FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 11125

FusionGeneSummary for EGLN1_PTPRF

check button Fusion gene summary
Fusion gene informationFusion gene name: EGLN1_PTPRF
Fusion gene ID: 11125
HgeneTgene
Gene symbol

EGLN1

PTPRF

Gene ID

54583

5792

Gene nameegl-9 family hypoxia inducible factor 1protein tyrosine phosphatase, receptor type F
SynonymsC1orf12|ECYT3|HALAH|HIF-PH2|HIFPH2|HPH-2|HPH2|PHD2|SM20|ZMYND6BNAH2|LAR
Cytomap

1q42.2

1p34.2

Type of geneprotein-codingprotein-coding
Descriptionegl nine homolog 1HIF-prolyl hydroxylase 2egl nine-like protein 1hypoxia-inducible factor prolyl hydroxylase 2prolyl hydroxylase domain-containing protein 2zinc finger MYND domain-containing protein 6receptor-type tyrosine-protein phosphatase FLCA-homologleukocyte antigen-related (LAR) PTP receptorleukocyte antigen-related tyrosine phosphataseleukocyte common antigen relatedprotein tyrosine phosphatase, receptor type, F polypeptidereceptor-linke
Modification date2018052720180522
UniProtAcc

Q9GZT9

P10586

Ensembl transtripts involved in fusion geneENST00000366641, ENST00000476717, 
ENST00000359947, ENST00000438120, 
ENST00000372413, ENST00000372414, 
ENST00000422171, ENST00000496447, 
Fusion gene scores* DoF score5 X 3 X 4=607 X 9 X 4=252
# samples 59
** MAII scorelog2(5/60*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(9/252*10)=-1.48542682717024
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: EGLN1 [Title/Abstract] AND PTPRF [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTumor suppressor gene involved fusion gene, in-frame but not retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
HgeneEGLN1

GO:0001666

response to hypoxia

16956324

HgeneEGLN1

GO:0018401

peptidyl-proline hydroxylation to 4-hydroxy-L-proline

11598268

HgeneEGLN1

GO:0032364

oxygen homeostasis

16956324

HgeneEGLN1

GO:0043433

negative regulation of DNA binding transcription factor activity

16956324

HgeneEGLN1

GO:0071731

response to nitric oxide

21601578


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVLUSCTCGA-43-8115-01AEGLN1chr1

231556744

-PTPRFchr1

44083116

+
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000366641ENST00000359947EGLN1chr1

231556744

-PTPRFchr1

44083116

+
In-frameENST00000366641ENST00000438120EGLN1chr1

231556744

-PTPRFchr1

44083116

+
In-frameENST00000366641ENST00000372413EGLN1chr1

231556744

-PTPRFchr1

44083116

+
In-frameENST00000366641ENST00000372414EGLN1chr1

231556744

-PTPRFchr1

44083116

+
In-frameENST00000366641ENST00000422171EGLN1chr1

231556744

-PTPRFchr1

44083116

+
5CDS-3UTRENST00000366641ENST00000496447EGLN1chr1

231556744

-PTPRFchr1

44083116

+
intron-3CDSENST00000476717ENST00000359947EGLN1chr1

231556744

-PTPRFchr1

44083116

+
intron-3CDSENST00000476717ENST00000438120EGLN1chr1

231556744

-PTPRFchr1

44083116

+
intron-3CDSENST00000476717ENST00000372413EGLN1chr1

231556744

-PTPRFchr1

44083116

+
intron-3CDSENST00000476717ENST00000372414EGLN1chr1

231556744

-PTPRFchr1

44083116

+
intron-3CDSENST00000476717ENST00000422171EGLN1chr1

231556744

-PTPRFchr1

44083116

+
intron-3UTRENST00000476717ENST00000496447EGLN1chr1

231556744

-PTPRFchr1

44083116

+

Top

FusionProtFeatures for EGLN1_PTPRF


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
EGLN1

Q9GZT9

PTPRF

P10586

Cellular oxygen sensor that catalyzes, under normoxicconditions, the post-translational formation of 4-hydroxyprolinein hypoxia-inducible factor (HIF) alpha proteins. Hydroxylates aspecific proline found in each of the oxygen-dependent degradation(ODD) domains (N-terminal, NODD, and C-terminal, CODD) of HIF1A.Also hydroxylates HIF2A. Has a preference for the CODD site forboth HIF1A and HIF1B. Hydroxylated HIFs are then targeted forproteasomal degradation via the von Hippel-Lindau ubiquitinationcomplex. Under hypoxic conditions, the hydroxylation reaction isattenuated allowing HIFs to escape degradation resulting in theirtranslocation to the nucleus, heterodimerization with HIF1B, andincreased expression of hypoxy-inducible genes. EGLN1 is the mostimportant isozyme under normoxia and, through regulating thestability of HIF1, involved in various hypoxia-influencedprocesses such as angiogenesis in retinal and cardiacfunctionality. Target proteins are preferentially recognized via aLXXLAP motif. {ECO:0000269|PubMed:11595184,ECO:0000269|PubMed:12181324, ECO:0000269|PubMed:12351678,ECO:0000269|PubMed:15897452, ECO:0000269|PubMed:19339211,ECO:0000269|PubMed:21792862, ECO:0000269|PubMed:25129147}. Possible cell adhesion receptor. It possesses anintrinsic protein tyrosine phosphatase activity (PTPase) anddephosphorylates EPHA2 regulating its activity. The first PTPase domain has enzymatic activity, whilethe second one seems to affect the substrate specificity of thefirst one.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneEGLN1chr1:231556744chr1:44083116ENST00000366641-15241_251297427RegionBeta(2)beta(3) 'finger-like' loop
HgeneEGLN1chr1:231556744chr1:44083116ENST00000366641-156_20297427RegionNote=Required for nuclear export
HgeneEGLN1chr1:231556744chr1:44083116ENST00000366641-1521_58297427Zinc fingerMYND-type
TgenePTPRFchr1:231556744chr1:44083116ENST00000359947+22341639_189813571908DomainTyrosine-protein phosphatase 2
TgenePTPRFchr1:231556744chr1:44083116ENST00000372413+19311352_160713481899DomainTyrosine-protein phosphatase 1
TgenePTPRFchr1:231556744chr1:44083116ENST00000372413+19311639_189813481899DomainTyrosine-protein phosphatase 2
TgenePTPRFchr1:231556744chr1:44083116ENST00000372414+20321639_189813571908DomainTyrosine-protein phosphatase 2
TgenePTPRFchr1:231556744chr1:44083116ENST00000438120+21331352_160713481899DomainTyrosine-protein phosphatase 1
TgenePTPRFchr1:231556744chr1:44083116ENST00000438120+21331639_189813481899DomainTyrosine-protein phosphatase 2
TgenePTPRFchr1:231556744chr1:44083116ENST00000359947+22341548_155413571908RegionSubstrate binding
TgenePTPRFchr1:231556744chr1:44083116ENST00000372413+19311548_155413481899RegionSubstrate binding
TgenePTPRFchr1:231556744chr1:44083116ENST00000372414+20321548_155413571908RegionSubstrate binding
TgenePTPRFchr1:231556744chr1:44083116ENST00000438120+21331548_155413481899RegionSubstrate binding

- In-frame and not-retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneEGLN1chr1:231556744chr1:44083116ENST00000366641-15291_392297427DomainFe2OG dioxygenase
TgenePTPRFchr1:231556744chr1:44083116ENST00000359947+22341014_109813571908DomainFibronectin type-III 8
TgenePTPRFchr1:231556744chr1:44083116ENST00000359947+22341352_160713571908DomainTyrosine-protein phosphatase 1
TgenePTPRFchr1:231556744chr1:44083116ENST00000359947+2234135_22413571908DomainNote=Ig-like C2-type 2
TgenePTPRFchr1:231556744chr1:44083116ENST00000359947+2234232_31413571908DomainNote=Ig-like C2-type 3
TgenePTPRFchr1:231556744chr1:44083116ENST00000359947+2234321_41113571908DomainFibronectin type-III 1
TgenePTPRFchr1:231556744chr1:44083116ENST00000359947+223433_12313571908DomainNote=Ig-like C2-type 1
TgenePTPRFchr1:231556744chr1:44083116ENST00000359947+2234416_51013571908DomainFibronectin type-III 2
TgenePTPRFchr1:231556744chr1:44083116ENST00000359947+2234514_60413571908DomainFibronectin type-III 3
TgenePTPRFchr1:231556744chr1:44083116ENST00000359947+2234609_70613571908DomainFibronectin type-III 4
TgenePTPRFchr1:231556744chr1:44083116ENST00000359947+2234711_81913571908DomainFibronectin type-III 5
TgenePTPRFchr1:231556744chr1:44083116ENST00000359947+2234820_91413571908DomainFibronectin type-III 6
TgenePTPRFchr1:231556744chr1:44083116ENST00000359947+2234918_101013571908DomainFibronectin type-III 7
TgenePTPRFchr1:231556744chr1:44083116ENST00000372413+19311014_109813481899DomainFibronectin type-III 8
TgenePTPRFchr1:231556744chr1:44083116ENST00000372413+1931135_22413481899DomainNote=Ig-like C2-type 2
TgenePTPRFchr1:231556744chr1:44083116ENST00000372413+1931232_31413481899DomainNote=Ig-like C2-type 3
TgenePTPRFchr1:231556744chr1:44083116ENST00000372413+1931321_41113481899DomainFibronectin type-III 1
TgenePTPRFchr1:231556744chr1:44083116ENST00000372413+193133_12313481899DomainNote=Ig-like C2-type 1
TgenePTPRFchr1:231556744chr1:44083116ENST00000372413+1931416_51013481899DomainFibronectin type-III 2
TgenePTPRFchr1:231556744chr1:44083116ENST00000372413+1931514_60413481899DomainFibronectin type-III 3
TgenePTPRFchr1:231556744chr1:44083116ENST00000372413+1931609_70613481899DomainFibronectin type-III 4
TgenePTPRFchr1:231556744chr1:44083116ENST00000372413+1931711_81913481899DomainFibronectin type-III 5
TgenePTPRFchr1:231556744chr1:44083116ENST00000372413+1931820_91413481899DomainFibronectin type-III 6
TgenePTPRFchr1:231556744chr1:44083116ENST00000372413+1931918_101013481899DomainFibronectin type-III 7
TgenePTPRFchr1:231556744chr1:44083116ENST00000372414+20321014_109813571908DomainFibronectin type-III 8
TgenePTPRFchr1:231556744chr1:44083116ENST00000372414+20321352_160713571908DomainTyrosine-protein phosphatase 1
TgenePTPRFchr1:231556744chr1:44083116ENST00000372414+2032135_22413571908DomainNote=Ig-like C2-type 2
TgenePTPRFchr1:231556744chr1:44083116ENST00000372414+2032232_31413571908DomainNote=Ig-like C2-type 3
TgenePTPRFchr1:231556744chr1:44083116ENST00000372414+2032321_41113571908DomainFibronectin type-III 1
TgenePTPRFchr1:231556744chr1:44083116ENST00000372414+203233_12313571908DomainNote=Ig-like C2-type 1
TgenePTPRFchr1:231556744chr1:44083116ENST00000372414+2032416_51013571908DomainFibronectin type-III 2
TgenePTPRFchr1:231556744chr1:44083116ENST00000372414+2032514_60413571908DomainFibronectin type-III 3
TgenePTPRFchr1:231556744chr1:44083116ENST00000372414+2032609_70613571908DomainFibronectin type-III 4
TgenePTPRFchr1:231556744chr1:44083116ENST00000372414+2032711_81913571908DomainFibronectin type-III 5
TgenePTPRFchr1:231556744chr1:44083116ENST00000372414+2032820_91413571908DomainFibronectin type-III 6
TgenePTPRFchr1:231556744chr1:44083116ENST00000372414+2032918_101013571908DomainFibronectin type-III 7
TgenePTPRFchr1:231556744chr1:44083116ENST00000438120+21331014_109813481899DomainFibronectin type-III 8
TgenePTPRFchr1:231556744chr1:44083116ENST00000438120+2133135_22413481899DomainNote=Ig-like C2-type 2
TgenePTPRFchr1:231556744chr1:44083116ENST00000438120+2133232_31413481899DomainNote=Ig-like C2-type 3
TgenePTPRFchr1:231556744chr1:44083116ENST00000438120+2133321_41113481899DomainFibronectin type-III 1
TgenePTPRFchr1:231556744chr1:44083116ENST00000438120+213333_12313481899DomainNote=Ig-like C2-type 1
TgenePTPRFchr1:231556744chr1:44083116ENST00000438120+2133416_51013481899DomainFibronectin type-III 2
TgenePTPRFchr1:231556744chr1:44083116ENST00000438120+2133514_60413481899DomainFibronectin type-III 3
TgenePTPRFchr1:231556744chr1:44083116ENST00000438120+2133609_70613481899DomainFibronectin type-III 4
TgenePTPRFchr1:231556744chr1:44083116ENST00000438120+2133711_81913481899DomainFibronectin type-III 5
TgenePTPRFchr1:231556744chr1:44083116ENST00000438120+2133820_91413481899DomainFibronectin type-III 6
TgenePTPRFchr1:231556744chr1:44083116ENST00000438120+2133918_101013481899DomainFibronectin type-III 7
TgenePTPRFchr1:231556744chr1:44083116ENST00000359947+223468_7713571908RegionHeparin-binding
TgenePTPRFchr1:231556744chr1:44083116ENST00000372413+193168_7713481899RegionHeparin-binding
TgenePTPRFchr1:231556744chr1:44083116ENST00000372414+203268_7713571908RegionHeparin-binding
TgenePTPRFchr1:231556744chr1:44083116ENST00000438120+213368_7713481899RegionHeparin-binding
TgenePTPRFchr1:231556744chr1:44083116ENST00000359947+22341285_190713571908Topological domainCytoplasmic
TgenePTPRFchr1:231556744chr1:44083116ENST00000359947+223430_126313571908Topological domainExtracellular
TgenePTPRFchr1:231556744chr1:44083116ENST00000372413+19311285_190713481899Topological domainCytoplasmic
TgenePTPRFchr1:231556744chr1:44083116ENST00000372413+193130_126313481899Topological domainExtracellular
TgenePTPRFchr1:231556744chr1:44083116ENST00000372414+20321285_190713571908Topological domainCytoplasmic
TgenePTPRFchr1:231556744chr1:44083116ENST00000372414+203230_126313571908Topological domainExtracellular
TgenePTPRFchr1:231556744chr1:44083116ENST00000438120+21331285_190713481899Topological domainCytoplasmic
TgenePTPRFchr1:231556744chr1:44083116ENST00000438120+213330_126313481899Topological domainExtracellular
TgenePTPRFchr1:231556744chr1:44083116ENST00000359947+22341264_128413571908TransmembraneHelical
TgenePTPRFchr1:231556744chr1:44083116ENST00000372413+19311264_128413481899TransmembraneHelical
TgenePTPRFchr1:231556744chr1:44083116ENST00000372414+20321264_128413571908TransmembraneHelical
TgenePTPRFchr1:231556744chr1:44083116ENST00000438120+21331264_128413481899TransmembraneHelical


Top

FusionGeneSequence for EGLN1_PTPRF


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_EGLN1_ENST00000366641_chr1_231556744_-_PTPRF_ENST00000359947_chr1_44083116_+_848aa
MANDSGGPGGPSPSERDRQYCELCGKMENLLRCSRCRSSFYCCKEHQRQDWKKHKLVCQGSEGALGHGVGPHQHSGPAPPAAVPPPRAGA
REPRKAAARRDNASGDAAKGKVKAKPPADPAAAASPCRAAAGGQGSAVAAEAEPGKEEPPARSSLFQEKANLYPPSNTPGDALSPGGGLR
PNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIG
LLMSSMDDLIRHCNGKLGSYKINGRTKSIDPGQQFTWENSNLEVNKPKNRYANVIAYDHSRVILTSIDGVPGSDYINANYIDGYRKQNAY
IATQGPLPETMGDFWRMVWEQRTATVVMMTRLEEKSRVKCDQYWPARGTETCGLIQVTLLDTVELATYTVRTFALHKSGSSEKRELRQFQ
FMAWPDHGVPEYPTPILAFLRRVKACNPLDAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKTVDIYGHVTCMRSQRNYMVQTEDQYVFI
HEALLEAATCGHTEVPARNLYAHIQKLGQVPPGESVTAMELEFKLLASSKAHTSRFISANLPCNKFKNRLVNIMPYELTRVCLQPIRGVE
GSDYINASFLDGYRQQKAYIATQGPLAESTEDFWRMLWEHNSTIIVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILR
EFKVTDARDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDMFQT

>In-frame_EGLN1_ENST00000366641_chr1_231556744_-_PTPRF_ENST00000438120_chr1_44083116_+_848aa
MANDSGGPGGPSPSERDRQYCELCGKMENLLRCSRCRSSFYCCKEHQRQDWKKHKLVCQGSEGALGHGVGPHQHSGPAPPAAVPPPRAGA
REPRKAAARRDNASGDAAKGKVKAKPPADPAAAASPCRAAAGGQGSAVAAEAEPGKEEPPARSSLFQEKANLYPPSNTPGDALSPGGGLR
PNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIG
LLMSSMDDLIRHCNGKLGSYKINGRTKSIDPGQQFTWENSNLEVNKPKNRYANVIAYDHSRVILTSIDGVPGSDYINANYIDGYRKQNAY
IATQGPLPETMGDFWRMVWEQRTATVVMMTRLEEKSRVKCDQYWPARGTETCGLIQVTLLDTVELATYTVRTFALHKSGSSEKRELRQFQ
FMAWPDHGVPEYPTPILAFLRRVKACNPLDAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKTVDIYGHVTCMRSQRNYMVQTEDQYVFI
HEALLEAATCGHTEVPARNLYAHIQKLGQVPPGESVTAMELEFKLLASSKAHTSRFISANLPCNKFKNRLVNIMPYELTRVCLQPIRGVE
GSDYINASFLDGYRQQKAYIATQGPLAESTEDFWRMLWEHNSTIIVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILR
EFKVTDARDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDMFQT

>In-frame_EGLN1_ENST00000366641_chr1_231556744_-_PTPRF_ENST00000372413_chr1_44083116_+_848aa
MANDSGGPGGPSPSERDRQYCELCGKMENLLRCSRCRSSFYCCKEHQRQDWKKHKLVCQGSEGALGHGVGPHQHSGPAPPAAVPPPRAGA
REPRKAAARRDNASGDAAKGKVKAKPPADPAAAASPCRAAAGGQGSAVAAEAEPGKEEPPARSSLFQEKANLYPPSNTPGDALSPGGGLR
PNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIG
LLMSSMDDLIRHCNGKLGSYKINGRTKSIDPGQQFTWENSNLEVNKPKNRYANVIAYDHSRVILTSIDGVPGSDYINANYIDGYRKQNAY
IATQGPLPETMGDFWRMVWEQRTATVVMMTRLEEKSRVKCDQYWPARGTETCGLIQVTLLDTVELATYTVRTFALHKSGSSEKRELRQFQ
FMAWPDHGVPEYPTPILAFLRRVKACNPLDAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKTVDIYGHVTCMRSQRNYMVQTEDQYVFI
HEALLEAATCGHTEVPARNLYAHIQKLGQVPPGESVTAMELEFKLLASSKAHTSRFISANLPCNKFKNRLVNIMPYELTRVCLQPIRGVE
GSDYINASFLDGYRQQKAYIATQGPLAESTEDFWRMLWEHNSTIIVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILR
EFKVTDARDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDMFQT

>In-frame_EGLN1_ENST00000366641_chr1_231556744_-_PTPRF_ENST00000372414_chr1_44083116_+_848aa
MANDSGGPGGPSPSERDRQYCELCGKMENLLRCSRCRSSFYCCKEHQRQDWKKHKLVCQGSEGALGHGVGPHQHSGPAPPAAVPPPRAGA
REPRKAAARRDNASGDAAKGKVKAKPPADPAAAASPCRAAAGGQGSAVAAEAEPGKEEPPARSSLFQEKANLYPPSNTPGDALSPGGGLR
PNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIG
LLMSSMDDLIRHCNGKLGSYKINGRTKSIDPGQQFTWENSNLEVNKPKNRYANVIAYDHSRVILTSIDGVPGSDYINANYIDGYRKQNAY
IATQGPLPETMGDFWRMVWEQRTATVVMMTRLEEKSRVKCDQYWPARGTETCGLIQVTLLDTVELATYTVRTFALHKSGSSEKRELRQFQ
FMAWPDHGVPEYPTPILAFLRRVKACNPLDAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKTVDIYGHVTCMRSQRNYMVQTEDQYVFI
HEALLEAATCGHTEVPARNLYAHIQKLGQVPPGESVTAMELEFKLLASSKAHTSRFISANLPCNKFKNRLVNIMPYELTRVCLQPIRGVE
GSDYINASFLDGYRQQKAYIATQGPLAESTEDFWRMLWEHNSTIIVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILR
EFKVTDARDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDMFQT

>In-frame_EGLN1_ENST00000366641_chr1_231556744_-_PTPRF_ENST00000422171_chr1_44083116_+_848aa
MANDSGGPGGPSPSERDRQYCELCGKMENLLRCSRCRSSFYCCKEHQRQDWKKHKLVCQGSEGALGHGVGPHQHSGPAPPAAVPPPRAGA
REPRKAAARRDNASGDAAKGKVKAKPPADPAAAASPCRAAAGGQGSAVAAEAEPGKEEPPARSSLFQEKANLYPPSNTPGDALSPGGGLR
PNGQTKPLPALKLALEYIVPCMNKHGICVVDDFLGKETGQQIGDEVRALHDTGKFTDGQLVSQKSDSSKDIRGDKITWIEGKEPGCETIG
LLMSSMDDLIRHCNGKLGSYKINGRTKSIDPGQQFTWENSNLEVNKPKNRYANVIAYDHSRVILTSIDGVPGSDYINANYIDGYRKQNAY
IATQGPLPETMGDFWRMVWEQRTATVVMMTRLEEKSRVKCDQYWPARGTETCGLIQVTLLDTVELATYTVRTFALHKSGSSEKRELRQFQ
FMAWPDHGVPEYPTPILAFLRRVKACNPLDAGPMVVHCSAGVGRTGCFIVIDAMLERMKHEKTVDIYGHVTCMRSQRNYMVQTEDQYVFI
HEALLEAATCGHTEVPARNLYAHIQKLGQVPPGESVTAMELEFKLLASSKAHTSRFISANLPCNKFKNRLVNIMPYELTRVCLQPIRGVE
GSDYINASFLDGYRQQKAYIATQGPLAESTEDFWRMLWEHNSTIIVMLTKLREMGREKCHQYWPAERSARYQYFVVDPMAEYNMPQYILR
EFKVTDARDGQSRTIRQFQFTDWPEQGVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVDMFQT


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_EGLN1_ENST00000366641_chr1_231556744_-_PTPRF_ENST00000359947_chr1_44083116_+_2544nt
ATGGCCAATGACAGCGGCGGGCCCGGCGGGCCGAGCCCGAGCGAGCGAGACCGGCAGTACTGCGAGCTGTGCGGGAAGATGGAGAACCTG
CTGCGCTGCAGCCGCTGCCGCAGCTCCTTCTACTGCTGCAAGGAGCACCAGCGTCAGGACTGGAAGAAGCACAAGCTCGTGTGCCAGGGC
AGCGAGGGCGCCCTCGGCCACGGAGTGGGCCCACACCAGCATTCCGGCCCCGCGCCGCCGGCTGCAGTGCCGCCGCCCAGGGCCGGGGCC
CGGGAGCCCAGGAAGGCAGCGGCGCGCCGGGACAACGCCTCCGGGGACGCGGCCAAGGGAAAAGTAAAGGCCAAGCCCCCGGCCGACCCA
GCGGCGGCCGCGTCGCCGTGTCGTGCGGCCGCCGGCGGCCAGGGCTCGGCGGTGGCTGCCGAAGCCGAGCCCGGCAAGGAGGAGCCGCCG
GCCCGCTCATCGCTGTTCCAGGAGAAGGCGAACCTGTACCCCCCAAGCAACACGCCCGGGGATGCGCTGAGCCCCGGCGGCGGCCTGCGG
CCCAACGGGCAGACGAAGCCCCTGCCGGCGCTGAAGCTGGCGCTCGAGTACATCGTGCCGTGCATGAACAAGCACGGCATCTGTGTGGTG
GACGACTTCCTCGGCAAGGAGACCGGACAGCAGATCGGCGACGAGGTGCGCGCCCTGCACGACACCGGGAAGTTCACGGACGGGCAGCTG
GTCAGCCAGAAGAGTGACTCGTCCAAGGACATCCGAGGCGATAAGATCACCTGGATCGAGGGCAAGGAGCCCGGCTGCGAAACCATTGGG
CTGCTCATGAGCAGCATGGACGACCTGATACGCCACTGTAACGGGAAGCTGGGCAGCTACAAAATCAATGGCCGGACGAAATCCATCGAC
CCTGGACAGCAGTTCACGTGGGAGAATTCAAACCTGGAGGTGAACAAGCCCAAGAACCGCTATGCGAATGTCATCGCCTACGACCACTCT
CGAGTCATCCTTACCTCTATCGATGGCGTCCCCGGGAGTGACTACATCAATGCCAACTACATCGATGGCTACCGCAAGCAGAATGCCTAC
ATCGCCACGCAGGGCCCCCTGCCCGAGACCATGGGTGATTTCTGGAGGATGGTGTGGGAACAGCGCACGGCCACTGTGGTCATGATGACA
CGGCTGGAGGAGAAGTCCCGGGTAAAATGTGATCAGTACTGGCCAGCCCGTGGCACCGAGACCTGTGGCCTTATTCAGGTGACCCTGTTG
GACACAGTGGAGCTGGCCACATACACTGTGCGCACCTTCGCACTCCACAAGAGTGGCTCCAGTGAGAAGCGCGAGCTGCGTCAGTTTCAG
TTCATGGCCTGGCCAGACCATGGAGTTCCTGAGTACCCAACTCCCATCCTGGCCTTCCTACGACGGGTCAAGGCCTGCAACCCCCTAGAC
GCAGGGCCCATGGTGGTGCACTGCAGCGCGGGCGTGGGCCGCACCGGCTGCTTCATCGTGATTGATGCCATGTTGGAGCGGATGAAGCAC
GAGAAGACGGTGGACATCTATGGCCACGTGACCTGCATGCGATCACAGAGGAACTACATGGTGCAGACGGAGGACCAGTACGTGTTCATC
CATGAGGCGCTGCTGGAGGCTGCCACGTGCGGCCACACAGAGGTGCCTGCCCGCAACCTGTATGCCCACATCCAGAAGCTGGGCCAAGTG
CCTCCAGGGGAGAGTGTGACCGCCATGGAGCTCGAGTTCAAGTTGCTGGCCAGCTCCAAGGCCCACACGTCCCGCTTCATCAGCGCCAAC
CTGCCCTGCAACAAGTTCAAGAACCGGCTGGTGAACATCATGCCCTACGAATTGACCCGTGTGTGTCTGCAGCCCATCCGTGGTGTGGAG
GGCTCTGACTACATCAATGCCAGCTTCCTGGATGGTTATAGACAGCAGAAGGCCTACATAGCTACACAGGGGCCTCTGGCAGAGAGCACC
GAGGACTTCTGGCGCATGCTATGGGAGCACAATTCCACCATCATCGTCATGCTGACCAAGCTTCGGGAGATGGGCAGGGAGAAATGCCAC
CAGTACTGGCCAGCAGAGCGCTCTGCTCGCTACCAGTACTTTGTTGTTGACCCGATGGCTGAGTACAACATGCCCCAGTATATCCTGCGT
GAGTTCAAGGTCACGGATGCCCGGGATGGGCAGTCAAGGACAATCCGGCAGTTCCAGTTCACAGACTGGCCAGAGCAGGGCGTGCCCAAG
ACAGGCGAGGGATTCATTGACTTCATCGGGCAGGTGCATAAGACCAAGGAGCAGTTTGGACAGGATGGGCCTATCACGGTGCACTGCAGT
GCTGGCGTGGGCCGCACCGGGGTGTTCATCACTCTGAGCATCGTCCTGGAGCGCATGCGCTACGAGGGCGTGGTCGACATGTTTCAGACC
GTGAAGACCCTGCGTACACAGCGTCCTGCCATGGTGCAGACAGAGGACCAGTATCAGCTGTGCTACCGTGCGGCCCTGGAGTACCTCGGC

>In-frame_EGLN1_ENST00000366641_chr1_231556744_-_PTPRF_ENST00000438120_chr1_44083116_+_2544nt
ATGGCCAATGACAGCGGCGGGCCCGGCGGGCCGAGCCCGAGCGAGCGAGACCGGCAGTACTGCGAGCTGTGCGGGAAGATGGAGAACCTG
CTGCGCTGCAGCCGCTGCCGCAGCTCCTTCTACTGCTGCAAGGAGCACCAGCGTCAGGACTGGAAGAAGCACAAGCTCGTGTGCCAGGGC
AGCGAGGGCGCCCTCGGCCACGGAGTGGGCCCACACCAGCATTCCGGCCCCGCGCCGCCGGCTGCAGTGCCGCCGCCCAGGGCCGGGGCC
CGGGAGCCCAGGAAGGCAGCGGCGCGCCGGGACAACGCCTCCGGGGACGCGGCCAAGGGAAAAGTAAAGGCCAAGCCCCCGGCCGACCCA
GCGGCGGCCGCGTCGCCGTGTCGTGCGGCCGCCGGCGGCCAGGGCTCGGCGGTGGCTGCCGAAGCCGAGCCCGGCAAGGAGGAGCCGCCG
GCCCGCTCATCGCTGTTCCAGGAGAAGGCGAACCTGTACCCCCCAAGCAACACGCCCGGGGATGCGCTGAGCCCCGGCGGCGGCCTGCGG
CCCAACGGGCAGACGAAGCCCCTGCCGGCGCTGAAGCTGGCGCTCGAGTACATCGTGCCGTGCATGAACAAGCACGGCATCTGTGTGGTG
GACGACTTCCTCGGCAAGGAGACCGGACAGCAGATCGGCGACGAGGTGCGCGCCCTGCACGACACCGGGAAGTTCACGGACGGGCAGCTG
GTCAGCCAGAAGAGTGACTCGTCCAAGGACATCCGAGGCGATAAGATCACCTGGATCGAGGGCAAGGAGCCCGGCTGCGAAACCATTGGG
CTGCTCATGAGCAGCATGGACGACCTGATACGCCACTGTAACGGGAAGCTGGGCAGCTACAAAATCAATGGCCGGACGAAATCCATCGAC
CCTGGACAGCAGTTCACGTGGGAGAATTCAAACCTGGAGGTGAACAAGCCCAAGAACCGCTATGCGAATGTCATCGCCTACGACCACTCT
CGAGTCATCCTTACCTCTATCGATGGCGTCCCCGGGAGTGACTACATCAATGCCAACTACATCGATGGCTACCGCAAGCAGAATGCCTAC
ATCGCCACGCAGGGCCCCCTGCCCGAGACCATGGGTGATTTCTGGAGGATGGTGTGGGAACAGCGCACGGCCACTGTGGTCATGATGACA
CGGCTGGAGGAGAAGTCCCGGGTAAAATGTGATCAGTACTGGCCAGCCCGTGGCACCGAGACCTGTGGCCTTATTCAGGTGACCCTGTTG
GACACAGTGGAGCTGGCCACATACACTGTGCGCACCTTCGCACTCCACAAGAGTGGCTCCAGTGAGAAGCGCGAGCTGCGTCAGTTTCAG
TTCATGGCCTGGCCAGACCATGGAGTTCCTGAGTACCCAACTCCCATCCTGGCCTTCCTACGACGGGTCAAGGCCTGCAACCCCCTAGAC
GCAGGGCCCATGGTGGTGCACTGCAGCGCGGGCGTGGGCCGCACCGGCTGCTTCATCGTGATTGATGCCATGTTGGAGCGGATGAAGCAC
GAGAAGACGGTGGACATCTATGGCCACGTGACCTGCATGCGATCACAGAGGAACTACATGGTGCAGACGGAGGACCAGTACGTGTTCATC
CATGAGGCGCTGCTGGAGGCTGCCACGTGCGGCCACACAGAGGTGCCTGCCCGCAACCTGTATGCCCACATCCAGAAGCTGGGCCAAGTG
CCTCCAGGGGAGAGTGTGACCGCCATGGAGCTCGAGTTCAAGTTGCTGGCCAGCTCCAAGGCCCACACGTCCCGCTTCATCAGCGCCAAC
CTGCCCTGCAACAAGTTCAAGAACCGGCTGGTGAACATCATGCCCTACGAATTGACCCGTGTGTGTCTGCAGCCCATCCGTGGTGTGGAG
GGCTCTGACTACATCAATGCCAGCTTCCTGGATGGTTATAGACAGCAGAAGGCCTACATAGCTACACAGGGGCCTCTGGCAGAGAGCACC
GAGGACTTCTGGCGCATGCTATGGGAGCACAATTCCACCATCATCGTCATGCTGACCAAGCTTCGGGAGATGGGCAGGGAGAAATGCCAC
CAGTACTGGCCAGCAGAGCGCTCTGCTCGCTACCAGTACTTTGTTGTTGACCCGATGGCTGAGTACAACATGCCCCAGTATATCCTGCGT
GAGTTCAAGGTCACGGATGCCCGGGATGGGCAGTCAAGGACAATCCGGCAGTTCCAGTTCACAGACTGGCCAGAGCAGGGCGTGCCCAAG
ACAGGCGAGGGATTCATTGACTTCATCGGGCAGGTGCATAAGACCAAGGAGCAGTTTGGACAGGATGGGCCTATCACGGTGCACTGCAGT
GCTGGCGTGGGCCGCACCGGGGTGTTCATCACTCTGAGCATCGTCCTGGAGCGCATGCGCTACGAGGGCGTGGTCGACATGTTTCAGACC
GTGAAGACCCTGCGTACACAGCGTCCTGCCATGGTGCAGACAGAGGACCAGTATCAGCTGTGCTACCGTGCGGCCCTGGAGTACCTCGGC

>In-frame_EGLN1_ENST00000366641_chr1_231556744_-_PTPRF_ENST00000372413_chr1_44083116_+_2544nt
ATGGCCAATGACAGCGGCGGGCCCGGCGGGCCGAGCCCGAGCGAGCGAGACCGGCAGTACTGCGAGCTGTGCGGGAAGATGGAGAACCTG
CTGCGCTGCAGCCGCTGCCGCAGCTCCTTCTACTGCTGCAAGGAGCACCAGCGTCAGGACTGGAAGAAGCACAAGCTCGTGTGCCAGGGC
AGCGAGGGCGCCCTCGGCCACGGAGTGGGCCCACACCAGCATTCCGGCCCCGCGCCGCCGGCTGCAGTGCCGCCGCCCAGGGCCGGGGCC
CGGGAGCCCAGGAAGGCAGCGGCGCGCCGGGACAACGCCTCCGGGGACGCGGCCAAGGGAAAAGTAAAGGCCAAGCCCCCGGCCGACCCA
GCGGCGGCCGCGTCGCCGTGTCGTGCGGCCGCCGGCGGCCAGGGCTCGGCGGTGGCTGCCGAAGCCGAGCCCGGCAAGGAGGAGCCGCCG
GCCCGCTCATCGCTGTTCCAGGAGAAGGCGAACCTGTACCCCCCAAGCAACACGCCCGGGGATGCGCTGAGCCCCGGCGGCGGCCTGCGG
CCCAACGGGCAGACGAAGCCCCTGCCGGCGCTGAAGCTGGCGCTCGAGTACATCGTGCCGTGCATGAACAAGCACGGCATCTGTGTGGTG
GACGACTTCCTCGGCAAGGAGACCGGACAGCAGATCGGCGACGAGGTGCGCGCCCTGCACGACACCGGGAAGTTCACGGACGGGCAGCTG
GTCAGCCAGAAGAGTGACTCGTCCAAGGACATCCGAGGCGATAAGATCACCTGGATCGAGGGCAAGGAGCCCGGCTGCGAAACCATTGGG
CTGCTCATGAGCAGCATGGACGACCTGATACGCCACTGTAACGGGAAGCTGGGCAGCTACAAAATCAATGGCCGGACGAAATCCATCGAC
CCTGGACAGCAGTTCACGTGGGAGAATTCAAACCTGGAGGTGAACAAGCCCAAGAACCGCTATGCGAATGTCATCGCCTACGACCACTCT
CGAGTCATCCTTACCTCTATCGATGGCGTCCCCGGGAGTGACTACATCAATGCCAACTACATCGATGGCTACCGCAAGCAGAATGCCTAC
ATCGCCACGCAGGGCCCCCTGCCCGAGACCATGGGTGATTTCTGGAGGATGGTGTGGGAACAGCGCACGGCCACTGTGGTCATGATGACA
CGGCTGGAGGAGAAGTCCCGGGTAAAATGTGATCAGTACTGGCCAGCCCGTGGCACCGAGACCTGTGGCCTTATTCAGGTGACCCTGTTG
GACACAGTGGAGCTGGCCACATACACTGTGCGCACCTTCGCACTCCACAAGAGTGGCTCCAGTGAGAAGCGCGAGCTGCGTCAGTTTCAG
TTCATGGCCTGGCCAGACCATGGAGTTCCTGAGTACCCAACTCCCATCCTGGCCTTCCTACGACGGGTCAAGGCCTGCAACCCCCTAGAC
GCAGGGCCCATGGTGGTGCACTGCAGCGCGGGCGTGGGCCGCACCGGCTGCTTCATCGTGATTGATGCCATGTTGGAGCGGATGAAGCAC
GAGAAGACGGTGGACATCTATGGCCACGTGACCTGCATGCGATCACAGAGGAACTACATGGTGCAGACGGAGGACCAGTACGTGTTCATC
CATGAGGCGCTGCTGGAGGCTGCCACGTGCGGCCACACAGAGGTGCCTGCCCGCAACCTGTATGCCCACATCCAGAAGCTGGGCCAAGTG
CCTCCAGGGGAGAGTGTGACCGCCATGGAGCTCGAGTTCAAGTTGCTGGCCAGCTCCAAGGCCCACACGTCCCGCTTCATCAGCGCCAAC
CTGCCCTGCAACAAGTTCAAGAACCGGCTGGTGAACATCATGCCCTACGAATTGACCCGTGTGTGTCTGCAGCCCATCCGTGGTGTGGAG
GGCTCTGACTACATCAATGCCAGCTTCCTGGATGGTTATAGACAGCAGAAGGCCTACATAGCTACACAGGGGCCTCTGGCAGAGAGCACC
GAGGACTTCTGGCGCATGCTATGGGAGCACAATTCCACCATCATCGTCATGCTGACCAAGCTTCGGGAGATGGGCAGGGAGAAATGCCAC
CAGTACTGGCCAGCAGAGCGCTCTGCTCGCTACCAGTACTTTGTTGTTGACCCGATGGCTGAGTACAACATGCCCCAGTATATCCTGCGT
GAGTTCAAGGTCACGGATGCCCGGGATGGGCAGTCAAGGACAATCCGGCAGTTCCAGTTCACAGACTGGCCAGAGCAGGGCGTGCCCAAG
ACAGGCGAGGGATTCATTGACTTCATCGGGCAGGTGCATAAGACCAAGGAGCAGTTTGGACAGGATGGGCCTATCACGGTGCACTGCAGT
GCTGGCGTGGGCCGCACCGGGGTGTTCATCACTCTGAGCATCGTCCTGGAGCGCATGCGCTACGAGGGCGTGGTCGACATGTTTCAGACC
GTGAAGACCCTGCGTACACAGCGTCCTGCCATGGTGCAGACAGAGGACCAGTATCAGCTGTGCTACCGTGCGGCCCTGGAGTACCTCGGC

>In-frame_EGLN1_ENST00000366641_chr1_231556744_-_PTPRF_ENST00000372414_chr1_44083116_+_2544nt
ATGGCCAATGACAGCGGCGGGCCCGGCGGGCCGAGCCCGAGCGAGCGAGACCGGCAGTACTGCGAGCTGTGCGGGAAGATGGAGAACCTG
CTGCGCTGCAGCCGCTGCCGCAGCTCCTTCTACTGCTGCAAGGAGCACCAGCGTCAGGACTGGAAGAAGCACAAGCTCGTGTGCCAGGGC
AGCGAGGGCGCCCTCGGCCACGGAGTGGGCCCACACCAGCATTCCGGCCCCGCGCCGCCGGCTGCAGTGCCGCCGCCCAGGGCCGGGGCC
CGGGAGCCCAGGAAGGCAGCGGCGCGCCGGGACAACGCCTCCGGGGACGCGGCCAAGGGAAAAGTAAAGGCCAAGCCCCCGGCCGACCCA
GCGGCGGCCGCGTCGCCGTGTCGTGCGGCCGCCGGCGGCCAGGGCTCGGCGGTGGCTGCCGAAGCCGAGCCCGGCAAGGAGGAGCCGCCG
GCCCGCTCATCGCTGTTCCAGGAGAAGGCGAACCTGTACCCCCCAAGCAACACGCCCGGGGATGCGCTGAGCCCCGGCGGCGGCCTGCGG
CCCAACGGGCAGACGAAGCCCCTGCCGGCGCTGAAGCTGGCGCTCGAGTACATCGTGCCGTGCATGAACAAGCACGGCATCTGTGTGGTG
GACGACTTCCTCGGCAAGGAGACCGGACAGCAGATCGGCGACGAGGTGCGCGCCCTGCACGACACCGGGAAGTTCACGGACGGGCAGCTG
GTCAGCCAGAAGAGTGACTCGTCCAAGGACATCCGAGGCGATAAGATCACCTGGATCGAGGGCAAGGAGCCCGGCTGCGAAACCATTGGG
CTGCTCATGAGCAGCATGGACGACCTGATACGCCACTGTAACGGGAAGCTGGGCAGCTACAAAATCAATGGCCGGACGAAATCCATCGAC
CCTGGACAGCAGTTCACGTGGGAGAATTCAAACCTGGAGGTGAACAAGCCCAAGAACCGCTATGCGAATGTCATCGCCTACGACCACTCT
CGAGTCATCCTTACCTCTATCGATGGCGTCCCCGGGAGTGACTACATCAATGCCAACTACATCGATGGCTACCGCAAGCAGAATGCCTAC
ATCGCCACGCAGGGCCCCCTGCCCGAGACCATGGGTGATTTCTGGAGGATGGTGTGGGAACAGCGCACGGCCACTGTGGTCATGATGACA
CGGCTGGAGGAGAAGTCCCGGGTAAAATGTGATCAGTACTGGCCAGCCCGTGGCACCGAGACCTGTGGCCTTATTCAGGTGACCCTGTTG
GACACAGTGGAGCTGGCCACATACACTGTGCGCACCTTCGCACTCCACAAGAGTGGCTCCAGTGAGAAGCGCGAGCTGCGTCAGTTTCAG
TTCATGGCCTGGCCAGACCATGGAGTTCCTGAGTACCCAACTCCCATCCTGGCCTTCCTACGACGGGTCAAGGCCTGCAACCCCCTAGAC
GCAGGGCCCATGGTGGTGCACTGCAGCGCGGGCGTGGGCCGCACCGGCTGCTTCATCGTGATTGATGCCATGTTGGAGCGGATGAAGCAC
GAGAAGACGGTGGACATCTATGGCCACGTGACCTGCATGCGATCACAGAGGAACTACATGGTGCAGACGGAGGACCAGTACGTGTTCATC
CATGAGGCGCTGCTGGAGGCTGCCACGTGCGGCCACACAGAGGTGCCTGCCCGCAACCTGTATGCCCACATCCAGAAGCTGGGCCAAGTG
CCTCCAGGGGAGAGTGTGACCGCCATGGAGCTCGAGTTCAAGTTGCTGGCCAGCTCCAAGGCCCACACGTCCCGCTTCATCAGCGCCAAC
CTGCCCTGCAACAAGTTCAAGAACCGGCTGGTGAACATCATGCCCTACGAATTGACCCGTGTGTGTCTGCAGCCCATCCGTGGTGTGGAG
GGCTCTGACTACATCAATGCCAGCTTCCTGGATGGTTATAGACAGCAGAAGGCCTACATAGCTACACAGGGGCCTCTGGCAGAGAGCACC
GAGGACTTCTGGCGCATGCTATGGGAGCACAATTCCACCATCATCGTCATGCTGACCAAGCTTCGGGAGATGGGCAGGGAGAAATGCCAC
CAGTACTGGCCAGCAGAGCGCTCTGCTCGCTACCAGTACTTTGTTGTTGACCCGATGGCTGAGTACAACATGCCCCAGTATATCCTGCGT
GAGTTCAAGGTCACGGATGCCCGGGATGGGCAGTCAAGGACAATCCGGCAGTTCCAGTTCACAGACTGGCCAGAGCAGGGCGTGCCCAAG
ACAGGCGAGGGATTCATTGACTTCATCGGGCAGGTGCATAAGACCAAGGAGCAGTTTGGACAGGATGGGCCTATCACGGTGCACTGCAGT
GCTGGCGTGGGCCGCACCGGGGTGTTCATCACTCTGAGCATCGTCCTGGAGCGCATGCGCTACGAGGGCGTGGTCGACATGTTTCAGACC
GTGAAGACCCTGCGTACACAGCGTCCTGCCATGGTGCAGACAGAGGACCAGTATCAGCTGTGCTACCGTGCGGCCCTGGAGTACCTCGGC

>In-frame_EGLN1_ENST00000366641_chr1_231556744_-_PTPRF_ENST00000422171_chr1_44083116_+_2544nt
ATGGCCAATGACAGCGGCGGGCCCGGCGGGCCGAGCCCGAGCGAGCGAGACCGGCAGTACTGCGAGCTGTGCGGGAAGATGGAGAACCTG
CTGCGCTGCAGCCGCTGCCGCAGCTCCTTCTACTGCTGCAAGGAGCACCAGCGTCAGGACTGGAAGAAGCACAAGCTCGTGTGCCAGGGC
AGCGAGGGCGCCCTCGGCCACGGAGTGGGCCCACACCAGCATTCCGGCCCCGCGCCGCCGGCTGCAGTGCCGCCGCCCAGGGCCGGGGCC
CGGGAGCCCAGGAAGGCAGCGGCGCGCCGGGACAACGCCTCCGGGGACGCGGCCAAGGGAAAAGTAAAGGCCAAGCCCCCGGCCGACCCA
GCGGCGGCCGCGTCGCCGTGTCGTGCGGCCGCCGGCGGCCAGGGCTCGGCGGTGGCTGCCGAAGCCGAGCCCGGCAAGGAGGAGCCGCCG
GCCCGCTCATCGCTGTTCCAGGAGAAGGCGAACCTGTACCCCCCAAGCAACACGCCCGGGGATGCGCTGAGCCCCGGCGGCGGCCTGCGG
CCCAACGGGCAGACGAAGCCCCTGCCGGCGCTGAAGCTGGCGCTCGAGTACATCGTGCCGTGCATGAACAAGCACGGCATCTGTGTGGTG
GACGACTTCCTCGGCAAGGAGACCGGACAGCAGATCGGCGACGAGGTGCGCGCCCTGCACGACACCGGGAAGTTCACGGACGGGCAGCTG
GTCAGCCAGAAGAGTGACTCGTCCAAGGACATCCGAGGCGATAAGATCACCTGGATCGAGGGCAAGGAGCCCGGCTGCGAAACCATTGGG
CTGCTCATGAGCAGCATGGACGACCTGATACGCCACTGTAACGGGAAGCTGGGCAGCTACAAAATCAATGGCCGGACGAAATCCATCGAC
CCTGGACAGCAGTTCACGTGGGAGAATTCAAACCTGGAGGTGAACAAGCCCAAGAACCGCTATGCGAATGTCATCGCCTACGACCACTCT
CGAGTCATCCTTACCTCTATCGATGGCGTCCCCGGGAGTGACTACATCAATGCCAACTACATCGATGGCTACCGCAAGCAGAATGCCTAC
ATCGCCACGCAGGGCCCCCTGCCCGAGACCATGGGTGATTTCTGGAGGATGGTGTGGGAACAGCGCACGGCCACTGTGGTCATGATGACA
CGGCTGGAGGAGAAGTCCCGGGTAAAATGTGATCAGTACTGGCCAGCCCGTGGCACCGAGACCTGTGGCCTTATTCAGGTGACCCTGTTG
GACACAGTGGAGCTGGCCACATACACTGTGCGCACCTTCGCACTCCACAAGAGTGGCTCCAGTGAGAAGCGCGAGCTGCGTCAGTTTCAG
TTCATGGCCTGGCCAGACCATGGAGTTCCTGAGTACCCAACTCCCATCCTGGCCTTCCTACGACGGGTCAAGGCCTGCAACCCCCTAGAC
GCAGGGCCCATGGTGGTGCACTGCAGCGCGGGCGTGGGCCGCACCGGCTGCTTCATCGTGATTGATGCCATGTTGGAGCGGATGAAGCAC
GAGAAGACGGTGGACATCTATGGCCACGTGACCTGCATGCGATCACAGAGGAACTACATGGTGCAGACGGAGGACCAGTACGTGTTCATC
CATGAGGCGCTGCTGGAGGCTGCCACGTGCGGCCACACAGAGGTGCCTGCCCGCAACCTGTATGCCCACATCCAGAAGCTGGGCCAAGTG
CCTCCAGGGGAGAGTGTGACCGCCATGGAGCTCGAGTTCAAGTTGCTGGCCAGCTCCAAGGCCCACACGTCCCGCTTCATCAGCGCCAAC
CTGCCCTGCAACAAGTTCAAGAACCGGCTGGTGAACATCATGCCCTACGAATTGACCCGTGTGTGTCTGCAGCCCATCCGTGGTGTGGAG
GGCTCTGACTACATCAATGCCAGCTTCCTGGATGGTTATAGACAGCAGAAGGCCTACATAGCTACACAGGGGCCTCTGGCAGAGAGCACC
GAGGACTTCTGGCGCATGCTATGGGAGCACAATTCCACCATCATCGTCATGCTGACCAAGCTTCGGGAGATGGGCAGGGAGAAATGCCAC
CAGTACTGGCCAGCAGAGCGCTCTGCTCGCTACCAGTACTTTGTTGTTGACCCGATGGCTGAGTACAACATGCCCCAGTATATCCTGCGT
GAGTTCAAGGTCACGGATGCCCGGGATGGGCAGTCAAGGACAATCCGGCAGTTCCAGTTCACAGACTGGCCAGAGCAGGGCGTGCCCAAG
ACAGGCGAGGGATTCATTGACTTCATCGGGCAGGTGCATAAGACCAAGGAGCAGTTTGGACAGGATGGGCCTATCACGGTGCACTGCAGT
GCTGGCGTGGGCCGCACCGGGGTGTTCATCACTCTGAGCATCGTCCTGGAGCGCATGCGCTACGAGGGCGTGGTCGACATGTTTCAGACC
GTGAAGACCCTGCGTACACAGCGTCCTGCCATGGTGCAGACAGAGGACCAGTATCAGCTGTGCTACCGTGCGGCCCTGGAGTACCTCGGC


* Fusion transcript sequences (Full-length transcript).
>In-frame_EGLN1_ENST00000366641_chr1_231556744_-_PTPRF_ENST00000359947_chr1_44083116_+_7363nt
TTAGGGGCAGAAAAACATTTGTAATAATTAATGGCTTTGAGAGACACAAGGCTTTGTTTGCCCCAGAGTATTAGTTAACCCACCTAGTGC
TCCTAATCATACAATATTAAGGATTGGGAGGGACATTCATTGCCTCACTCTCTATTTGTTTCACCTTCTGTAAAATTGGTAGAATAATAG
TACCCACTTCATAGCATTGTATGATGATTAAATTGGTTAATATTTTTAAAATGCTTAGAACACAGATTGGGCACATAACAGCAAGCACCA
CATGTGTTTATAAGATAAATTCCTTTGTGTTGCCTTCCGTTAAAGTTTAAATAAGTAAATAAATAAATAAATACTTGCATGACATTTTGA
AGTCTCTCTATAACATCTGAGTAAGTGGCGGCTGCGACAATGCTACTGGAGTTCCAGAATCGTGTTGGTGACAAGATTGTTCACCAGCAT
ATGGTGTGGTGAAAACTCACTAATTTGGAATTAGTTCAGATTATTAAGCCTGAATAGGTGAAAATCCTGAAATCAAGGATCTTTGGAACT
ATTTGAAATCAGTATTTTATATTTTCCTGTTGTATTCATTAAAGTGTTGCAAGTGTTCTATTTGATGGATTAAGTATATTTAGGATATAC
ATGTTCAATTTGTGATTTTGTATACTTAATTGGAACAAGAAAGCTAATAAAGGTTTTGATATGGACATCTATTCTTTTAAGTAAACTTCA
ATGAAAATATATGAGTAGAGCATATAGAGATGTAAATAATTTGTGGACACACCACAGACTGAAATAGCAAATTTAAAAGAAATTGTTGGA
AGAATCAAGTGTTTGTGGAATGAGTCCTCCTAGTAAAGTTCCTGCTCTTGTGAATAATTAAGCCTCATGTATAATTACTATAGCAAAAGG
AAGCCTAAGAAGTATTAGACTCTACTTGTATTTAAATTACATTTTACATAATTTATGTGTATGAAAAATGTTTTAAATGCTTATTTTCGT
AAGCCATGAGATAGCTCCTTTATATTTTAAGAATTTCTGAATTAATTTGCTTGGATTTTATTAGTGCAAATGGCAGAGCTAGCAATTCCT
TTTTCTGTGTTCCCATTCCATCCTATTCATCCCTCTTTTAGGAAACTCTGAACTCTGGATTGTCCTTGTTTACATACCTGCCTCCTGCAT
TGGACTATGTGTCTCTGAGTGTAGTATGACTAATTCATTTGTTTGTCAAGGACTCTCAATGCATTTGTTGAACAGCCTAATTAGTAATGT
CTGCAACAATGACATTTTACTGTATTTAATAAAGCTCTGGGAAAGTAGGATACACATAAGACAGGTCTAGGTCTAAATTCTTTACAGAAA
CTTGGATTTTTAGTTCGGTTTGAAATTTGAAGATGTGAGTATATTTATCTCAGTTTCCCAAAGGACAAGCTAATTGGAATTATCATCCTC
TTTCACTTGATTGGATCCCCAGAATGCCATTTACGCATGCAGCAGGATTTTATAACAGTTTTAAATTCTGTATATTTGATGAAGAGGTTT
TATATTTTTGGATTCAAGCCTCTTTTTAAACTTCTACAATATGGTTTACAATAATTCCTTATATCCTGCTTTTGAAATACATATTACAAC
TTTTTAAGTTTGGAAGGCTATATTTCAAGGACTGAAGTTACAGTATACTCAAGTGATACACAAGCCTAGCACCCCACTTTCCACATAGTG
TTCGATAAAGATTGATAAACTCGAAATCACAGACCTTTTAATTCTTAAGACAAATAGCAGCAGAAAGAAACATCTTTGGCTTATTTCTGG
TAAGGTTTTTATGCTCTGTAAAACAAAGAATTGTATTCATCCGCGCAGCACAGATTCTATTAAAAATAAATGTGAGAGTCGTTAATGTAG
TACTGCTCATTTACCATCAAAATTCACTTTTCAGGAATAATCCCATCAGTTTAAATTGGATATTGGAATGAGCATTGATTACATTTAACT
TGGTAGCCCAAAATTTCTTCATGGGGTTTTGAACTCGGCGGGATTTCAAAGGTTTTAAAAATGAGTTTTTGATTTTTTTTAAAACCCTCA
AATTTCATTACCTTTAAACTAGGTCGAAACGGGGCGCAAGAGATTGGATTAACACCATAGTAATACTTATTTTGTTCTTAACCATTTCAG
GGCTTCTTGAAATAGAGGCTGTATGGTGTAATGGAAAAAACAGCCTTGGAATCTGGGAGCCTGATTCCTGGATTCAGTCCCAGTTTTGCG
TGACCTTGGGCAAGTTACTTTACTTCTCTGAATTTCCGTTTCCTCCTCTGCAAAATGAGGATCGCAATAGCCACCTTGCAACCTTGACTG
GAGCGAGCCTCGCACACCCCGCGCCGGCCTGGAGGAAGAGCAGCCATGATTACGCCGCCTTCGCTCCGCTACCCGCTTGCGGCTGGCGCC
CTCCTCCAGCAGGTGTAGGCGCTGCCGCGCTGCCCCACGCCTTTCCGCCGCTCGCGGGCCTGCGCCTCGGCGTCCCCGAGGAGGCCGCTG
CGGGCTGAGGTAGCGCACCGGCCTCTCGGCGTCCCAGTCCGGTCCCGGGCGGAGGGAAAGCGGGCGACCCACCTCCGAGGCAGAAGCCGA
GGCCCGGCCCCGCCGAGTGCGGAGGAGCGCAGGCAGCCCCCGCCCCTCGGCCCTCCCCCCGGCCCTCCCGGCCCTCCCTCCGCCCCCTCC
GCCCTCGCGCGCCGCCCGCCCGGGTCGCCGCGGGGCCGTGGTGTACGTGCAGAGCGCGCAGAGCGAGTGGCGCCCGTATGCCCTGCGCTC
CTCCACAGCCTGGGCCGGGCCGCCCGGGACGCTGAGGCGGCGGCGGCGGCCGAGGGGGCCGGTCTTGCGCTCCCCAGGCCCGCGCGCCTG
AGCCCAGGTTGCCATTCGCCGCACAGGCCCTATTCTCTCAGCCCTCGGCGGCGATGAGGCGCTGAGGCGGCTGCCGGCGCTGCGCCGGAG
CTTAGGACTCGGAAGCGGCCGGGCCGAGGGCGTGGGGTGCCGGCCTCCCTGAGGCGAGGGTAGCGGGTGCATGGCGCAGTAACGGCCCCT
ATCTCTCTCCCCGCTCCCCAGCCTCGGGCGAGGCCGTCCGGCCGCTACCCCTCCTGCTCGGCCGCCGCAGTCGCCGTCGCCGCCGCCGCC
GCCGCCATGGCCAATGACAGCGGCGGGCCCGGCGGGCCGAGCCCGAGCGAGCGAGACCGGCAGTACTGCGAGCTGTGCGGGAAGATGGAG
AACCTGCTGCGCTGCAGCCGCTGCCGCAGCTCCTTCTACTGCTGCAAGGAGCACCAGCGTCAGGACTGGAAGAAGCACAAGCTCGTGTGC
CAGGGCAGCGAGGGCGCCCTCGGCCACGGAGTGGGCCCACACCAGCATTCCGGCCCCGCGCCGCCGGCTGCAGTGCCGCCGCCCAGGGCC
GGGGCCCGGGAGCCCAGGAAGGCAGCGGCGCGCCGGGACAACGCCTCCGGGGACGCGGCCAAGGGAAAAGTAAAGGCCAAGCCCCCGGCC
GACCCAGCGGCGGCCGCGTCGCCGTGTCGTGCGGCCGCCGGCGGCCAGGGCTCGGCGGTGGCTGCCGAAGCCGAGCCCGGCAAGGAGGAG
CCGCCGGCCCGCTCATCGCTGTTCCAGGAGAAGGCGAACCTGTACCCCCCAAGCAACACGCCCGGGGATGCGCTGAGCCCCGGCGGCGGC
CTGCGGCCCAACGGGCAGACGAAGCCCCTGCCGGCGCTGAAGCTGGCGCTCGAGTACATCGTGCCGTGCATGAACAAGCACGGCATCTGT
GTGGTGGACGACTTCCTCGGCAAGGAGACCGGACAGCAGATCGGCGACGAGGTGCGCGCCCTGCACGACACCGGGAAGTTCACGGACGGG
CAGCTGGTCAGCCAGAAGAGTGACTCGTCCAAGGACATCCGAGGCGATAAGATCACCTGGATCGAGGGCAAGGAGCCCGGCTGCGAAACC
ATTGGGCTGCTCATGAGCAGCATGGACGACCTGATACGCCACTGTAACGGGAAGCTGGGCAGCTACAAAATCAATGGCCGGACGAAATCC
ATCGACCCTGGACAGCAGTTCACGTGGGAGAATTCAAACCTGGAGGTGAACAAGCCCAAGAACCGCTATGCGAATGTCATCGCCTACGAC
CACTCTCGAGTCATCCTTACCTCTATCGATGGCGTCCCCGGGAGTGACTACATCAATGCCAACTACATCGATGGCTACCGCAAGCAGAAT
GCCTACATCGCCACGCAGGGCCCCCTGCCCGAGACCATGGGTGATTTCTGGAGGATGGTGTGGGAACAGCGCACGGCCACTGTGGTCATG
ATGACACGGCTGGAGGAGAAGTCCCGGGTAAAATGTGATCAGTACTGGCCAGCCCGTGGCACCGAGACCTGTGGCCTTATTCAGGTGACC
CTGTTGGACACAGTGGAGCTGGCCACATACACTGTGCGCACCTTCGCACTCCACAAGAGTGGCTCCAGTGAGAAGCGCGAGCTGCGTCAG
TTTCAGTTCATGGCCTGGCCAGACCATGGAGTTCCTGAGTACCCAACTCCCATCCTGGCCTTCCTACGACGGGTCAAGGCCTGCAACCCC
CTAGACGCAGGGCCCATGGTGGTGCACTGCAGCGCGGGCGTGGGCCGCACCGGCTGCTTCATCGTGATTGATGCCATGTTGGAGCGGATG
AAGCACGAGAAGACGGTGGACATCTATGGCCACGTGACCTGCATGCGATCACAGAGGAACTACATGGTGCAGACGGAGGACCAGTACGTG
TTCATCCATGAGGCGCTGCTGGAGGCTGCCACGTGCGGCCACACAGAGGTGCCTGCCCGCAACCTGTATGCCCACATCCAGAAGCTGGGC
CAAGTGCCTCCAGGGGAGAGTGTGACCGCCATGGAGCTCGAGTTCAAGTTGCTGGCCAGCTCCAAGGCCCACACGTCCCGCTTCATCAGC
GCCAACCTGCCCTGCAACAAGTTCAAGAACCGGCTGGTGAACATCATGCCCTACGAATTGACCCGTGTGTGTCTGCAGCCCATCCGTGGT
GTGGAGGGCTCTGACTACATCAATGCCAGCTTCCTGGATGGTTATAGACAGCAGAAGGCCTACATAGCTACACAGGGGCCTCTGGCAGAG
AGCACCGAGGACTTCTGGCGCATGCTATGGGAGCACAATTCCACCATCATCGTCATGCTGACCAAGCTTCGGGAGATGGGCAGGGAGAAA
TGCCACCAGTACTGGCCAGCAGAGCGCTCTGCTCGCTACCAGTACTTTGTTGTTGACCCGATGGCTGAGTACAACATGCCCCAGTATATC
CTGCGTGAGTTCAAGGTCACGGATGCCCGGGATGGGCAGTCAAGGACAATCCGGCAGTTCCAGTTCACAGACTGGCCAGAGCAGGGCGTG
CCCAAGACAGGCGAGGGATTCATTGACTTCATCGGGCAGGTGCATAAGACCAAGGAGCAGTTTGGACAGGATGGGCCTATCACGGTGCAC
TGCAGTGCTGGCGTGGGCCGCACCGGGGTGTTCATCACTCTGAGCATCGTCCTGGAGCGCATGCGCTACGAGGGCGTGGTCGACATGTTT
CAGACCGTGAAGACCCTGCGTACACAGCGTCCTGCCATGGTGCAGACAGAGGACCAGTATCAGCTGTGCTACCGTGCGGCCCTGGAGTAC
CTCGGCAGCTTTGACCACTATGCAACGTAACTACCGCTCCCCTCTCCTCCGCCACCCCCGCCGTGGGGCTCCGGAGGGGACCCAGCTCCT
CTGAGCCATACCGACCATCGTCCAGCCCTCCTACGCAGATGCTGTCACTGGCAGAGCACAGCCCACGGGGATCACAGCGTTTCAGGAACG
TTGCCACACCAATCAGAGAGCCTAGAACATCCCTGGGCAAGTGGATGGCCCAGCAGGCAGGCACTGTGGCCCTTCTGTCCACCAGACCCA
CCTGGAGCCCGCTTCAAGCTCTCTGTTGCGCTCCCGCATTTCTCATGCTTCTTCTCATGGGGTGGGGTTGGGGCAAAGCCTCCTTTTTAA
TACATTAAGTGGGGTAGACTGAGGGATTTTAGCCTCTTCCCTCTGATTTTTCCTTTCGCGAATCCGTATCTGCAGAATGGGCCACTGTAG
GGGTTGGGGTTTATTTTGTTTTGTTTTTTTTTTTCTTGAGTTCACTTTGGATCCTTATTTTGTATGACTTCTGCTGAAGGACAGAACATT
GCCTTCCTCGTGCAGAGCTGGGGCTGCCAGCCTGAGCGGAGGCTCGGCCGTGGGCCGGGAGGCAGTGCTGATCCGGCTGCTCCTCCAGCC
CTTCAGACGAGATCCTGTTTCAGCTAAATGCAGGGAAACTCAATGTTTTTTTAAGTTTTGTTTTCCCTTTAAAGCCTTTTTTTAGGCCAC
ATTGACAGTGGTGGGCGGGGAGAAGATAGGGAACACTCATCCCTGGTCGTCTATCCCAGTGTGTGTTTAACATTCACAGCCCAGAACCAC
AGATGTGTCTGGGAGAGCCTGGCAAGGCATTCCTCATCACCATCGTGTTTGCAAAGGTTAAAACAAAAACAAAAAACCACAAAAATAAAA
AACAAAAAAAACAAAAAACCCAAGAAAAAAAAAAAGAGTCAGCCCTTGGCTTCTGCTTCAAACCCTCAAGAGGGGAAGCAACTCCGTGTG
CCTGGGGTTCCCGAGGGAGCTGCTGGCTGACCTGGGCCCACAGAGCCTGGCTTTGGTCCCCAGCATTGCAGTATGGTGTGGTGTTTGTAG
GCTGTGGGGTCTGGCTGTGTGGCCAAGGTGAATAGCACAGGTTAGGGTGTGTGCCACACCCCATGCACCTCAGGGCCAAGCGGGGGCGTG
GCTGGCCTTTCAGGTCCAGGCCAGTGGGCCTGGTAGCACATGTCTGTCCTCAGAGCAGGGGCCAGATGATTTTCCTCCCTGGTTTGCAGC
TGTTTTCAAAGCCCCCGATAATCGCTCTTTTCCACTCCAAGATGCCCTCATAAACCAATGTGGCAAGACTACTGGACTTCTATCAATGGT
ACTCTAATCAGTCCTTATTATCCCAGCTTGCTGAGGGGCAGGGAGAGCGCCTCTTCCTCTGGGCAGCGCTATCTAGATAGGTAAGTGGGG
GCGGGGAAGGGTGCATAGCTGTTTTAGCTGAGGGACGTGGTGCCGACGTCCCCAAACCTAGCTAGGCTAAGTCAAGATCAACATTCCAGG
GTTGGTAATGTTGGATGATGAAACATTCATTTTTACCTTGTGGATGCTAGTGCTGTAGAGTTCACTGTTGTACACAGTCTGTTTTCTATT

>In-frame_EGLN1_ENST00000366641_chr1_231556744_-_PTPRF_ENST00000438120_chr1_44083116_+_6054nt
TTAGGGGCAGAAAAACATTTGTAATAATTAATGGCTTTGAGAGACACAAGGCTTTGTTTGCCCCAGAGTATTAGTTAACCCACCTAGTGC
TCCTAATCATACAATATTAAGGATTGGGAGGGACATTCATTGCCTCACTCTCTATTTGTTTCACCTTCTGTAAAATTGGTAGAATAATAG
TACCCACTTCATAGCATTGTATGATGATTAAATTGGTTAATATTTTTAAAATGCTTAGAACACAGATTGGGCACATAACAGCAAGCACCA
CATGTGTTTATAAGATAAATTCCTTTGTGTTGCCTTCCGTTAAAGTTTAAATAAGTAAATAAATAAATAAATACTTGCATGACATTTTGA
AGTCTCTCTATAACATCTGAGTAAGTGGCGGCTGCGACAATGCTACTGGAGTTCCAGAATCGTGTTGGTGACAAGATTGTTCACCAGCAT
ATGGTGTGGTGAAAACTCACTAATTTGGAATTAGTTCAGATTATTAAGCCTGAATAGGTGAAAATCCTGAAATCAAGGATCTTTGGAACT
ATTTGAAATCAGTATTTTATATTTTCCTGTTGTATTCATTAAAGTGTTGCAAGTGTTCTATTTGATGGATTAAGTATATTTAGGATATAC
ATGTTCAATTTGTGATTTTGTATACTTAATTGGAACAAGAAAGCTAATAAAGGTTTTGATATGGACATCTATTCTTTTAAGTAAACTTCA
ATGAAAATATATGAGTAGAGCATATAGAGATGTAAATAATTTGTGGACACACCACAGACTGAAATAGCAAATTTAAAAGAAATTGTTGGA
AGAATCAAGTGTTTGTGGAATGAGTCCTCCTAGTAAAGTTCCTGCTCTTGTGAATAATTAAGCCTCATGTATAATTACTATAGCAAAAGG
AAGCCTAAGAAGTATTAGACTCTACTTGTATTTAAATTACATTTTACATAATTTATGTGTATGAAAAATGTTTTAAATGCTTATTTTCGT
AAGCCATGAGATAGCTCCTTTATATTTTAAGAATTTCTGAATTAATTTGCTTGGATTTTATTAGTGCAAATGGCAGAGCTAGCAATTCCT
TTTTCTGTGTTCCCATTCCATCCTATTCATCCCTCTTTTAGGAAACTCTGAACTCTGGATTGTCCTTGTTTACATACCTGCCTCCTGCAT
TGGACTATGTGTCTCTGAGTGTAGTATGACTAATTCATTTGTTTGTCAAGGACTCTCAATGCATTTGTTGAACAGCCTAATTAGTAATGT
CTGCAACAATGACATTTTACTGTATTTAATAAAGCTCTGGGAAAGTAGGATACACATAAGACAGGTCTAGGTCTAAATTCTTTACAGAAA
CTTGGATTTTTAGTTCGGTTTGAAATTTGAAGATGTGAGTATATTTATCTCAGTTTCCCAAAGGACAAGCTAATTGGAATTATCATCCTC
TTTCACTTGATTGGATCCCCAGAATGCCATTTACGCATGCAGCAGGATTTTATAACAGTTTTAAATTCTGTATATTTGATGAAGAGGTTT
TATATTTTTGGATTCAAGCCTCTTTTTAAACTTCTACAATATGGTTTACAATAATTCCTTATATCCTGCTTTTGAAATACATATTACAAC
TTTTTAAGTTTGGAAGGCTATATTTCAAGGACTGAAGTTACAGTATACTCAAGTGATACACAAGCCTAGCACCCCACTTTCCACATAGTG
TTCGATAAAGATTGATAAACTCGAAATCACAGACCTTTTAATTCTTAAGACAAATAGCAGCAGAAAGAAACATCTTTGGCTTATTTCTGG
TAAGGTTTTTATGCTCTGTAAAACAAAGAATTGTATTCATCCGCGCAGCACAGATTCTATTAAAAATAAATGTGAGAGTCGTTAATGTAG
TACTGCTCATTTACCATCAAAATTCACTTTTCAGGAATAATCCCATCAGTTTAAATTGGATATTGGAATGAGCATTGATTACATTTAACT
TGGTAGCCCAAAATTTCTTCATGGGGTTTTGAACTCGGCGGGATTTCAAAGGTTTTAAAAATGAGTTTTTGATTTTTTTTAAAACCCTCA
AATTTCATTACCTTTAAACTAGGTCGAAACGGGGCGCAAGAGATTGGATTAACACCATAGTAATACTTATTTTGTTCTTAACCATTTCAG
GGCTTCTTGAAATAGAGGCTGTATGGTGTAATGGAAAAAACAGCCTTGGAATCTGGGAGCCTGATTCCTGGATTCAGTCCCAGTTTTGCG
TGACCTTGGGCAAGTTACTTTACTTCTCTGAATTTCCGTTTCCTCCTCTGCAAAATGAGGATCGCAATAGCCACCTTGCAACCTTGACTG
GAGCGAGCCTCGCACACCCCGCGCCGGCCTGGAGGAAGAGCAGCCATGATTACGCCGCCTTCGCTCCGCTACCCGCTTGCGGCTGGCGCC
CTCCTCCAGCAGGTGTAGGCGCTGCCGCGCTGCCCCACGCCTTTCCGCCGCTCGCGGGCCTGCGCCTCGGCGTCCCCGAGGAGGCCGCTG
CGGGCTGAGGTAGCGCACCGGCCTCTCGGCGTCCCAGTCCGGTCCCGGGCGGAGGGAAAGCGGGCGACCCACCTCCGAGGCAGAAGCCGA
GGCCCGGCCCCGCCGAGTGCGGAGGAGCGCAGGCAGCCCCCGCCCCTCGGCCCTCCCCCCGGCCCTCCCGGCCCTCCCTCCGCCCCCTCC
GCCCTCGCGCGCCGCCCGCCCGGGTCGCCGCGGGGCCGTGGTGTACGTGCAGAGCGCGCAGAGCGAGTGGCGCCCGTATGCCCTGCGCTC
CTCCACAGCCTGGGCCGGGCCGCCCGGGACGCTGAGGCGGCGGCGGCGGCCGAGGGGGCCGGTCTTGCGCTCCCCAGGCCCGCGCGCCTG
AGCCCAGGTTGCCATTCGCCGCACAGGCCCTATTCTCTCAGCCCTCGGCGGCGATGAGGCGCTGAGGCGGCTGCCGGCGCTGCGCCGGAG
CTTAGGACTCGGAAGCGGCCGGGCCGAGGGCGTGGGGTGCCGGCCTCCCTGAGGCGAGGGTAGCGGGTGCATGGCGCAGTAACGGCCCCT
ATCTCTCTCCCCGCTCCCCAGCCTCGGGCGAGGCCGTCCGGCCGCTACCCCTCCTGCTCGGCCGCCGCAGTCGCCGTCGCCGCCGCCGCC
GCCGCCATGGCCAATGACAGCGGCGGGCCCGGCGGGCCGAGCCCGAGCGAGCGAGACCGGCAGTACTGCGAGCTGTGCGGGAAGATGGAG
AACCTGCTGCGCTGCAGCCGCTGCCGCAGCTCCTTCTACTGCTGCAAGGAGCACCAGCGTCAGGACTGGAAGAAGCACAAGCTCGTGTGC
CAGGGCAGCGAGGGCGCCCTCGGCCACGGAGTGGGCCCACACCAGCATTCCGGCCCCGCGCCGCCGGCTGCAGTGCCGCCGCCCAGGGCC
GGGGCCCGGGAGCCCAGGAAGGCAGCGGCGCGCCGGGACAACGCCTCCGGGGACGCGGCCAAGGGAAAAGTAAAGGCCAAGCCCCCGGCC
GACCCAGCGGCGGCCGCGTCGCCGTGTCGTGCGGCCGCCGGCGGCCAGGGCTCGGCGGTGGCTGCCGAAGCCGAGCCCGGCAAGGAGGAG
CCGCCGGCCCGCTCATCGCTGTTCCAGGAGAAGGCGAACCTGTACCCCCCAAGCAACACGCCCGGGGATGCGCTGAGCCCCGGCGGCGGC
CTGCGGCCCAACGGGCAGACGAAGCCCCTGCCGGCGCTGAAGCTGGCGCTCGAGTACATCGTGCCGTGCATGAACAAGCACGGCATCTGT
GTGGTGGACGACTTCCTCGGCAAGGAGACCGGACAGCAGATCGGCGACGAGGTGCGCGCCCTGCACGACACCGGGAAGTTCACGGACGGG
CAGCTGGTCAGCCAGAAGAGTGACTCGTCCAAGGACATCCGAGGCGATAAGATCACCTGGATCGAGGGCAAGGAGCCCGGCTGCGAAACC
ATTGGGCTGCTCATGAGCAGCATGGACGACCTGATACGCCACTGTAACGGGAAGCTGGGCAGCTACAAAATCAATGGCCGGACGAAATCC
ATCGACCCTGGACAGCAGTTCACGTGGGAGAATTCAAACCTGGAGGTGAACAAGCCCAAGAACCGCTATGCGAATGTCATCGCCTACGAC
CACTCTCGAGTCATCCTTACCTCTATCGATGGCGTCCCCGGGAGTGACTACATCAATGCCAACTACATCGATGGCTACCGCAAGCAGAAT
GCCTACATCGCCACGCAGGGCCCCCTGCCCGAGACCATGGGTGATTTCTGGAGGATGGTGTGGGAACAGCGCACGGCCACTGTGGTCATG
ATGACACGGCTGGAGGAGAAGTCCCGGGTAAAATGTGATCAGTACTGGCCAGCCCGTGGCACCGAGACCTGTGGCCTTATTCAGGTGACC
CTGTTGGACACAGTGGAGCTGGCCACATACACTGTGCGCACCTTCGCACTCCACAAGAGTGGCTCCAGTGAGAAGCGCGAGCTGCGTCAG
TTTCAGTTCATGGCCTGGCCAGACCATGGAGTTCCTGAGTACCCAACTCCCATCCTGGCCTTCCTACGACGGGTCAAGGCCTGCAACCCC
CTAGACGCAGGGCCCATGGTGGTGCACTGCAGCGCGGGCGTGGGCCGCACCGGCTGCTTCATCGTGATTGATGCCATGTTGGAGCGGATG
AAGCACGAGAAGACGGTGGACATCTATGGCCACGTGACCTGCATGCGATCACAGAGGAACTACATGGTGCAGACGGAGGACCAGTACGTG
TTCATCCATGAGGCGCTGCTGGAGGCTGCCACGTGCGGCCACACAGAGGTGCCTGCCCGCAACCTGTATGCCCACATCCAGAAGCTGGGC
CAAGTGCCTCCAGGGGAGAGTGTGACCGCCATGGAGCTCGAGTTCAAGTTGCTGGCCAGCTCCAAGGCCCACACGTCCCGCTTCATCAGC
GCCAACCTGCCCTGCAACAAGTTCAAGAACCGGCTGGTGAACATCATGCCCTACGAATTGACCCGTGTGTGTCTGCAGCCCATCCGTGGT
GTGGAGGGCTCTGACTACATCAATGCCAGCTTCCTGGATGGTTATAGACAGCAGAAGGCCTACATAGCTACACAGGGGCCTCTGGCAGAG
AGCACCGAGGACTTCTGGCGCATGCTATGGGAGCACAATTCCACCATCATCGTCATGCTGACCAAGCTTCGGGAGATGGGCAGGGAGAAA
TGCCACCAGTACTGGCCAGCAGAGCGCTCTGCTCGCTACCAGTACTTTGTTGTTGACCCGATGGCTGAGTACAACATGCCCCAGTATATC
CTGCGTGAGTTCAAGGTCACGGATGCCCGGGATGGGCAGTCAAGGACAATCCGGCAGTTCCAGTTCACAGACTGGCCAGAGCAGGGCGTG
CCCAAGACAGGCGAGGGATTCATTGACTTCATCGGGCAGGTGCATAAGACCAAGGAGCAGTTTGGACAGGATGGGCCTATCACGGTGCAC
TGCAGTGCTGGCGTGGGCCGCACCGGGGTGTTCATCACTCTGAGCATCGTCCTGGAGCGCATGCGCTACGAGGGCGTGGTCGACATGTTT
CAGACCGTGAAGACCCTGCGTACACAGCGTCCTGCCATGGTGCAGACAGAGGACCAGTATCAGCTGTGCTACCGTGCGGCCCTGGAGTAC
CTCGGCAGCTTTGACCACTATGCAACGTAACTACCGCTCCCCTCTCCTCCGCCACCCCCGCCGTGGGGCTCCGGAGGGGACCCAGCTCCT
CTGAGCCATACCGACCATCGTCCAGCCCTCCTACGCAGATGCTGTCACTGGCAGAGCACAGCCCACGGGGATCACAGCGTTTCAGGAACG
TTGCCACACCAATCAGAGAGCCTAGAACATCCCTGGGCAAGTGGATGGCCCAGCAGGCAGGCACTGTGGCCCTTCTGTCCACCAGACCCA
CCTGGAGCCCGCTTCAAGCTCTCTGTTGCGCTCCCGCATTTCTCATGCTTCTTCTCATGGGGTGGGGTTGGGGCAAAGCCTCCTTTTTAA

>In-frame_EGLN1_ENST00000366641_chr1_231556744_-_PTPRF_ENST00000372413_chr1_44083116_+_7369nt
TTAGGGGCAGAAAAACATTTGTAATAATTAATGGCTTTGAGAGACACAAGGCTTTGTTTGCCCCAGAGTATTAGTTAACCCACCTAGTGC
TCCTAATCATACAATATTAAGGATTGGGAGGGACATTCATTGCCTCACTCTCTATTTGTTTCACCTTCTGTAAAATTGGTAGAATAATAG
TACCCACTTCATAGCATTGTATGATGATTAAATTGGTTAATATTTTTAAAATGCTTAGAACACAGATTGGGCACATAACAGCAAGCACCA
CATGTGTTTATAAGATAAATTCCTTTGTGTTGCCTTCCGTTAAAGTTTAAATAAGTAAATAAATAAATAAATACTTGCATGACATTTTGA
AGTCTCTCTATAACATCTGAGTAAGTGGCGGCTGCGACAATGCTACTGGAGTTCCAGAATCGTGTTGGTGACAAGATTGTTCACCAGCAT
ATGGTGTGGTGAAAACTCACTAATTTGGAATTAGTTCAGATTATTAAGCCTGAATAGGTGAAAATCCTGAAATCAAGGATCTTTGGAACT
ATTTGAAATCAGTATTTTATATTTTCCTGTTGTATTCATTAAAGTGTTGCAAGTGTTCTATTTGATGGATTAAGTATATTTAGGATATAC
ATGTTCAATTTGTGATTTTGTATACTTAATTGGAACAAGAAAGCTAATAAAGGTTTTGATATGGACATCTATTCTTTTAAGTAAACTTCA
ATGAAAATATATGAGTAGAGCATATAGAGATGTAAATAATTTGTGGACACACCACAGACTGAAATAGCAAATTTAAAAGAAATTGTTGGA
AGAATCAAGTGTTTGTGGAATGAGTCCTCCTAGTAAAGTTCCTGCTCTTGTGAATAATTAAGCCTCATGTATAATTACTATAGCAAAAGG
AAGCCTAAGAAGTATTAGACTCTACTTGTATTTAAATTACATTTTACATAATTTATGTGTATGAAAAATGTTTTAAATGCTTATTTTCGT
AAGCCATGAGATAGCTCCTTTATATTTTAAGAATTTCTGAATTAATTTGCTTGGATTTTATTAGTGCAAATGGCAGAGCTAGCAATTCCT
TTTTCTGTGTTCCCATTCCATCCTATTCATCCCTCTTTTAGGAAACTCTGAACTCTGGATTGTCCTTGTTTACATACCTGCCTCCTGCAT
TGGACTATGTGTCTCTGAGTGTAGTATGACTAATTCATTTGTTTGTCAAGGACTCTCAATGCATTTGTTGAACAGCCTAATTAGTAATGT
CTGCAACAATGACATTTTACTGTATTTAATAAAGCTCTGGGAAAGTAGGATACACATAAGACAGGTCTAGGTCTAAATTCTTTACAGAAA
CTTGGATTTTTAGTTCGGTTTGAAATTTGAAGATGTGAGTATATTTATCTCAGTTTCCCAAAGGACAAGCTAATTGGAATTATCATCCTC
TTTCACTTGATTGGATCCCCAGAATGCCATTTACGCATGCAGCAGGATTTTATAACAGTTTTAAATTCTGTATATTTGATGAAGAGGTTT
TATATTTTTGGATTCAAGCCTCTTTTTAAACTTCTACAATATGGTTTACAATAATTCCTTATATCCTGCTTTTGAAATACATATTACAAC
TTTTTAAGTTTGGAAGGCTATATTTCAAGGACTGAAGTTACAGTATACTCAAGTGATACACAAGCCTAGCACCCCACTTTCCACATAGTG
TTCGATAAAGATTGATAAACTCGAAATCACAGACCTTTTAATTCTTAAGACAAATAGCAGCAGAAAGAAACATCTTTGGCTTATTTCTGG
TAAGGTTTTTATGCTCTGTAAAACAAAGAATTGTATTCATCCGCGCAGCACAGATTCTATTAAAAATAAATGTGAGAGTCGTTAATGTAG
TACTGCTCATTTACCATCAAAATTCACTTTTCAGGAATAATCCCATCAGTTTAAATTGGATATTGGAATGAGCATTGATTACATTTAACT
TGGTAGCCCAAAATTTCTTCATGGGGTTTTGAACTCGGCGGGATTTCAAAGGTTTTAAAAATGAGTTTTTGATTTTTTTTAAAACCCTCA
AATTTCATTACCTTTAAACTAGGTCGAAACGGGGCGCAAGAGATTGGATTAACACCATAGTAATACTTATTTTGTTCTTAACCATTTCAG
GGCTTCTTGAAATAGAGGCTGTATGGTGTAATGGAAAAAACAGCCTTGGAATCTGGGAGCCTGATTCCTGGATTCAGTCCCAGTTTTGCG
TGACCTTGGGCAAGTTACTTTACTTCTCTGAATTTCCGTTTCCTCCTCTGCAAAATGAGGATCGCAATAGCCACCTTGCAACCTTGACTG
GAGCGAGCCTCGCACACCCCGCGCCGGCCTGGAGGAAGAGCAGCCATGATTACGCCGCCTTCGCTCCGCTACCCGCTTGCGGCTGGCGCC
CTCCTCCAGCAGGTGTAGGCGCTGCCGCGCTGCCCCACGCCTTTCCGCCGCTCGCGGGCCTGCGCCTCGGCGTCCCCGAGGAGGCCGCTG
CGGGCTGAGGTAGCGCACCGGCCTCTCGGCGTCCCAGTCCGGTCCCGGGCGGAGGGAAAGCGGGCGACCCACCTCCGAGGCAGAAGCCGA
GGCCCGGCCCCGCCGAGTGCGGAGGAGCGCAGGCAGCCCCCGCCCCTCGGCCCTCCCCCCGGCCCTCCCGGCCCTCCCTCCGCCCCCTCC
GCCCTCGCGCGCCGCCCGCCCGGGTCGCCGCGGGGCCGTGGTGTACGTGCAGAGCGCGCAGAGCGAGTGGCGCCCGTATGCCCTGCGCTC
CTCCACAGCCTGGGCCGGGCCGCCCGGGACGCTGAGGCGGCGGCGGCGGCCGAGGGGGCCGGTCTTGCGCTCCCCAGGCCCGCGCGCCTG
AGCCCAGGTTGCCATTCGCCGCACAGGCCCTATTCTCTCAGCCCTCGGCGGCGATGAGGCGCTGAGGCGGCTGCCGGCGCTGCGCCGGAG
CTTAGGACTCGGAAGCGGCCGGGCCGAGGGCGTGGGGTGCCGGCCTCCCTGAGGCGAGGGTAGCGGGTGCATGGCGCAGTAACGGCCCCT
ATCTCTCTCCCCGCTCCCCAGCCTCGGGCGAGGCCGTCCGGCCGCTACCCCTCCTGCTCGGCCGCCGCAGTCGCCGTCGCCGCCGCCGCC
GCCGCCATGGCCAATGACAGCGGCGGGCCCGGCGGGCCGAGCCCGAGCGAGCGAGACCGGCAGTACTGCGAGCTGTGCGGGAAGATGGAG
AACCTGCTGCGCTGCAGCCGCTGCCGCAGCTCCTTCTACTGCTGCAAGGAGCACCAGCGTCAGGACTGGAAGAAGCACAAGCTCGTGTGC
CAGGGCAGCGAGGGCGCCCTCGGCCACGGAGTGGGCCCACACCAGCATTCCGGCCCCGCGCCGCCGGCTGCAGTGCCGCCGCCCAGGGCC
GGGGCCCGGGAGCCCAGGAAGGCAGCGGCGCGCCGGGACAACGCCTCCGGGGACGCGGCCAAGGGAAAAGTAAAGGCCAAGCCCCCGGCC
GACCCAGCGGCGGCCGCGTCGCCGTGTCGTGCGGCCGCCGGCGGCCAGGGCTCGGCGGTGGCTGCCGAAGCCGAGCCCGGCAAGGAGGAG
CCGCCGGCCCGCTCATCGCTGTTCCAGGAGAAGGCGAACCTGTACCCCCCAAGCAACACGCCCGGGGATGCGCTGAGCCCCGGCGGCGGC
CTGCGGCCCAACGGGCAGACGAAGCCCCTGCCGGCGCTGAAGCTGGCGCTCGAGTACATCGTGCCGTGCATGAACAAGCACGGCATCTGT
GTGGTGGACGACTTCCTCGGCAAGGAGACCGGACAGCAGATCGGCGACGAGGTGCGCGCCCTGCACGACACCGGGAAGTTCACGGACGGG
CAGCTGGTCAGCCAGAAGAGTGACTCGTCCAAGGACATCCGAGGCGATAAGATCACCTGGATCGAGGGCAAGGAGCCCGGCTGCGAAACC
ATTGGGCTGCTCATGAGCAGCATGGACGACCTGATACGCCACTGTAACGGGAAGCTGGGCAGCTACAAAATCAATGGCCGGACGAAATCC
ATCGACCCTGGACAGCAGTTCACGTGGGAGAATTCAAACCTGGAGGTGAACAAGCCCAAGAACCGCTATGCGAATGTCATCGCCTACGAC
CACTCTCGAGTCATCCTTACCTCTATCGATGGCGTCCCCGGGAGTGACTACATCAATGCCAACTACATCGATGGCTACCGCAAGCAGAAT
GCCTACATCGCCACGCAGGGCCCCCTGCCCGAGACCATGGGTGATTTCTGGAGGATGGTGTGGGAACAGCGCACGGCCACTGTGGTCATG
ATGACACGGCTGGAGGAGAAGTCCCGGGTAAAATGTGATCAGTACTGGCCAGCCCGTGGCACCGAGACCTGTGGCCTTATTCAGGTGACC
CTGTTGGACACAGTGGAGCTGGCCACATACACTGTGCGCACCTTCGCACTCCACAAGAGTGGCTCCAGTGAGAAGCGCGAGCTGCGTCAG
TTTCAGTTCATGGCCTGGCCAGACCATGGAGTTCCTGAGTACCCAACTCCCATCCTGGCCTTCCTACGACGGGTCAAGGCCTGCAACCCC
CTAGACGCAGGGCCCATGGTGGTGCACTGCAGCGCGGGCGTGGGCCGCACCGGCTGCTTCATCGTGATTGATGCCATGTTGGAGCGGATG
AAGCACGAGAAGACGGTGGACATCTATGGCCACGTGACCTGCATGCGATCACAGAGGAACTACATGGTGCAGACGGAGGACCAGTACGTG
TTCATCCATGAGGCGCTGCTGGAGGCTGCCACGTGCGGCCACACAGAGGTGCCTGCCCGCAACCTGTATGCCCACATCCAGAAGCTGGGC
CAAGTGCCTCCAGGGGAGAGTGTGACCGCCATGGAGCTCGAGTTCAAGTTGCTGGCCAGCTCCAAGGCCCACACGTCCCGCTTCATCAGC
GCCAACCTGCCCTGCAACAAGTTCAAGAACCGGCTGGTGAACATCATGCCCTACGAATTGACCCGTGTGTGTCTGCAGCCCATCCGTGGT
GTGGAGGGCTCTGACTACATCAATGCCAGCTTCCTGGATGGTTATAGACAGCAGAAGGCCTACATAGCTACACAGGGGCCTCTGGCAGAG
AGCACCGAGGACTTCTGGCGCATGCTATGGGAGCACAATTCCACCATCATCGTCATGCTGACCAAGCTTCGGGAGATGGGCAGGGAGAAA
TGCCACCAGTACTGGCCAGCAGAGCGCTCTGCTCGCTACCAGTACTTTGTTGTTGACCCGATGGCTGAGTACAACATGCCCCAGTATATC
CTGCGTGAGTTCAAGGTCACGGATGCCCGGGATGGGCAGTCAAGGACAATCCGGCAGTTCCAGTTCACAGACTGGCCAGAGCAGGGCGTG
CCCAAGACAGGCGAGGGATTCATTGACTTCATCGGGCAGGTGCATAAGACCAAGGAGCAGTTTGGACAGGATGGGCCTATCACGGTGCAC
TGCAGTGCTGGCGTGGGCCGCACCGGGGTGTTCATCACTCTGAGCATCGTCCTGGAGCGCATGCGCTACGAGGGCGTGGTCGACATGTTT
CAGACCGTGAAGACCCTGCGTACACAGCGTCCTGCCATGGTGCAGACAGAGGACCAGTATCAGCTGTGCTACCGTGCGGCCCTGGAGTAC
CTCGGCAGCTTTGACCACTATGCAACGTAACTACCGCTCCCCTCTCCTCCGCCACCCCCGCCGTGGGGCTCCGGAGGGGACCCAGCTCCT
CTGAGCCATACCGACCATCGTCCAGCCCTCCTACGCAGATGCTGTCACTGGCAGAGCACAGCCCACGGGGATCACAGCGTTTCAGGAACG
TTGCCACACCAATCAGAGAGCCTAGAACATCCCTGGGCAAGTGGATGGCCCAGCAGGCAGGCACTGTGGCCCTTCTGTCCACCAGACCCA
CCTGGAGCCCGCTTCAAGCTCTCTGTTGCGCTCCCGCATTTCTCATGCTTCTTCTCATGGGGTGGGGTTGGGGCAAAGCCTCCTTTTTAA
TACATTAAGTGGGGTAGACTGAGGGATTTTAGCCTCTTCCCTCTGATTTTTCCTTTCGCGAATCCGTATCTGCAGAATGGGCCACTGTAG
GGGTTGGGGTTTATTTTGTTTTGTTTTTTTTTTTCTTGAGTTCACTTTGGATCCTTATTTTGTATGACTTCTGCTGAAGGACAGAACATT
GCCTTCCTCGTGCAGAGCTGGGGCTGCCAGCCTGAGCGGAGGCTCGGCCGTGGGCCGGGAGGCAGTGCTGATCCGGCTGCTCCTCCAGCC
CTTCAGACGAGATCCTGTTTCAGCTAAATGCAGGGAAACTCAATGTTTTTTTAAGTTTTGTTTTCCCTTTAAAGCCTTTTTTTAGGCCAC
ATTGACAGTGGTGGGCGGGGAGAAGATAGGGAACACTCATCCCTGGTCGTCTATCCCAGTGTGTGTTTAACATTCACAGCCCAGAACCAC
AGATGTGTCTGGGAGAGCCTGGCAAGGCATTCCTCATCACCATCGTGTTTGCAAAGGTTAAAACAAAAACAAAAAACCACAAAAATAAAA
AACAAAAAAAACAAAAAACCCAAGAAAAAAAAAAAGAGTCAGCCCTTGGCTTCTGCTTCAAACCCTCAAGAGGGGAAGCAACTCCGTGTG
CCTGGGGTTCCCGAGGGAGCTGCTGGCTGACCTGGGCCCACAGAGCCTGGCTTTGGTCCCCAGCATTGCAGTATGGTGTGGTGTTTGTAG
GCTGTGGGGTCTGGCTGTGTGGCCAAGGTGAATAGCACAGGTTAGGGTGTGTGCCACACCCCATGCACCTCAGGGCCAAGCGGGGGCGTG
GCTGGCCTTTCAGGTCCAGGCCAGTGGGCCTGGTAGCACATGTCTGTCCTCAGAGCAGGGGCCAGATGATTTTCCTCCCTGGTTTGCAGC
TGTTTTCAAAGCCCCCGATAATCGCTCTTTTCCACTCCAAGATGCCCTCATAAACCAATGTGGCAAGACTACTGGACTTCTATCAATGGT
ACTCTAATCAGTCCTTATTATCCCAGCTTGCTGAGGGGCAGGGAGAGCGCCTCTTCCTCTGGGCAGCGCTATCTAGATAGGTAAGTGGGG
GCGGGGAAGGGTGCATAGCTGTTTTAGCTGAGGGACGTGGTGCCGACGTCCCCAAACCTAGCTAGGCTAAGTCAAGATCAACATTCCAGG
GTTGGTAATGTTGGATGATGAAACATTCATTTTTACCTTGTGGATGCTAGTGCTGTAGAGTTCACTGTTGTACACAGTCTGTTTTCTATT

>In-frame_EGLN1_ENST00000366641_chr1_231556744_-_PTPRF_ENST00000372414_chr1_44083116_+_7369nt
TTAGGGGCAGAAAAACATTTGTAATAATTAATGGCTTTGAGAGACACAAGGCTTTGTTTGCCCCAGAGTATTAGTTAACCCACCTAGTGC
TCCTAATCATACAATATTAAGGATTGGGAGGGACATTCATTGCCTCACTCTCTATTTGTTTCACCTTCTGTAAAATTGGTAGAATAATAG
TACCCACTTCATAGCATTGTATGATGATTAAATTGGTTAATATTTTTAAAATGCTTAGAACACAGATTGGGCACATAACAGCAAGCACCA
CATGTGTTTATAAGATAAATTCCTTTGTGTTGCCTTCCGTTAAAGTTTAAATAAGTAAATAAATAAATAAATACTTGCATGACATTTTGA
AGTCTCTCTATAACATCTGAGTAAGTGGCGGCTGCGACAATGCTACTGGAGTTCCAGAATCGTGTTGGTGACAAGATTGTTCACCAGCAT
ATGGTGTGGTGAAAACTCACTAATTTGGAATTAGTTCAGATTATTAAGCCTGAATAGGTGAAAATCCTGAAATCAAGGATCTTTGGAACT
ATTTGAAATCAGTATTTTATATTTTCCTGTTGTATTCATTAAAGTGTTGCAAGTGTTCTATTTGATGGATTAAGTATATTTAGGATATAC
ATGTTCAATTTGTGATTTTGTATACTTAATTGGAACAAGAAAGCTAATAAAGGTTTTGATATGGACATCTATTCTTTTAAGTAAACTTCA
ATGAAAATATATGAGTAGAGCATATAGAGATGTAAATAATTTGTGGACACACCACAGACTGAAATAGCAAATTTAAAAGAAATTGTTGGA
AGAATCAAGTGTTTGTGGAATGAGTCCTCCTAGTAAAGTTCCTGCTCTTGTGAATAATTAAGCCTCATGTATAATTACTATAGCAAAAGG
AAGCCTAAGAAGTATTAGACTCTACTTGTATTTAAATTACATTTTACATAATTTATGTGTATGAAAAATGTTTTAAATGCTTATTTTCGT
AAGCCATGAGATAGCTCCTTTATATTTTAAGAATTTCTGAATTAATTTGCTTGGATTTTATTAGTGCAAATGGCAGAGCTAGCAATTCCT
TTTTCTGTGTTCCCATTCCATCCTATTCATCCCTCTTTTAGGAAACTCTGAACTCTGGATTGTCCTTGTTTACATACCTGCCTCCTGCAT
TGGACTATGTGTCTCTGAGTGTAGTATGACTAATTCATTTGTTTGTCAAGGACTCTCAATGCATTTGTTGAACAGCCTAATTAGTAATGT
CTGCAACAATGACATTTTACTGTATTTAATAAAGCTCTGGGAAAGTAGGATACACATAAGACAGGTCTAGGTCTAAATTCTTTACAGAAA
CTTGGATTTTTAGTTCGGTTTGAAATTTGAAGATGTGAGTATATTTATCTCAGTTTCCCAAAGGACAAGCTAATTGGAATTATCATCCTC
TTTCACTTGATTGGATCCCCAGAATGCCATTTACGCATGCAGCAGGATTTTATAACAGTTTTAAATTCTGTATATTTGATGAAGAGGTTT
TATATTTTTGGATTCAAGCCTCTTTTTAAACTTCTACAATATGGTTTACAATAATTCCTTATATCCTGCTTTTGAAATACATATTACAAC
TTTTTAAGTTTGGAAGGCTATATTTCAAGGACTGAAGTTACAGTATACTCAAGTGATACACAAGCCTAGCACCCCACTTTCCACATAGTG
TTCGATAAAGATTGATAAACTCGAAATCACAGACCTTTTAATTCTTAAGACAAATAGCAGCAGAAAGAAACATCTTTGGCTTATTTCTGG
TAAGGTTTTTATGCTCTGTAAAACAAAGAATTGTATTCATCCGCGCAGCACAGATTCTATTAAAAATAAATGTGAGAGTCGTTAATGTAG
TACTGCTCATTTACCATCAAAATTCACTTTTCAGGAATAATCCCATCAGTTTAAATTGGATATTGGAATGAGCATTGATTACATTTAACT
TGGTAGCCCAAAATTTCTTCATGGGGTTTTGAACTCGGCGGGATTTCAAAGGTTTTAAAAATGAGTTTTTGATTTTTTTTAAAACCCTCA
AATTTCATTACCTTTAAACTAGGTCGAAACGGGGCGCAAGAGATTGGATTAACACCATAGTAATACTTATTTTGTTCTTAACCATTTCAG
GGCTTCTTGAAATAGAGGCTGTATGGTGTAATGGAAAAAACAGCCTTGGAATCTGGGAGCCTGATTCCTGGATTCAGTCCCAGTTTTGCG
TGACCTTGGGCAAGTTACTTTACTTCTCTGAATTTCCGTTTCCTCCTCTGCAAAATGAGGATCGCAATAGCCACCTTGCAACCTTGACTG
GAGCGAGCCTCGCACACCCCGCGCCGGCCTGGAGGAAGAGCAGCCATGATTACGCCGCCTTCGCTCCGCTACCCGCTTGCGGCTGGCGCC
CTCCTCCAGCAGGTGTAGGCGCTGCCGCGCTGCCCCACGCCTTTCCGCCGCTCGCGGGCCTGCGCCTCGGCGTCCCCGAGGAGGCCGCTG
CGGGCTGAGGTAGCGCACCGGCCTCTCGGCGTCCCAGTCCGGTCCCGGGCGGAGGGAAAGCGGGCGACCCACCTCCGAGGCAGAAGCCGA
GGCCCGGCCCCGCCGAGTGCGGAGGAGCGCAGGCAGCCCCCGCCCCTCGGCCCTCCCCCCGGCCCTCCCGGCCCTCCCTCCGCCCCCTCC
GCCCTCGCGCGCCGCCCGCCCGGGTCGCCGCGGGGCCGTGGTGTACGTGCAGAGCGCGCAGAGCGAGTGGCGCCCGTATGCCCTGCGCTC
CTCCACAGCCTGGGCCGGGCCGCCCGGGACGCTGAGGCGGCGGCGGCGGCCGAGGGGGCCGGTCTTGCGCTCCCCAGGCCCGCGCGCCTG
AGCCCAGGTTGCCATTCGCCGCACAGGCCCTATTCTCTCAGCCCTCGGCGGCGATGAGGCGCTGAGGCGGCTGCCGGCGCTGCGCCGGAG
CTTAGGACTCGGAAGCGGCCGGGCCGAGGGCGTGGGGTGCCGGCCTCCCTGAGGCGAGGGTAGCGGGTGCATGGCGCAGTAACGGCCCCT
ATCTCTCTCCCCGCTCCCCAGCCTCGGGCGAGGCCGTCCGGCCGCTACCCCTCCTGCTCGGCCGCCGCAGTCGCCGTCGCCGCCGCCGCC
GCCGCCATGGCCAATGACAGCGGCGGGCCCGGCGGGCCGAGCCCGAGCGAGCGAGACCGGCAGTACTGCGAGCTGTGCGGGAAGATGGAG
AACCTGCTGCGCTGCAGCCGCTGCCGCAGCTCCTTCTACTGCTGCAAGGAGCACCAGCGTCAGGACTGGAAGAAGCACAAGCTCGTGTGC
CAGGGCAGCGAGGGCGCCCTCGGCCACGGAGTGGGCCCACACCAGCATTCCGGCCCCGCGCCGCCGGCTGCAGTGCCGCCGCCCAGGGCC
GGGGCCCGGGAGCCCAGGAAGGCAGCGGCGCGCCGGGACAACGCCTCCGGGGACGCGGCCAAGGGAAAAGTAAAGGCCAAGCCCCCGGCC
GACCCAGCGGCGGCCGCGTCGCCGTGTCGTGCGGCCGCCGGCGGCCAGGGCTCGGCGGTGGCTGCCGAAGCCGAGCCCGGCAAGGAGGAG
CCGCCGGCCCGCTCATCGCTGTTCCAGGAGAAGGCGAACCTGTACCCCCCAAGCAACACGCCCGGGGATGCGCTGAGCCCCGGCGGCGGC
CTGCGGCCCAACGGGCAGACGAAGCCCCTGCCGGCGCTGAAGCTGGCGCTCGAGTACATCGTGCCGTGCATGAACAAGCACGGCATCTGT
GTGGTGGACGACTTCCTCGGCAAGGAGACCGGACAGCAGATCGGCGACGAGGTGCGCGCCCTGCACGACACCGGGAAGTTCACGGACGGG
CAGCTGGTCAGCCAGAAGAGTGACTCGTCCAAGGACATCCGAGGCGATAAGATCACCTGGATCGAGGGCAAGGAGCCCGGCTGCGAAACC
ATTGGGCTGCTCATGAGCAGCATGGACGACCTGATACGCCACTGTAACGGGAAGCTGGGCAGCTACAAAATCAATGGCCGGACGAAATCC
ATCGACCCTGGACAGCAGTTCACGTGGGAGAATTCAAACCTGGAGGTGAACAAGCCCAAGAACCGCTATGCGAATGTCATCGCCTACGAC
CACTCTCGAGTCATCCTTACCTCTATCGATGGCGTCCCCGGGAGTGACTACATCAATGCCAACTACATCGATGGCTACCGCAAGCAGAAT
GCCTACATCGCCACGCAGGGCCCCCTGCCCGAGACCATGGGTGATTTCTGGAGGATGGTGTGGGAACAGCGCACGGCCACTGTGGTCATG
ATGACACGGCTGGAGGAGAAGTCCCGGGTAAAATGTGATCAGTACTGGCCAGCCCGTGGCACCGAGACCTGTGGCCTTATTCAGGTGACC
CTGTTGGACACAGTGGAGCTGGCCACATACACTGTGCGCACCTTCGCACTCCACAAGAGTGGCTCCAGTGAGAAGCGCGAGCTGCGTCAG
TTTCAGTTCATGGCCTGGCCAGACCATGGAGTTCCTGAGTACCCAACTCCCATCCTGGCCTTCCTACGACGGGTCAAGGCCTGCAACCCC
CTAGACGCAGGGCCCATGGTGGTGCACTGCAGCGCGGGCGTGGGCCGCACCGGCTGCTTCATCGTGATTGATGCCATGTTGGAGCGGATG
AAGCACGAGAAGACGGTGGACATCTATGGCCACGTGACCTGCATGCGATCACAGAGGAACTACATGGTGCAGACGGAGGACCAGTACGTG
TTCATCCATGAGGCGCTGCTGGAGGCTGCCACGTGCGGCCACACAGAGGTGCCTGCCCGCAACCTGTATGCCCACATCCAGAAGCTGGGC
CAAGTGCCTCCAGGGGAGAGTGTGACCGCCATGGAGCTCGAGTTCAAGTTGCTGGCCAGCTCCAAGGCCCACACGTCCCGCTTCATCAGC
GCCAACCTGCCCTGCAACAAGTTCAAGAACCGGCTGGTGAACATCATGCCCTACGAATTGACCCGTGTGTGTCTGCAGCCCATCCGTGGT
GTGGAGGGCTCTGACTACATCAATGCCAGCTTCCTGGATGGTTATAGACAGCAGAAGGCCTACATAGCTACACAGGGGCCTCTGGCAGAG
AGCACCGAGGACTTCTGGCGCATGCTATGGGAGCACAATTCCACCATCATCGTCATGCTGACCAAGCTTCGGGAGATGGGCAGGGAGAAA
TGCCACCAGTACTGGCCAGCAGAGCGCTCTGCTCGCTACCAGTACTTTGTTGTTGACCCGATGGCTGAGTACAACATGCCCCAGTATATC
CTGCGTGAGTTCAAGGTCACGGATGCCCGGGATGGGCAGTCAAGGACAATCCGGCAGTTCCAGTTCACAGACTGGCCAGAGCAGGGCGTG
CCCAAGACAGGCGAGGGATTCATTGACTTCATCGGGCAGGTGCATAAGACCAAGGAGCAGTTTGGACAGGATGGGCCTATCACGGTGCAC
TGCAGTGCTGGCGTGGGCCGCACCGGGGTGTTCATCACTCTGAGCATCGTCCTGGAGCGCATGCGCTACGAGGGCGTGGTCGACATGTTT
CAGACCGTGAAGACCCTGCGTACACAGCGTCCTGCCATGGTGCAGACAGAGGACCAGTATCAGCTGTGCTACCGTGCGGCCCTGGAGTAC
CTCGGCAGCTTTGACCACTATGCAACGTAACTACCGCTCCCCTCTCCTCCGCCACCCCCGCCGTGGGGCTCCGGAGGGGACCCAGCTCCT
CTGAGCCATACCGACCATCGTCCAGCCCTCCTACGCAGATGCTGTCACTGGCAGAGCACAGCCCACGGGGATCACAGCGTTTCAGGAACG
TTGCCACACCAATCAGAGAGCCTAGAACATCCCTGGGCAAGTGGATGGCCCAGCAGGCAGGCACTGTGGCCCTTCTGTCCACCAGACCCA
CCTGGAGCCCGCTTCAAGCTCTCTGTTGCGCTCCCGCATTTCTCATGCTTCTTCTCATGGGGTGGGGTTGGGGCAAAGCCTCCTTTTTAA
TACATTAAGTGGGGTAGACTGAGGGATTTTAGCCTCTTCCCTCTGATTTTTCCTTTCGCGAATCCGTATCTGCAGAATGGGCCACTGTAG
GGGTTGGGGTTTATTTTGTTTTGTTTTTTTTTTTCTTGAGTTCACTTTGGATCCTTATTTTGTATGACTTCTGCTGAAGGACAGAACATT
GCCTTCCTCGTGCAGAGCTGGGGCTGCCAGCCTGAGCGGAGGCTCGGCCGTGGGCCGGGAGGCAGTGCTGATCCGGCTGCTCCTCCAGCC
CTTCAGACGAGATCCTGTTTCAGCTAAATGCAGGGAAACTCAATGTTTTTTTAAGTTTTGTTTTCCCTTTAAAGCCTTTTTTTAGGCCAC
ATTGACAGTGGTGGGCGGGGAGAAGATAGGGAACACTCATCCCTGGTCGTCTATCCCAGTGTGTGTTTAACATTCACAGCCCAGAACCAC
AGATGTGTCTGGGAGAGCCTGGCAAGGCATTCCTCATCACCATCGTGTTTGCAAAGGTTAAAACAAAAACAAAAAACCACAAAAATAAAA
AACAAAAAAAACAAAAAACCCAAGAAAAAAAAAAAGAGTCAGCCCTTGGCTTCTGCTTCAAACCCTCAAGAGGGGAAGCAACTCCGTGTG
CCTGGGGTTCCCGAGGGAGCTGCTGGCTGACCTGGGCCCACAGAGCCTGGCTTTGGTCCCCAGCATTGCAGTATGGTGTGGTGTTTGTAG
GCTGTGGGGTCTGGCTGTGTGGCCAAGGTGAATAGCACAGGTTAGGGTGTGTGCCACACCCCATGCACCTCAGGGCCAAGCGGGGGCGTG
GCTGGCCTTTCAGGTCCAGGCCAGTGGGCCTGGTAGCACATGTCTGTCCTCAGAGCAGGGGCCAGATGATTTTCCTCCCTGGTTTGCAGC
TGTTTTCAAAGCCCCCGATAATCGCTCTTTTCCACTCCAAGATGCCCTCATAAACCAATGTGGCAAGACTACTGGACTTCTATCAATGGT
ACTCTAATCAGTCCTTATTATCCCAGCTTGCTGAGGGGCAGGGAGAGCGCCTCTTCCTCTGGGCAGCGCTATCTAGATAGGTAAGTGGGG
GCGGGGAAGGGTGCATAGCTGTTTTAGCTGAGGGACGTGGTGCCGACGTCCCCAAACCTAGCTAGGCTAAGTCAAGATCAACATTCCAGG
GTTGGTAATGTTGGATGATGAAACATTCATTTTTACCTTGTGGATGCTAGTGCTGTAGAGTTCACTGTTGTACACAGTCTGTTTTCTATT

>In-frame_EGLN1_ENST00000366641_chr1_231556744_-_PTPRF_ENST00000422171_chr1_44083116_+_6539nt
TTAGGGGCAGAAAAACATTTGTAATAATTAATGGCTTTGAGAGACACAAGGCTTTGTTTGCCCCAGAGTATTAGTTAACCCACCTAGTGC
TCCTAATCATACAATATTAAGGATTGGGAGGGACATTCATTGCCTCACTCTCTATTTGTTTCACCTTCTGTAAAATTGGTAGAATAATAG
TACCCACTTCATAGCATTGTATGATGATTAAATTGGTTAATATTTTTAAAATGCTTAGAACACAGATTGGGCACATAACAGCAAGCACCA
CATGTGTTTATAAGATAAATTCCTTTGTGTTGCCTTCCGTTAAAGTTTAAATAAGTAAATAAATAAATAAATACTTGCATGACATTTTGA
AGTCTCTCTATAACATCTGAGTAAGTGGCGGCTGCGACAATGCTACTGGAGTTCCAGAATCGTGTTGGTGACAAGATTGTTCACCAGCAT
ATGGTGTGGTGAAAACTCACTAATTTGGAATTAGTTCAGATTATTAAGCCTGAATAGGTGAAAATCCTGAAATCAAGGATCTTTGGAACT
ATTTGAAATCAGTATTTTATATTTTCCTGTTGTATTCATTAAAGTGTTGCAAGTGTTCTATTTGATGGATTAAGTATATTTAGGATATAC
ATGTTCAATTTGTGATTTTGTATACTTAATTGGAACAAGAAAGCTAATAAAGGTTTTGATATGGACATCTATTCTTTTAAGTAAACTTCA
ATGAAAATATATGAGTAGAGCATATAGAGATGTAAATAATTTGTGGACACACCACAGACTGAAATAGCAAATTTAAAAGAAATTGTTGGA
AGAATCAAGTGTTTGTGGAATGAGTCCTCCTAGTAAAGTTCCTGCTCTTGTGAATAATTAAGCCTCATGTATAATTACTATAGCAAAAGG
AAGCCTAAGAAGTATTAGACTCTACTTGTATTTAAATTACATTTTACATAATTTATGTGTATGAAAAATGTTTTAAATGCTTATTTTCGT
AAGCCATGAGATAGCTCCTTTATATTTTAAGAATTTCTGAATTAATTTGCTTGGATTTTATTAGTGCAAATGGCAGAGCTAGCAATTCCT
TTTTCTGTGTTCCCATTCCATCCTATTCATCCCTCTTTTAGGAAACTCTGAACTCTGGATTGTCCTTGTTTACATACCTGCCTCCTGCAT
TGGACTATGTGTCTCTGAGTGTAGTATGACTAATTCATTTGTTTGTCAAGGACTCTCAATGCATTTGTTGAACAGCCTAATTAGTAATGT
CTGCAACAATGACATTTTACTGTATTTAATAAAGCTCTGGGAAAGTAGGATACACATAAGACAGGTCTAGGTCTAAATTCTTTACAGAAA
CTTGGATTTTTAGTTCGGTTTGAAATTTGAAGATGTGAGTATATTTATCTCAGTTTCCCAAAGGACAAGCTAATTGGAATTATCATCCTC
TTTCACTTGATTGGATCCCCAGAATGCCATTTACGCATGCAGCAGGATTTTATAACAGTTTTAAATTCTGTATATTTGATGAAGAGGTTT
TATATTTTTGGATTCAAGCCTCTTTTTAAACTTCTACAATATGGTTTACAATAATTCCTTATATCCTGCTTTTGAAATACATATTACAAC
TTTTTAAGTTTGGAAGGCTATATTTCAAGGACTGAAGTTACAGTATACTCAAGTGATACACAAGCCTAGCACCCCACTTTCCACATAGTG
TTCGATAAAGATTGATAAACTCGAAATCACAGACCTTTTAATTCTTAAGACAAATAGCAGCAGAAAGAAACATCTTTGGCTTATTTCTGG
TAAGGTTTTTATGCTCTGTAAAACAAAGAATTGTATTCATCCGCGCAGCACAGATTCTATTAAAAATAAATGTGAGAGTCGTTAATGTAG
TACTGCTCATTTACCATCAAAATTCACTTTTCAGGAATAATCCCATCAGTTTAAATTGGATATTGGAATGAGCATTGATTACATTTAACT
TGGTAGCCCAAAATTTCTTCATGGGGTTTTGAACTCGGCGGGATTTCAAAGGTTTTAAAAATGAGTTTTTGATTTTTTTTAAAACCCTCA
AATTTCATTACCTTTAAACTAGGTCGAAACGGGGCGCAAGAGATTGGATTAACACCATAGTAATACTTATTTTGTTCTTAACCATTTCAG
GGCTTCTTGAAATAGAGGCTGTATGGTGTAATGGAAAAAACAGCCTTGGAATCTGGGAGCCTGATTCCTGGATTCAGTCCCAGTTTTGCG
TGACCTTGGGCAAGTTACTTTACTTCTCTGAATTTCCGTTTCCTCCTCTGCAAAATGAGGATCGCAATAGCCACCTTGCAACCTTGACTG
GAGCGAGCCTCGCACACCCCGCGCCGGCCTGGAGGAAGAGCAGCCATGATTACGCCGCCTTCGCTCCGCTACCCGCTTGCGGCTGGCGCC
CTCCTCCAGCAGGTGTAGGCGCTGCCGCGCTGCCCCACGCCTTTCCGCCGCTCGCGGGCCTGCGCCTCGGCGTCCCCGAGGAGGCCGCTG
CGGGCTGAGGTAGCGCACCGGCCTCTCGGCGTCCCAGTCCGGTCCCGGGCGGAGGGAAAGCGGGCGACCCACCTCCGAGGCAGAAGCCGA
GGCCCGGCCCCGCCGAGTGCGGAGGAGCGCAGGCAGCCCCCGCCCCTCGGCCCTCCCCCCGGCCCTCCCGGCCCTCCCTCCGCCCCCTCC
GCCCTCGCGCGCCGCCCGCCCGGGTCGCCGCGGGGCCGTGGTGTACGTGCAGAGCGCGCAGAGCGAGTGGCGCCCGTATGCCCTGCGCTC
CTCCACAGCCTGGGCCGGGCCGCCCGGGACGCTGAGGCGGCGGCGGCGGCCGAGGGGGCCGGTCTTGCGCTCCCCAGGCCCGCGCGCCTG
AGCCCAGGTTGCCATTCGCCGCACAGGCCCTATTCTCTCAGCCCTCGGCGGCGATGAGGCGCTGAGGCGGCTGCCGGCGCTGCGCCGGAG
CTTAGGACTCGGAAGCGGCCGGGCCGAGGGCGTGGGGTGCCGGCCTCCCTGAGGCGAGGGTAGCGGGTGCATGGCGCAGTAACGGCCCCT
ATCTCTCTCCCCGCTCCCCAGCCTCGGGCGAGGCCGTCCGGCCGCTACCCCTCCTGCTCGGCCGCCGCAGTCGCCGTCGCCGCCGCCGCC
GCCGCCATGGCCAATGACAGCGGCGGGCCCGGCGGGCCGAGCCCGAGCGAGCGAGACCGGCAGTACTGCGAGCTGTGCGGGAAGATGGAG
AACCTGCTGCGCTGCAGCCGCTGCCGCAGCTCCTTCTACTGCTGCAAGGAGCACCAGCGTCAGGACTGGAAGAAGCACAAGCTCGTGTGC
CAGGGCAGCGAGGGCGCCCTCGGCCACGGAGTGGGCCCACACCAGCATTCCGGCCCCGCGCCGCCGGCTGCAGTGCCGCCGCCCAGGGCC
GGGGCCCGGGAGCCCAGGAAGGCAGCGGCGCGCCGGGACAACGCCTCCGGGGACGCGGCCAAGGGAAAAGTAAAGGCCAAGCCCCCGGCC
GACCCAGCGGCGGCCGCGTCGCCGTGTCGTGCGGCCGCCGGCGGCCAGGGCTCGGCGGTGGCTGCCGAAGCCGAGCCCGGCAAGGAGGAG
CCGCCGGCCCGCTCATCGCTGTTCCAGGAGAAGGCGAACCTGTACCCCCCAAGCAACACGCCCGGGGATGCGCTGAGCCCCGGCGGCGGC
CTGCGGCCCAACGGGCAGACGAAGCCCCTGCCGGCGCTGAAGCTGGCGCTCGAGTACATCGTGCCGTGCATGAACAAGCACGGCATCTGT
GTGGTGGACGACTTCCTCGGCAAGGAGACCGGACAGCAGATCGGCGACGAGGTGCGCGCCCTGCACGACACCGGGAAGTTCACGGACGGG
CAGCTGGTCAGCCAGAAGAGTGACTCGTCCAAGGACATCCGAGGCGATAAGATCACCTGGATCGAGGGCAAGGAGCCCGGCTGCGAAACC
ATTGGGCTGCTCATGAGCAGCATGGACGACCTGATACGCCACTGTAACGGGAAGCTGGGCAGCTACAAAATCAATGGCCGGACGAAATCC
ATCGACCCTGGACAGCAGTTCACGTGGGAGAATTCAAACCTGGAGGTGAACAAGCCCAAGAACCGCTATGCGAATGTCATCGCCTACGAC
CACTCTCGAGTCATCCTTACCTCTATCGATGGCGTCCCCGGGAGTGACTACATCAATGCCAACTACATCGATGGCTACCGCAAGCAGAAT
GCCTACATCGCCACGCAGGGCCCCCTGCCCGAGACCATGGGTGATTTCTGGAGGATGGTGTGGGAACAGCGCACGGCCACTGTGGTCATG
ATGACACGGCTGGAGGAGAAGTCCCGGGTAAAATGTGATCAGTACTGGCCAGCCCGTGGCACCGAGACCTGTGGCCTTATTCAGGTGACC
CTGTTGGACACAGTGGAGCTGGCCACATACACTGTGCGCACCTTCGCACTCCACAAGAGTGGCTCCAGTGAGAAGCGCGAGCTGCGTCAG
TTTCAGTTCATGGCCTGGCCAGACCATGGAGTTCCTGAGTACCCAACTCCCATCCTGGCCTTCCTACGACGGGTCAAGGCCTGCAACCCC
CTAGACGCAGGGCCCATGGTGGTGCACTGCAGCGCGGGCGTGGGCCGCACCGGCTGCTTCATCGTGATTGATGCCATGTTGGAGCGGATG
AAGCACGAGAAGACGGTGGACATCTATGGCCACGTGACCTGCATGCGATCACAGAGGAACTACATGGTGCAGACGGAGGACCAGTACGTG
TTCATCCATGAGGCGCTGCTGGAGGCTGCCACGTGCGGCCACACAGAGGTGCCTGCCCGCAACCTGTATGCCCACATCCAGAAGCTGGGC
CAAGTGCCTCCAGGGGAGAGTGTGACCGCCATGGAGCTCGAGTTCAAGTTGCTGGCCAGCTCCAAGGCCCACACGTCCCGCTTCATCAGC
GCCAACCTGCCCTGCAACAAGTTCAAGAACCGGCTGGTGAACATCATGCCCTACGAATTGACCCGTGTGTGTCTGCAGCCCATCCGTGGT
GTGGAGGGCTCTGACTACATCAATGCCAGCTTCCTGGATGGTTATAGACAGCAGAAGGCCTACATAGCTACACAGGGGCCTCTGGCAGAG
AGCACCGAGGACTTCTGGCGCATGCTATGGGAGCACAATTCCACCATCATCGTCATGCTGACCAAGCTTCGGGAGATGGGCAGGGAGAAA
TGCCACCAGTACTGGCCAGCAGAGCGCTCTGCTCGCTACCAGTACTTTGTTGTTGACCCGATGGCTGAGTACAACATGCCCCAGTATATC
CTGCGTGAGTTCAAGGTCACGGATGCCCGGGATGGGCAGTCAAGGACAATCCGGCAGTTCCAGTTCACAGACTGGCCAGAGCAGGGCGTG
CCCAAGACAGGCGAGGGATTCATTGACTTCATCGGGCAGGTGCATAAGACCAAGGAGCAGTTTGGACAGGATGGGCCTATCACGGTGCAC
TGCAGTGCTGGCGTGGGCCGCACCGGGGTGTTCATCACTCTGAGCATCGTCCTGGAGCGCATGCGCTACGAGGGCGTGGTCGACATGTTT
CAGACCGTGAAGACCCTGCGTACACAGCGTCCTGCCATGGTGCAGACAGAGGACCAGTATCAGCTGTGCTACCGTGCGGCCCTGGAGTAC
CTCGGCAGCTTTGACCACTATGCAACGTAACTACCGCTCCCCTCTCCTCCGCCACCCCCGCCGTGGGGCTCCGGAGGGGACCCAGCTCCT
CTGAGCCATACCGACCATCGTCCAGCCCTCCTACGCAGATGCTGTCACTGGCAGAGCACAGCCCACGGGGATCACAGCGTTTCAGGAACG
TTGCCACACCAATCAGAGAGCCTAGAACATCCCTGGGCAAGTGGATGGCCCAGCAGGCAGGCACTGTGGCCCTTCTGTCCACCAGACCCA
CCTGGAGCCCGCTTCAAGCTCTCTGTTGCGCTCCCGCATTTCTCATGCTTCTTCTCATGGGGTGGGGTTGGGGCAAAGCCTCCTTTTTAA
TACATTAAGTGGGGTAGACTGAGGGATTTTAGCCTCTTCCCTCTGATTTTTCCTTTCGCGAATCCGTATCTGCAGAATGGGCCACTGTAG
GGGTTGGGGTTTATTTTGTTTTGTTTTTTTTTTTCTTGAGTTCACTTTGGATCCTTATTTTGTATGACTTCTGCTGAAGGACAGAACATT
GCCTTCCTCGTGCAGAGCTGGGGCTGCCAGCCTGAGCGGAGGCTCGGCCGTGGGCCGGGAGGCAGTGCTGATCCGGCTGCTCCTCCAGCC
CTTCAGACGAGATCCTGTTTCAGCTAAATGCAGGGAAACTCAATGTTTTTTTAAGTTTTGTTTTCCCTTTAAAGCCTTTTTTTAGGCCAC
ATTGACAGTGGTGGGCGGGGAGAAGATAGGGAACACTCATCCCTGGTCGTCTATCCCAGTGTGTGTTTAACATTCACAGCCCAGAACCAC


Top

FusionGenePPI for EGLN1_PTPRF


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
EGLN1POLR2A, ING4, OSR1, HIF1A, EPAS1, HIST1H3A, OS9, SIAH2, EGLN1, EGLN3, SPRY2, SRC, FKBP8, LIMD1, VHL, MAGEA11, MAGEA9, PKM, KRAS, ZNF281, FKBP5, PLD1, RFPL4B, PEX19, SNUPN, CBWD1, CBWD2, MKS1, PLD2, GPLD1, RHOBTB3, PTGES3, FKBP4, HSP90AA1, HSP90AB1, N6AMT2, AKT1, AKT2PTPRFCTNNB1, GIT1, PPFIA1, RET, TRIO, CAV1, NID1, JUP, PPFIA3, PPFIA2, RYK, PRPF40A, SKIL, ZNF512B, EGFR, CUL7, ABCE1, CEACAM21, TGFBR2, SCN2B, HEPACAM2, UNK, NTRK1, ADRBK1, DNAAF5, NAA50, NPLOC4, PFKM, PICALM, PPWD1, ARPC3, HACL1, MAPK1, PPP2R5D, SEPHS1, TSTA3, UFD1L, CDKN2AIP, NUDCD3, TTI1, FAM171A2, SUGT1, PTPRS, WFDC2, IL13RA2, CLU, LRRIQ1, TMEM30B, PCDHGB1, ATP6V0E1, MANSC1, PCDHB16, MRAP2, PIANP, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for EGLN1_PTPRF


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status
HgeneEGLN1Q9GZT9DB01592IronEgl nine homolog 1small moleculeapproved
HgeneEGLN1Q9GZT9DB00126Vitamin CEgl nine homolog 1small moleculeapproved|nutraceutical

Top

RelatedDiseases for EGLN1_PTPRF


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneEGLN1C1853286Erythrocytosis, Familial, 32CTD_human;UNIPROT
TgenePTPRFC0038356Stomach Neoplasms1CTD_human
TgenePTPRFC0345967Malignant mesothelioma1CTD_human