchr11

34668231

+CATchr11

34485652

+
In-frameENST00000530286ENST00000241052EHFchr11

34668231

+CATchr11

34485652

+
5CDS-intronENST00000530286ENST00000534710EHFchr11

34668231

+CATchr11

34485652

+
In-frameENST00000533754ENST00000241052EHFchr11

34668231

+CATchr11

34485652

+
5CDS-intronENST00000533754ENST00000534710EHFchr11

34668231

+CATchr11

34485652

+
In-frameENST00000531728ENST00000241052EHFchr11

34668231

+CATchr11

34485652

+
5CDS-intronENST00000531728ENST00000534710EHFchr11

34668231

+CATchr11

34485652

+
In-frameENST00000531794ENST00000241052EHFchr11

34668231

+CATchr11

34485652

+
5CDS-intronENST00000531794ENST00000534710EHFchr11

34668231

+CATchr11

34485652

+
In-frameENST00000527935ENST00000241052EHFchr11

34668231

+CATchr11

34485652

+
5CDS-intronENST00000527935ENST00000534710EHFchr11

34668231

+CATchr11

34485652

+

Top

FusionProtFeatures for EHF_CAT


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
EHF

Q9NZC4

CAT

P04040

Transcriptional activator that may play a role inregulating epithelial cell differentiation and proliferation. Mayact as a repressor for a specific subset of ETS/AP-1-responsivegenes and as a modulator of the nuclear response to mitogen-activated protein kinase signaling cascades. Binds to DNAsequences containing the consensus nucleotide core sequence GGAA.Involved in regulation of TNFRSF10B/DR5 expression through Ets-binding sequences on the TNFRSF10B/DR5 promoter. May contribute todevelopment and carcinogenesis by acting as a tumor suppressorgene or anti-oncogene. {ECO:0000269|PubMed:10527851,ECO:0000269|PubMed:10644770, ECO:0000269|PubMed:11259407,ECO:0000269|PubMed:12444029, ECO:0000269|PubMed:17027647}. Occurs in almost all aerobically respiring organisms andserves to protect cells from the toxic effects of hydrogenperoxide. Promotes growth of cells including T-cells, B-cells,myeloid leukemia cells, melanoma cells, mastocytoma cells andnormal and transformed fibroblast cells.{ECO:0000269|PubMed:7882369}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note


Top

FusionGeneSequence for EHF_CAT


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_EHF_ENST00000257831_chr11_34668231_+_CAT_ENST00000241052_chr11_34485652_+_244aa
MILEGGGVMNLNPGNNLLHQPPAWTDSYSTCNVSSGFFGGQWHEIHPQYWTKYQVWEWLQHLLDTNQLDANCIPFQEFDINGEHLCSMSL
QEFTRAAGTAGQLLYSNLQHLKWNGGAPNYYPNSFGAPEQQPSALEHSIQTSGEVRRFNTANDDNVTQVRAFTVNVLNEEQRKRLCENIA

>In-frame_EHF_ENST00000450654_chr11_34668231_+_CAT_ENST00000241052_chr11_34485652_+_244aa
MILEGGGVMNLNPGNNLLHQPPAWTDSYSTCNVSSGFFGGQWHEIHPQYWTKYQVWEWLQHLLDTNQLDANCIPFQEFDINGEHLCSMSL
QEFTRAAGTAGQLLYSNLQHLKWNGGAPNYYPNSFGAPEQQPSALEHSIQTSGEVRRFNTANDDNVTQVRAFTVNVLNEEQRKRLCENIA

>In-frame_EHF_ENST00000530286_chr11_34668231_+_CAT_ENST00000241052_chr11_34485652_+_244aa
MILEGGGVMNLNPGNNLLHQPPAWTDSYSTCNVSSGFFGGQWHEIHPQYWTKYQVWEWLQHLLDTNQLDANCIPFQEFDINGEHLCSMSL
QEFTRAAGTAGQLLYSNLQHLKWNGGAPNYYPNSFGAPEQQPSALEHSIQTSGEVRRFNTANDDNVTQVRAFTVNVLNEEQRKRLCENIA

>In-frame_EHF_ENST00000533754_chr11_34668231_+_CAT_ENST00000241052_chr11_34485652_+_244aa
MILEGGGVMNLNPGNNLLHQPPAWTDSYSTCNVSSGFFGGQWHEIHPQYWTKYQVWEWLQHLLDTNQLDANCIPFQEFDINGEHLCSMSL
QEFTRAAGTAGQLLYSNLQHLKWNGGAPNYYPNSFGAPEQQPSALEHSIQTSGEVRRFNTANDDNVTQVRAFTVNVLNEEQRKRLCENIA

>In-frame_EHF_ENST00000531728_chr11_34668231_+_CAT_ENST00000241052_chr11_34485652_+_273aa
MILEGGGVMNLNPGNNLLHQPPAWTDSYSTCNVSSGFFGGQWHEIHPQYWTKYQVWEWLQHLLDTNQLDANCIPFQEFDINGEHLCSMSL
QEFTRAAGTAGQLLYSNLQHLKWNGDSLFLCLSLPC_EPAGRIEILQMTGFFVSGAPNYYPNSFGAPEQQPSALEHSIQTSGEVRRFNTA
NDDNVTQVRAFTVNVLNEEQRKRLCENIAGHLKDAQIFIQKKAVKNFTEVHPDYGSHIQALLDKYNAEKPKNAIHTFVQSGSHLAAREKA

>In-frame_EHF_ENST00000531794_chr11_34668231_+_CAT_ENST00000241052_chr11_34485652_+_266aa
MGLPERRGLVLLLSLAEILFKIMILEGGGVMNLNPGNNLLHQPPAWTDSYSTCNVSSGFFGGQWHEIHPQYWTKYQVWEWLQHLLDTNQL
DANCIPFQEFDINGEHLCSMSLQEFTRAAGTAGQLLYSNLQHLKWNGGAPNYYPNSFGAPEQQPSALEHSIQTSGEVRRFNTANDDNVTQ

>In-frame_EHF_ENST00000527935_chr11_34668231_+_CAT_ENST00000241052_chr11_34485652_+_314aa
MILEGGGVMNLNPGNNLLHQPPAWTDSYSTCNVSSGFFGGQWHEIHPQYWTKYQVWEWLQHLLDTNQLDANCIPFQEFDINGEHLCSMSL
QEFTRAAGTAGQLLYSNLQHLKWNGDSLFLCLSLPC_EPAGRIEILQMTGFFVRDKKEWSHLQITMSQDREMEGR_KDRIEA_GTWCA_S
LINASGAPNYYPNSFGAPEQQPSALEHSIQTSGEVRRFNTANDDNVTQVRAFTVNVLNEEQRKRLCENIAGHLKDAQIFIQKKAVKNFTE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_EHF_ENST00000257831_chr11_34668231_+_CAT_ENST00000241052_chr11_34485652_+_732nt
ATGATTCTGGAAGGAGGTGGTGTAATGAATCTCAACCCCGGCAACAACCTCCTTCACCAGCCGCCAGCCTGGACAGACAGCTACTCCACG
TGCAATGTTTCCAGTGGGTTTTTTGGAGGCCAGTGGCATGAAATTCATCCTCAGTACTGGACCAAGTACCAGGTGTGGGAGTGGCTCCAG
CACCTCCTGGACACCAACCAGCTGGATGCCAATTGTATCCCTTTCCAAGAGTTCGACATCAACGGCGAGCACCTCTGCAGCATGAGTTTG
CAGGAGTTCACCCGGGCGGCAGGGACGGCGGGGCAGCTCCTCTACAGCAACTTGCAGCATCTGAAGTGGAACGGTGGTGCTCCAAATTAC
TACCCCAACAGCTTTGGTGCTCCGGAACAACAGCCTTCTGCCCTGGAGCACAGCATCCAATATTCTGGAGAAGTGCGGAGATTCAACACT
GCCAATGATGATAACGTTACTCAGGTGCGGGCATTCTATGTGAACGTGCTGAATGAGGAACAGAGGAAACGTCTGTGTGAGAACATTGCC
GGCCACCTGAAGGATGCACAAATTTTCATCCAGAAGAAAGCGGTCAAGAACTTCACTGAGGTCCACCCTGACTACGGGAGCCACATCCAG
GCTCTTCTGGACAAGTACAATGCTGAGAAGCCTAAGAATGCGATTCACACCTTTGTGCAGTCCGGATCTCACTTGGCGGCAAGGGAGAAG

>In-frame_EHF_ENST00000450654_chr11_34668231_+_CAT_ENST00000241052_chr11_34485652_+_732nt
ATGATTCTGGAAGGAGGTGGTGTAATGAATCTCAACCCCGGCAACAACCTCCTTCACCAGCCGCCAGCCTGGACAGACAGCTACTCCACG
TGCAATGTTTCCAGTGGGTTTTTTGGAGGCCAGTGGCATGAAATTCATCCTCAGTACTGGACCAAGTACCAGGTGTGGGAGTGGCTCCAG
CACCTCCTGGACACCAACCAGCTGGATGCCAATTGTATCCCTTTCCAAGAGTTCGACATCAACGGCGAGCACCTCTGCAGCATGAGTTTG
CAGGAGTTCACCCGGGCGGCAGGGACGGCGGGGCAGCTCCTCTACAGCAACTTGCAGCATCTGAAGTGGAACGGTGGTGCTCCAAATTAC
TACCCCAACAGCTTTGGTGCTCCGGAACAACAGCCTTCTGCCCTGGAGCACAGCATCCAATATTCTGGAGAAGTGCGGAGATTCAACACT
GCCAATGATGATAACGTTACTCAGGTGCGGGCATTCTATGTGAACGTGCTGAATGAGGAACAGAGGAAACGTCTGTGTGAGAACATTGCC
GGCCACCTGAAGGATGCACAAATTTTCATCCAGAAGAAAGCGGTCAAGAACTTCACTGAGGTCCACCCTGACTACGGGAGCCACATCCAG
GCTCTTCTGGACAAGTACAATGCTGAGAAGCCTAAGAATGCGATTCACACCTTTGTGCAGTCCGGATCTCACTTGGCGGCAAGGGAGAAG

>In-frame_EHF_ENST00000530286_chr11_34668231_+_CAT_ENST00000241052_chr11_34485652_+_732nt
ATGATTCTGGAAGGAGGTGGTGTAATGAATCTCAACCCCGGCAACAACCTCCTTCACCAGCCGCCAGCCTGGACAGACAGCTACTCCACG
TGCAATGTTTCCAGTGGGTTTTTTGGAGGCCAGTGGCATGAAATTCATCCTCAGTACTGGACCAAGTACCAGGTGTGGGAGTGGCTCCAG
CACCTCCTGGACACCAACCAGCTGGATGCCAATTGTATCCCTTTCCAAGAGTTCGACATCAACGGCGAGCACCTCTGCAGCATGAGTTTG
CAGGAGTTCACCCGGGCGGCAGGGACGGCGGGGCAGCTCCTCTACAGCAACTTGCAGCATCTGAAGTGGAACGGTGGTGCTCCAAATTAC
TACCCCAACAGCTTTGGTGCTCCGGAACAACAGCCTTCTGCCCTGGAGCACAGCATCCAATATTCTGGAGAAGTGCGGAGATTCAACACT
GCCAATGATGATAACGTTACTCAGGTGCGGGCATTCTATGTGAACGTGCTGAATGAGGAACAGAGGAAACGTCTGTGTGAGAACATTGCC
GGCCACCTGAAGGATGCACAAATTTTCATCCAGAAGAAAGCGGTCAAGAACTTCACTGAGGTCCACCCTGACTACGGGAGCCACATCCAG
GCTCTTCTGGACAAGTACAATGCTGAGAAGCCTAAGAATGCGATTCACACCTTTGTGCAGTCCGGATCTCACTTGGCGGCAAGGGAGAAG

>In-frame_EHF_ENST00000533754_chr11_34668231_+_CAT_ENST00000241052_chr11_34485652_+_732nt
ATGATTCTGGAAGGAGGTGGTGTAATGAATCTCAACCCCGGCAACAACCTCCTTCACCAGCCGCCAGCCTGGACAGACAGCTACTCCACG
TGCAATGTTTCCAGTGGGTTTTTTGGAGGCCAGTGGCATGAAATTCATCCTCAGTACTGGACCAAGTACCAGGTGTGGGAGTGGCTCCAG
CACCTCCTGGACACCAACCAGCTGGATGCCAATTGTATCCCTTTCCAAGAGTTCGACATCAACGGCGAGCACCTCTGCAGCATGAGTTTG
CAGGAGTTCACCCGGGCGGCAGGGACGGCGGGGCAGCTCCTCTACAGCAACTTGCAGCATCTGAAGTGGAACGGTGGTGCTCCAAATTAC
TACCCCAACAGCTTTGGTGCTCCGGAACAACAGCCTTCTGCCCTGGAGCACAGCATCCAATATTCTGGAGAAGTGCGGAGATTCAACACT
GCCAATGATGATAACGTTACTCAGGTGCGGGCATTCTATGTGAACGTGCTGAATGAGGAACAGAGGAAACGTCTGTGTGAGAACATTGCC
GGCCACCTGAAGGATGCACAAATTTTCATCCAGAAGAAAGCGGTCAAGAACTTCACTGAGGTCCACCCTGACTACGGGAGCCACATCCAG
GCTCTTCTGGACAAGTACAATGCTGAGAAGCCTAAGAATGCGATTCACACCTTTGTGCAGTCCGGATCTCACTTGGCGGCAAGGGAGAAG

>In-frame_EHF_ENST00000531728_chr11_34668231_+_CAT_ENST00000241052_chr11_34485652_+_819nt
ATGATTCTGGAAGGAGGTGGTGTAATGAATCTCAACCCCGGCAACAACCTCCTTCACCAGCCGCCAGCCTGGACAGACAGCTACTCCACG
TGCAATGTTTCCAGTGGGTTTTTTGGAGGCCAGTGGCATGAAATTCATCCTCAGTACTGGACCAAGTACCAGGTGTGGGAGTGGCTCCAG
CACCTCCTGGACACCAACCAGCTGGATGCCAATTGTATCCCTTTCCAAGAGTTCGACATCAACGGCGAGCACCTCTGCAGCATGAGTTTG
CAGGAGTTCACCCGGGCGGCAGGGACGGCGGGGCAGCTCCTCTACAGCAACTTGCAGCATCTGAAGTGGAACGGTGACTCTCTCTTTCTG
TGTCTCTCCCTACCCTGCTAGGAGCCAGCTGGAAGAATAGAGATTCTGCAGATGACAGGATTCTTTGTCAGTGGTGCTCCAAATTACTAC
CCCAACAGCTTTGGTGCTCCGGAACAACAGCCTTCTGCCCTGGAGCACAGCATCCAATATTCTGGAGAAGTGCGGAGATTCAACACTGCC
AATGATGATAACGTTACTCAGGTGCGGGCATTCTATGTGAACGTGCTGAATGAGGAACAGAGGAAACGTCTGTGTGAGAACATTGCCGGC
CACCTGAAGGATGCACAAATTTTCATCCAGAAGAAAGCGGTCAAGAACTTCACTGAGGTCCACCCTGACTACGGGAGCCACATCCAGGCT
CTTCTGGACAAGTACAATGCTGAGAAGCCTAAGAATGCGATTCACACCTTTGTGCAGTCCGGATCTCACTTGGCGGCAAGGGAGAAGGCA

>In-frame_EHF_ENST00000531794_chr11_34668231_+_CAT_ENST00000241052_chr11_34485652_+_798nt
ATGGGGTTGCCGGAGAGAAGAGGATTGGTCCTGCTTTTAAGCCTAGCTGAAATTCTTTTCAAGATCATGATTCTGGAAGGAGGTGGTGTA
ATGAATCTCAACCCCGGCAACAACCTCCTTCACCAGCCGCCAGCCTGGACAGACAGCTACTCCACGTGCAATGTTTCCAGTGGGTTTTTT
GGAGGCCAGTGGCATGAAATTCATCCTCAGTACTGGACCAAGTACCAGGTGTGGGAGTGGCTCCAGCACCTCCTGGACACCAACCAGCTG
GATGCCAATTGTATCCCTTTCCAAGAGTTCGACATCAACGGCGAGCACCTCTGCAGCATGAGTTTGCAGGAGTTCACCCGGGCGGCAGGG
ACGGCGGGGCAGCTCCTCTACAGCAACTTGCAGCATCTGAAGTGGAACGGTGGTGCTCCAAATTACTACCCCAACAGCTTTGGTGCTCCG
GAACAACAGCCTTCTGCCCTGGAGCACAGCATCCAATATTCTGGAGAAGTGCGGAGATTCAACACTGCCAATGATGATAACGTTACTCAG
GTGCGGGCATTCTATGTGAACGTGCTGAATGAGGAACAGAGGAAACGTCTGTGTGAGAACATTGCCGGCCACCTGAAGGATGCACAAATT
TTCATCCAGAAGAAAGCGGTCAAGAACTTCACTGAGGTCCACCCTGACTACGGGAGCCACATCCAGGCTCTTCTGGACAAGTACAATGCT

>In-frame_EHF_ENST00000527935_chr11_34668231_+_CAT_ENST00000241052_chr11_34485652_+_942nt
ATGATTCTGGAAGGAGGTGGTGTAATGAATCTCAACCCCGGCAACAACCTCCTTCACCAGCCGCCAGCCTGGACAGACAGCTACTCCACG
TGCAATGTTTCCAGTGGGTTTTTTGGAGGCCAGTGGCATGAAATTCATCCTCAGTACTGGACCAAGTACCAGGTGTGGGAGTGGCTCCAG
CACCTCCTGGACACCAACCAGCTGGATGCCAATTGTATCCCTTTCCAAGAGTTCGACATCAACGGCGAGCACCTCTGCAGCATGAGTTTG
CAGGAGTTCACCCGGGCGGCAGGGACGGCGGGGCAGCTCCTCTACAGCAACTTGCAGCATCTGAAGTGGAACGGTGACTCTCTCTTTCTG
TGTCTCTCCCTACCCTGCTAGGAGCCAGCTGGAAGAATAGAGATTCTGCAGATGACAGGATTCTTTGTCAGGGACAAGAAAGAGTGGTCT
CACCTCCAAATTACCATGTCCCAAGACAGAGAAATGGAAGGAAGATGAAAGGACAGGATTGAAGCATAGGGTACCTGGTGTGCCTAATCC
CTTATAAATGCCAGTGGTGCTCCAAATTACTACCCCAACAGCTTTGGTGCTCCGGAACAACAGCCTTCTGCCCTGGAGCACAGCATCCAA
TATTCTGGAGAAGTGCGGAGATTCAACACTGCCAATGATGATAACGTTACTCAGGTGCGGGCATTCTATGTGAACGTGCTGAATGAGGAA
CAGAGGAAACGTCTGTGTGAGAACATTGCCGGCCACCTGAAGGATGCACAAATTTTCATCCAGAAGAAAGCGGTCAAGAACTTCACTGAG
GTCCACCCTGACTACGGGAGCCACATCCAGGCTCTTCTGGACAAGTACAATGCTGAGAAGCCTAAGAATGCGATTCACACCTTTGTGCAG


* Fusion transcript sequences (Full-length transcript).
>In-frame_EHF_ENST00000257831_chr11_34668231_+_CAT_ENST00000241052_chr11_34485652_+_1482nt
ACTTGATAACACCCGTGGTGCCCCATCCCTATAGGAGCTGGTGAGATTGCAGCCTGCTGCCTCCCCTCCAACAGCCACAGCTATTGGATT
TCCCACCCAGAATCTTTAGGTAAATGAGATCATGATTCTGGAAGGAGGTGGTGTAATGAATCTCAACCCCGGCAACAACCTCCTTCACCA
GCCGCCAGCCTGGACAGACAGCTACTCCACGTGCAATGTTTCCAGTGGGTTTTTTGGAGGCCAGTGGCATGAAATTCATCCTCAGTACTG
GACCAAGTACCAGGTGTGGGAGTGGCTCCAGCACCTCCTGGACACCAACCAGCTGGATGCCAATTGTATCCCTTTCCAAGAGTTCGACAT
CAACGGCGAGCACCTCTGCAGCATGAGTTTGCAGGAGTTCACCCGGGCGGCAGGGACGGCGGGGCAGCTCCTCTACAGCAACTTGCAGCA
TCTGAAGTGGAACGGTGGTGCTCCAAATTACTACCCCAACAGCTTTGGTGCTCCGGAACAACAGCCTTCTGCCCTGGAGCACAGCATCCA
ATATTCTGGAGAAGTGCGGAGATTCAACACTGCCAATGATGATAACGTTACTCAGGTGCGGGCATTCTATGTGAACGTGCTGAATGAGGA
ACAGAGGAAACGTCTGTGTGAGAACATTGCCGGCCACCTGAAGGATGCACAAATTTTCATCCAGAAGAAAGCGGTCAAGAACTTCACTGA
GGTCCACCCTGACTACGGGAGCCACATCCAGGCTCTTCTGGACAAGTACAATGCTGAGAAGCCTAAGAATGCGATTCACACCTTTGTGCA
GTCCGGATCTCACTTGGCGGCAAGGGAGAAGGCAAATCTGTGAGGCCGGGGCCCTGCACCTGTGCAGCGAAGCTTAGCGTTCATCCGTGT
AACCCGCTCATCACTGGATGAAGATTCTCCTGTGCTAGATGTGCAAATGCAAGCTAGTGGCTTCAAAATAGAGAATCCCACTTTCTATAG
CAGATTGTGTAACAATTTTAATGCTATTTCCCCAGGGGAAAATGAAGGTTAGGATTTAACAGTCATTTAAAAAAAAAATTTGTTTTGACG
GATGATTGGATTATTCATTTAAAATGATTAGAAGGCAAGTTTCTAGCTAGAAATATGATTTTATTTGACAAAATTTGTTGAAATTATGTA
TGTTTACATATCACCTCATGGCCTATTATATTAAAATATGGCTATAAATATATAAAAAGAAAAGATAAAGATGATCTACTCAGAAATTTT
TATTTTTCTAAGGTTCTCATAGGAAAAGTACATTTAATACAGCAGTGTCATCAGAAGATAACTTGAGCACCGTCATGGCTTAATGTTTAT
TCCTGATAATAATTGATCAAATTCATTTTTTTCACTGGAGTTACATTAATGTTAATTCAGCACTGATTTCACAACAGATCAATTTGTAAT

>In-frame_EHF_ENST00000450654_chr11_34668231_+_CAT_ENST00000241052_chr11_34485652_+_1458nt
ATCCCTATAGGAGCTGGTGAGATTGCAGCCTGCTGCCTCCCCTCCAACAGCCACAGCTATTGGATTTCCCACCCAGAATCTTTAGGTAAA
TGAGATCATGATTCTGGAAGGAGGTGGTGTAATGAATCTCAACCCCGGCAACAACCTCCTTCACCAGCCGCCAGCCTGGACAGACAGCTA
CTCCACGTGCAATGTTTCCAGTGGGTTTTTTGGAGGCCAGTGGCATGAAATTCATCCTCAGTACTGGACCAAGTACCAGGTGTGGGAGTG
GCTCCAGCACCTCCTGGACACCAACCAGCTGGATGCCAATTGTATCCCTTTCCAAGAGTTCGACATCAACGGCGAGCACCTCTGCAGCAT
GAGTTTGCAGGAGTTCACCCGGGCGGCAGGGACGGCGGGGCAGCTCCTCTACAGCAACTTGCAGCATCTGAAGTGGAACGGTGGTGCTCC
AAATTACTACCCCAACAGCTTTGGTGCTCCGGAACAACAGCCTTCTGCCCTGGAGCACAGCATCCAATATTCTGGAGAAGTGCGGAGATT
CAACACTGCCAATGATGATAACGTTACTCAGGTGCGGGCATTCTATGTGAACGTGCTGAATGAGGAACAGAGGAAACGTCTGTGTGAGAA
CATTGCCGGCCACCTGAAGGATGCACAAATTTTCATCCAGAAGAAAGCGGTCAAGAACTTCACTGAGGTCCACCCTGACTACGGGAGCCA
CATCCAGGCTCTTCTGGACAAGTACAATGCTGAGAAGCCTAAGAATGCGATTCACACCTTTGTGCAGTCCGGATCTCACTTGGCGGCAAG
GGAGAAGGCAAATCTGTGAGGCCGGGGCCCTGCACCTGTGCAGCGAAGCTTAGCGTTCATCCGTGTAACCCGCTCATCACTGGATGAAGA
TTCTCCTGTGCTAGATGTGCAAATGCAAGCTAGTGGCTTCAAAATAGAGAATCCCACTTTCTATAGCAGATTGTGTAACAATTTTAATGC
TATTTCCCCAGGGGAAAATGAAGGTTAGGATTTAACAGTCATTTAAAAAAAAAATTTGTTTTGACGGATGATTGGATTATTCATTTAAAA
TGATTAGAAGGCAAGTTTCTAGCTAGAAATATGATTTTATTTGACAAAATTTGTTGAAATTATGTATGTTTACATATCACCTCATGGCCT
ATTATATTAAAATATGGCTATAAATATATAAAAAGAAAAGATAAAGATGATCTACTCAGAAATTTTTATTTTTCTAAGGTTCTCATAGGA
AAAGTACATTTAATACAGCAGTGTCATCAGAAGATAACTTGAGCACCGTCATGGCTTAATGTTTATTCCTGATAATAATTGATCAAATTC
ATTTTTTTCACTGGAGTTACATTAATGTTAATTCAGCACTGATTTCACAACAGATCAATTTGTAATTGCTTACATTTTTACAATAAATAA

>In-frame_EHF_ENST00000530286_chr11_34668231_+_CAT_ENST00000241052_chr11_34485652_+_1501nt
CTCAGCAGCAACAAATGCCTTCTGAGACAGGGATTCTTTTGATTTTGCTTGGACATTGTGGAGAAGTGTTAGCCCCAATGTGGACTGATC
TGGGAACAGTGGGAAATTAACTTCTTGTTGGTAAATATCAGGCTGAGATCATGATTCTGGAAGGAGGTGGTGTAATGAATCTCAACCCCG
GCAACAACCTCCTTCACCAGCCGCCAGCCTGGACAGACAGCTACTCCACGTGCAATGTTTCCAGTGGGTTTTTTGGAGGCCAGTGGCATG
AAATTCATCCTCAGTACTGGACCAAGTACCAGGTGTGGGAGTGGCTCCAGCACCTCCTGGACACCAACCAGCTGGATGCCAATTGTATCC
CTTTCCAAGAGTTCGACATCAACGGCGAGCACCTCTGCAGCATGAGTTTGCAGGAGTTCACCCGGGCGGCAGGGACGGCGGGGCAGCTCC
TCTACAGCAACTTGCAGCATCTGAAGTGGAACGGTGGTGCTCCAAATTACTACCCCAACAGCTTTGGTGCTCCGGAACAACAGCCTTCTG
CCCTGGAGCACAGCATCCAATATTCTGGAGAAGTGCGGAGATTCAACACTGCCAATGATGATAACGTTACTCAGGTGCGGGCATTCTATG
TGAACGTGCTGAATGAGGAACAGAGGAAACGTCTGTGTGAGAACATTGCCGGCCACCTGAAGGATGCACAAATTTTCATCCAGAAGAAAG
CGGTCAAGAACTTCACTGAGGTCCACCCTGACTACGGGAGCCACATCCAGGCTCTTCTGGACAAGTACAATGCTGAGAAGCCTAAGAATG
CGATTCACACCTTTGTGCAGTCCGGATCTCACTTGGCGGCAAGGGAGAAGGCAAATCTGTGAGGCCGGGGCCCTGCACCTGTGCAGCGAA
GCTTAGCGTTCATCCGTGTAACCCGCTCATCACTGGATGAAGATTCTCCTGTGCTAGATGTGCAAATGCAAGCTAGTGGCTTCAAAATAG
AGAATCCCACTTTCTATAGCAGATTGTGTAACAATTTTAATGCTATTTCCCCAGGGGAAAATGAAGGTTAGGATTTAACAGTCATTTAAA
AAAAAAATTTGTTTTGACGGATGATTGGATTATTCATTTAAAATGATTAGAAGGCAAGTTTCTAGCTAGAAATATGATTTTATTTGACAA
AATTTGTTGAAATTATGTATGTTTACATATCACCTCATGGCCTATTATATTAAAATATGGCTATAAATATATAAAAAGAAAAGATAAAGA
TGATCTACTCAGAAATTTTTATTTTTCTAAGGTTCTCATAGGAAAAGTACATTTAATACAGCAGTGTCATCAGAAGATAACTTGAGCACC
GTCATGGCTTAATGTTTATTCCTGATAATAATTGATCAAATTCATTTTTTTCACTGGAGTTACATTAATGTTAATTCAGCACTGATTTCA

>In-frame_EHF_ENST00000533754_chr11_34668231_+_CAT_ENST00000241052_chr11_34485652_+_1578nt
ATTTTCACCGTCCATCTTTGCTGATTTACCATGCTCCCAGGATGGTGGGAGTGTGTGTTTTTAAGATGGAGAGTGTATGCTTCTGGGTTC
AAGTTCACAGGTGTCTCTGCTGGTTATCTGCACTCACCTTGGTAACAGGGAGAAAGTGAGTGAATGGATTCCAAGAACTTACTGATGGAA
GTCTAATTCAGGAGTTGGTTCTGCAGCCATGGAGATCATGATTCTGGAAGGAGGTGGTGTAATGAATCTCAACCCCGGCAACAACCTCCT
TCACCAGCCGCCAGCCTGGACAGACAGCTACTCCACGTGCAATGTTTCCAGTGGGTTTTTTGGAGGCCAGTGGCATGAAATTCATCCTCA
GTACTGGACCAAGTACCAGGTGTGGGAGTGGCTCCAGCACCTCCTGGACACCAACCAGCTGGATGCCAATTGTATCCCTTTCCAAGAGTT
CGACATCAACGGCGAGCACCTCTGCAGCATGAGTTTGCAGGAGTTCACCCGGGCGGCAGGGACGGCGGGGCAGCTCCTCTACAGCAACTT
GCAGCATCTGAAGTGGAACGGTGGTGCTCCAAATTACTACCCCAACAGCTTTGGTGCTCCGGAACAACAGCCTTCTGCCCTGGAGCACAG
CATCCAATATTCTGGAGAAGTGCGGAGATTCAACACTGCCAATGATGATAACGTTACTCAGGTGCGGGCATTCTATGTGAACGTGCTGAA
TGAGGAACAGAGGAAACGTCTGTGTGAGAACATTGCCGGCCACCTGAAGGATGCACAAATTTTCATCCAGAAGAAAGCGGTCAAGAACTT
CACTGAGGTCCACCCTGACTACGGGAGCCACATCCAGGCTCTTCTGGACAAGTACAATGCTGAGAAGCCTAAGAATGCGATTCACACCTT
TGTGCAGTCCGGATCTCACTTGGCGGCAAGGGAGAAGGCAAATCTGTGAGGCCGGGGCCCTGCACCTGTGCAGCGAAGCTTAGCGTTCAT
CCGTGTAACCCGCTCATCACTGGATGAAGATTCTCCTGTGCTAGATGTGCAAATGCAAGCTAGTGGCTTCAAAATAGAGAATCCCACTTT
CTATAGCAGATTGTGTAACAATTTTAATGCTATTTCCCCAGGGGAAAATGAAGGTTAGGATTTAACAGTCATTTAAAAAAAAAATTTGTT
TTGACGGATGATTGGATTATTCATTTAAAATGATTAGAAGGCAAGTTTCTAGCTAGAAATATGATTTTATTTGACAAAATTTGTTGAAAT
TATGTATGTTTACATATCACCTCATGGCCTATTATATTAAAATATGGCTATAAATATATAAAAAGAAAAGATAAAGATGATCTACTCAGA
AATTTTTATTTTTCTAAGGTTCTCATAGGAAAAGTACATTTAATACAGCAGTGTCATCAGAAGATAACTTGAGCACCGTCATGGCTTAAT
GTTTATTCCTGATAATAATTGATCAAATTCATTTTTTTCACTGGAGTTACATTAATGTTAATTCAGCACTGATTTCACAACAGATCAATT

>In-frame_EHF_ENST00000531728_chr11_34668231_+_CAT_ENST00000241052_chr11_34485652_+_1665nt
ATTTTCACCGTCCATCTTTGCTGATTTACCATGCTCCCAGGATGGTGGGAGTGTGTGTTTTTAAGATGGAGAGTGTATGCTTCTGGGTTC
AAGTTCACAGGTGTCTCTGCTGGTTATCTGCACTCACCTTGGTAACAGGGAGAAAGTGAGTGAATGGATTCCAAGAACTTACTGATGGAA
GTCTAATTCAGGAGTTGGTTCTGCAGCCATGGAGATCATGATTCTGGAAGGAGGTGGTGTAATGAATCTCAACCCCGGCAACAACCTCCT
TCACCAGCCGCCAGCCTGGACAGACAGCTACTCCACGTGCAATGTTTCCAGTGGGTTTTTTGGAGGCCAGTGGCATGAAATTCATCCTCA
GTACTGGACCAAGTACCAGGTGTGGGAGTGGCTCCAGCACCTCCTGGACACCAACCAGCTGGATGCCAATTGTATCCCTTTCCAAGAGTT
CGACATCAACGGCGAGCACCTCTGCAGCATGAGTTTGCAGGAGTTCACCCGGGCGGCAGGGACGGCGGGGCAGCTCCTCTACAGCAACTT
GCAGCATCTGAAGTGGAACGGTGACTCTCTCTTTCTGTGTCTCTCCCTACCCTGCTAGGAGCCAGCTGGAAGAATAGAGATTCTGCAGAT
GACAGGATTCTTTGTCAGTGGTGCTCCAAATTACTACCCCAACAGCTTTGGTGCTCCGGAACAACAGCCTTCTGCCCTGGAGCACAGCAT
CCAATATTCTGGAGAAGTGCGGAGATTCAACACTGCCAATGATGATAACGTTACTCAGGTGCGGGCATTCTATGTGAACGTGCTGAATGA
GGAACAGAGGAAACGTCTGTGTGAGAACATTGCCGGCCACCTGAAGGATGCACAAATTTTCATCCAGAAGAAAGCGGTCAAGAACTTCAC
TGAGGTCCACCCTGACTACGGGAGCCACATCCAGGCTCTTCTGGACAAGTACAATGCTGAGAAGCCTAAGAATGCGATTCACACCTTTGT
GCAGTCCGGATCTCACTTGGCGGCAAGGGAGAAGGCAAATCTGTGAGGCCGGGGCCCTGCACCTGTGCAGCGAAGCTTAGCGTTCATCCG
TGTAACCCGCTCATCACTGGATGAAGATTCTCCTGTGCTAGATGTGCAAATGCAAGCTAGTGGCTTCAAAATAGAGAATCCCACTTTCTA
TAGCAGATTGTGTAACAATTTTAATGCTATTTCCCCAGGGGAAAATGAAGGTTAGGATTTAACAGTCATTTAAAAAAAAAATTTGTTTTG
ACGGATGATTGGATTATTCATTTAAAATGATTAGAAGGCAAGTTTCTAGCTAGAAATATGATTTTATTTGACAAAATTTGTTGAAATTAT
GTATGTTTACATATCACCTCATGGCCTATTATATTAAAATATGGCTATAAATATATAAAAAGAAAAGATAAAGATGATCTACTCAGAAAT
TTTTATTTTTCTAAGGTTCTCATAGGAAAAGTACATTTAATACAGCAGTGTCATCAGAAGATAACTTGAGCACCGTCATGGCTTAATGTT
TATTCCTGATAATAATTGATCAAATTCATTTTTTTCACTGGAGTTACATTAATGTTAATTCAGCACTGATTTCACAACAGATCAATTTGT

>In-frame_EHF_ENST00000531794_chr11_34668231_+_CAT_ENST00000241052_chr11_34485652_+_1553nt
AACCCACTGCTTTATTCTGCCCTGAGTGGAGATTGGTTTTGGCTCAGGCTGCTTTGTGAAACTCAGAAGCATTATCCTCTCTGCCAACTC
CACGTCCTAGTCAGAGTTTTCTGTGAAGGCAAGGGCATGGGGTTGCCGGAGAGAAGAGGATTGGTCCTGCTTTTAAGCCTAGCTGAAATT
CTTTTCAAGATCATGATTCTGGAAGGAGGTGGTGTAATGAATCTCAACCCCGGCAACAACCTCCTTCACCAGCCGCCAGCCTGGACAGAC
AGCTACTCCACGTGCAATGTTTCCAGTGGGTTTTTTGGAGGCCAGTGGCATGAAATTCATCCTCAGTACTGGACCAAGTACCAGGTGTGG
GAGTGGCTCCAGCACCTCCTGGACACCAACCAGCTGGATGCCAATTGTATCCCTTTCCAAGAGTTCGACATCAACGGCGAGCACCTCTGC
AGCATGAGTTTGCAGGAGTTCACCCGGGCGGCAGGGACGGCGGGGCAGCTCCTCTACAGCAACTTGCAGCATCTGAAGTGGAACGGTGGT
GCTCCAAATTACTACCCCAACAGCTTTGGTGCTCCGGAACAACAGCCTTCTGCCCTGGAGCACAGCATCCAATATTCTGGAGAAGTGCGG
AGATTCAACACTGCCAATGATGATAACGTTACTCAGGTGCGGGCATTCTATGTGAACGTGCTGAATGAGGAACAGAGGAAACGTCTGTGT
GAGAACATTGCCGGCCACCTGAAGGATGCACAAATTTTCATCCAGAAGAAAGCGGTCAAGAACTTCACTGAGGTCCACCCTGACTACGGG
AGCCACATCCAGGCTCTTCTGGACAAGTACAATGCTGAGAAGCCTAAGAATGCGATTCACACCTTTGTGCAGTCCGGATCTCACTTGGCG
GCAAGGGAGAAGGCAAATCTGTGAGGCCGGGGCCCTGCACCTGTGCAGCGAAGCTTAGCGTTCATCCGTGTAACCCGCTCATCACTGGAT
GAAGATTCTCCTGTGCTAGATGTGCAAATGCAAGCTAGTGGCTTCAAAATAGAGAATCCCACTTTCTATAGCAGATTGTGTAACAATTTT
AATGCTATTTCCCCAGGGGAAAATGAAGGTTAGGATTTAACAGTCATTTAAAAAAAAAATTTGTTTTGACGGATGATTGGATTATTCATT
TAAAATGATTAGAAGGCAAGTTTCTAGCTAGAAATATGATTTTATTTGACAAAATTTGTTGAAATTATGTATGTTTACATATCACCTCAT
GGCCTATTATATTAAAATATGGCTATAAATATATAAAAAGAAAAGATAAAGATGATCTACTCAGAAATTTTTATTTTTCTAAGGTTCTCA
TAGGAAAAGTACATTTAATACAGCAGTGTCATCAGAAGATAACTTGAGCACCGTCATGGCTTAATGTTTATTCCTGATAATAATTGATCA
AATTCATTTTTTTCACTGGAGTTACATTAATGTTAATTCAGCACTGATTTCACAACAGATCAATTTGTAATTGCTTACATTTTTACAATA

>In-frame_EHF_ENST00000527935_chr11_34668231_+_CAT_ENST00000241052_chr11_34485652_+_1663nt
AACCCACTGCTTTATTCTGCCCTGAGTGGAGATTGGTTTTGGCTCAGGCTGCTTTGTGAAACTCAGAAGCATTATCCTCTCTGCCAACTC
CACGTCCTAGTCAGAGTTTTCTGTGAAGGCAAGGGCATGGGGTTGCCGGAGAGAAGAGGATTGGTCCTGCTTTTAAGCCTAGCTGAAATT
CTTTTCAAGTTTCCAGTGGGTTTTTTGGAGGCCAGTGGCATGAAATTCATCCTCAGTACTGGACCAAGTACCAGGTGTGGGAGTGGCTCC
AGCACCTCCTGGACACCAACCAGCTGGATGCCAATTGTATCCCTTTCCAAGAGTTCGACATCAACGGCGAGCACCTCTGCAGCATGAGTT
TGCAGGAGTTCACCCGGGCGGCAGGGACGGCGGGGCAGCTCCTCTACAGCAACTTGCAGCATCTGAAGTGGAACGGTGACTCTCTCTTTC
TGTGTCTCTCCCTACCCTGCTAGGAGCCAGCTGGAAGAATAGAGATTCTGCAGATGACAGGATTCTTTGTCAGGGACAAGAAAGAGTGGT
CTCACCTCCAAATTACCATGTCCCAAGACAGAGAAATGGAAGGAAGATGAAAGGACAGGATTGAAGCATAGGGTACCTGGTGTGCCTAAT
CCCTTATAAATGCCAGTGGTGCTCCAAATTACTACCCCAACAGCTTTGGTGCTCCGGAACAACAGCCTTCTGCCCTGGAGCACAGCATCC
AATATTCTGGAGAAGTGCGGAGATTCAACACTGCCAATGATGATAACGTTACTCAGGTGCGGGCATTCTATGTGAACGTGCTGAATGAGG
AACAGAGGAAACGTCTGTGTGAGAACATTGCCGGCCACCTGAAGGATGCACAAATTTTCATCCAGAAGAAAGCGGTCAAGAACTTCACTG
AGGTCCACCCTGACTACGGGAGCCACATCCAGGCTCTTCTGGACAAGTACAATGCTGAGAAGCCTAAGAATGCGATTCACACCTTTGTGC
AGTCCGGATCTCACTTGGCGGCAAGGGAGAAGGCAAATCTGTGAGGCCGGGGCCCTGCACCTGTGCAGCGAAGCTTAGCGTTCATCCGTG
TAACCCGCTCATCACTGGATGAAGATTCTCCTGTGCTAGATGTGCAAATGCAAGCTAGTGGCTTCAAAATAGAGAATCCCACTTTCTATA
GCAGATTGTGTAACAATTTTAATGCTATTTCCCCAGGGGAAAATGAAGGTTAGGATTTAACAGTCATTTAAAAAAAAAATTTGTTTTGAC
GGATGATTGGATTATTCATTTAAAATGATTAGAAGGCAAGTTTCTAGCTAGAAATATGATTTTATTTGACAAAATTTGTTGAAATTATGT
ATGTTTACATATCACCTCATGGCCTATTATATTAAAATATGGCTATAAATATATAAAAAGAAAAGATAAAGATGATCTACTCAGAAATTT
TTATTTTTCTAAGGTTCTCATAGGAAAAGTACATTTAATACAGCAGTGTCATCAGAAGATAACTTGAGCACCGTCATGGCTTAATGTTTA
TTCCTGATAATAATTGATCAAATTCATTTTTTTCACTGGAGTTACATTAATGTTAATTCAGCACTGATTTCACAACAGATCAATTTGTAA


Top

FusionGenePPI for EHF_CAT


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
EHFELF3, FRZB, XRCC6, XRCC5, CST6, KPRP, APP, ARG1CATABL1, ABL2, CAT, PEX5, USP53, APP, HSD17B4, STIM1, MECP2, EHHADH, KEAP1, ENO1, MOV10, CCDC8, NTRK1, ACAA1, ACE2, ACOX1, AGL, ALDH7A1, ATPIF1, BCAT2, CFL1, CFL2, ENO3, HSPE1, LDHA, LDHB, PGM1, PPA2, SOD1, SOD2, SORD, UFC1, CYCS, FAHD1, FAHD2A, PRDX1, PRDX2, PRDX5, TANGO2, GNAS, JUP, SMARCA4, ACTR3, MCM2, ESR1, CYLD


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for EHF_CAT


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
TgeneCATP04040DB01213FomepizoleCatalasesmall moleculeapproved|vet_approved

Top

RelatedDiseases for EHF_CAT


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneEHFC0033578Prostatic Neoplasms1CTD_human
TgeneCATC0268419Acatalasia5CTD_human;ORPHANET
TgeneCATC0007621Neoplastic Cell Transformation4CTD_human
TgeneCATC0020538Hypertensive disease4CTD_human
TgeneCATC0035126Reperfusion Injury4CTD_human
TgeneCATC0038220Status Epilepticus4CTD_human
TgeneCATC0011853Diabetes Mellitus, Experimental3CTD_human
TgeneCATC0027627Neoplasm Metastasis3CTD_human
TgeneCATC0036572Seizures3CTD_human
TgeneCATC0001973Alcoholic Intoxication, Chronic2PSYGENET
TgeneCATC0011860Diabetes Mellitus, Non-Insulin-Dependent2CTD_human
TgeneCATC0022661Kidney Failure, Chronic2CTD_human
TgeneCATC0027540Necrosis2CTD_human
TgeneCATC0027626Neoplasm Invasiveness2CTD_human
TgeneCATC1269683Major Depressive Disorder2CTD_human;PSYGENET
TgeneCATC0003493Aortic Diseases1CTD_human
TgeneCATC0003873Rheumatoid Arthritis1CTD_human
TgeneCATC0004045Asphyxia Neonatorum1CTD_human
TgeneCATC0004096Asthma1CTD_human
TgeneCATC0004352Autistic Disorder1CTD_human
TgeneCATC0004943Behcet Syndrome1CTD_human
TgeneCATC0007131Non-Small Cell Lung Carcinoma1CTD_human
TgeneCATC0007786Brain Ischemia1CTD_human
TgeneCATC0011849Diabetes Mellitus1CTD_human
TgeneCATC0011854Diabetes Mellitus, Insulin-Dependent1CTD_human
TgeneCATC0011882Diabetic Neuropathies1CTD_human
TgeneCATC0013386Dyskinesia, Drug-Induced1CTD_human
TgeneCATC0013604Edema1CTD_human
TgeneCATC0015695Fatty Liver1CTD_human
TgeneCATC0017638Glioma1CTD_human
TgeneCATC0018801Heart failure1CTD_human
TgeneCATC0019158Hepatitis1CTD_human
TgeneCATC0019189Hepatitis, Chronic1CTD_human
TgeneCATC0020452Hyperemia1CTD_human
TgeneCATC0020550Hyperthyroidism1CTD_human
TgeneCATC0020649Hypotension1CTD_human
TgeneCATC0022593Keratosis1CTD_human
TgeneCATC0022650Kidney Calculi1CTD_human
TgeneCATC0023891Liver Cirrhosis, Alcoholic1CTD_human
TgeneCATC0024141Lupus Erythematosus, Systemic1CTD_human
TgeneCATC0024796Marfan Syndrome1CTD_human
TgeneCATC0025500Mesothelioma1CTD_human
TgeneCATC0027051Myocardial Infarction1CTD_human
TgeneCATC0027055Myocardial Reperfusion Injury1CTD_human
TgeneCATC0029458Osteoporosis, Postmenopausal1CTD_human
TgeneCATC0032927Precancerous Conditions1CTD_human
TgeneCATC0033626Protein Deficiency1CTD_human
TgeneCATC0033860Psoriasis1CTD_human
TgeneCATC0034063Pulmonary Edema1CTD_human
TgeneCATC0034065Pulmonary Embolism1CTD_human
TgeneCATC0034069Pulmonary Fibrosis1CTD_human
TgeneCATC0038358Gastric ulcer1CTD_human
TgeneCATC0041408Turner Syndrome1CTD_human
TgeneCATC0041696Unipolar Depression1PSYGENET
TgeneCATC0079744Diffuse Large B-Cell Lymphoma1CTD_human
TgeneCATC0151526Premature Birth1CTD_human
TgeneCATC0242488Acute Lung Injury1CTD_human
TgeneCATC0349231Phobic anxiety disorder1CTD_human
TgeneCATC0376628Chromosome Breakage1CTD_human
TgeneCATC0878544Cardiomyopathies1CTD_human
TgeneCATC0993582Arthritis, Experimental1CTD_human
TgeneCATC1456865Ureteral Calculi1CTD_human
TgeneCATC1458155Mammary Neoplasms1CTD_human
TgeneCATC2985290Fetal Alcohol Spectrum Disorders1CTD_human
TgeneCATC4277682Chemical and Drug Induced Liver Injury1CTD_human