FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 10662

FusionGeneSummary for DTWD2_AFF4

check button Fusion gene summary
Fusion gene informationFusion gene name: DTWD2_AFF4
Fusion gene ID: 10662
HgeneTgene
Gene symbol

DTWD2

AFF4

Gene ID

285605

27125

Gene nameDTW domain containing 2AF4/FMR2 family member 4
Synonyms-AF5Q31|CHOPS|MCEF
Cytomap

5q23.1

5q31.1

Type of geneprotein-codingprotein-coding
DescriptionDTW domain-containing protein 2AF4/FMR2 family member 4ALL1-fused gene from chromosome 5q31 proteinmajor CDK9 elongation factor-associated protein
Modification date2018051920180523
UniProtAcc

Q8NBA8

Q9UHB7

Ensembl transtripts involved in fusion geneENST00000304058, ENST00000510708, 
ENST00000515439, 
ENST00000265343, 
ENST00000378595, ENST00000491831, 
Fusion gene scores* DoF score2 X 1 X 2=43 X 3 X 2=18
# samples 23
** MAII scorelog2(2/4*10)=2.32192809488736log2(3/18*10)=0.736965594166206
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: DTWD2 [Title/Abstract] AND AFF4 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGALDPRADTCGA-CH-5744-01ADTWD2chr5

118264232

-AFF4chr5

132234833

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000304058ENST00000265343DTWD2chr5

118264232

-AFF4chr5

132234833

-
In-frameENST00000304058ENST00000378595DTWD2chr5

118264232

-AFF4chr5

132234833

-
5CDS-intronENST00000304058ENST00000491831DTWD2chr5

118264232

-AFF4chr5

132234833

-
In-frameENST00000510708ENST00000265343DTWD2chr5

118264232

-AFF4chr5

132234833

-
In-frameENST00000510708ENST00000378595DTWD2chr5

118264232

-AFF4chr5

132234833

-
5CDS-intronENST00000510708ENST00000491831DTWD2chr5

118264232

-AFF4chr5

132234833

-
intron-3CDSENST00000515439ENST00000265343DTWD2chr5

118264232

-AFF4chr5

132234833

-
intron-3CDSENST00000515439ENST00000378595DTWD2chr5

118264232

-AFF4chr5

132234833

-
intron-intronENST00000515439ENST00000491831DTWD2chr5

118264232

-AFF4chr5

132234833

-

Top

FusionProtFeatures for DTWD2_AFF4


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
DTWD2

Q8NBA8

AFF4

Q9UHB7

Key component of the super elongation complex (SEC), acomplex required to increase the catalytic rate of RNA polymeraseII transcription by suppressing transient pausing by thepolymerase at multiple sites along the DNA. In the SEC complex,AFF4 acts as a central scaffold that recruits other factorsthrough direct interactions with ELL proteins (ELL, ELL2 or ELL3)and the P-TEFb complex. In case of infection by HIV-1 virus, theSEC complex is recruited by the viral Tat protein to stimulateviral gene expression. {ECO:0000269|PubMed:20159561,ECO:0000269|PubMed:20471948, ECO:0000269|PubMed:23251033}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneDTWD2chr5:118264232chr5:132234833ENST00000510708-46178_181199299MotifNote=DXTW
TgeneAFF4chr5:118264232chr5:132234833ENST00000265343-721836_8993961164Compositional biasNote=Ser-rich
TgeneAFF4chr5:118264232chr5:132234833ENST00000378595-713836_899396901Compositional biasNote=Ser-rich

- In-frame and not-retained protein feature among the 13 regional features.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneAFF4chr5:118264232chr5:132234833ENST00000265343-721102_4613961164Compositional biasNote=Ser-rich
TgeneAFF4chr5:118264232chr5:132234833ENST00000378595-713102_461396901Compositional biasNote=Ser-rich


Top

FusionGeneSequence for DTWD2_AFF4


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_DTWD2_ENST00000304058_chr5_118264232_-_AFF4_ENST00000265343_chr5_132234833_-_901aa
MPGTATYRPQKVCLCPFLPAHPLHISTHLYIIQHPAEENKVLRTVPLLAACLPQDKCKVKIGRRFSEERDPELSTVCRKSGTLILTPGAE
AANLEEFILDSPVTPSTIIIIDGTWSQAKDIFTKNSLFRHPKQDCDKTMPRSTPGSNSEPSHHNSEGADNSRDDSSSHSGSESSSGSDSE
SESSSSDSEANEPSQSASPEPEPPPTNKWQLDNWLNKVNPHKVSPASSVDSNIPSSQGYKKEGREQGTGNSYTDTSGPKETSSATPGRDS
KTIQKGSESGRGRQKSPAQSDSTTQRRTVGKKQPKKAEKAAAEEPRGGLKIESETPVDLASSMPSSRHKAATKGSRKPNIKKESKSSPRP
TAEKKKTKSTSKSSQKSREIIETDTSSSDSDESESLPPSSQTPKYPESNRTPVKPSSVEEEDSFFRQRMFSPMEEKELLSPLSEPDDRYP
LIVKIDLNLLTRIPGKPYKETEPPKGEKKNVPEKHTREAQKQASEKVSNKGKRKHKNEDDNRASESKKPKTEDKNSAGHKPSSNRESSKQ
SAAKEKDLLPSPAGPVPSKDPKTEHGSRKRTISQSSSLKSSSNSNKETSGSSKNSSSTSKQKKTEGKTSSSSKEVKEKAPSSSSNCPPSA
PTLDSSKPRRTKLVFDDRNTSADHTLQEAKKLKHNADALSDRFEKAVYTLDAVVSFIECGNALEKNAQESKSPFPMTSETVDLIKYTMKL
KNYLAPDATAADKRLTVLCLRCESLLYLRLFKLKKENALKYSKTLTEHLKNSTNNSQAPSPGLGSKAVGMPSPVSPKLSPGNSGNTSSGA
SSASASGSSVTIPQKIHQMAASTVQVTSNFLTATEIWDQAEQLSKEQKEFFAELDKVMGPLIFNASIMTDLVRTTRQGLHWLRQDAKLIS

>In-frame_DTWD2_ENST00000304058_chr5_118264232_-_AFF4_ENST00000378595_chr5_132234833_-_638aa
MPGTATYRPQKVCLCPFLPAHPLHISTHLYIIQHPAEENKVLRTVPLLAACLPQDKCKVKIGRRFSEERDPELSTVCRKSGTLILTPGAE
AANLEEFILDSPVTPSTIIIIDGTWSQAKDIFTKNSLFRHPKQDCDKTMPRSTPGSNSEPSHHNSEGADNSRDDSSSHSGSESSSGSDSE
SESSSSDSEANEPSQSASPEPEPPPTNKWQLDNWLNKVNPHKVSPASSVDSNIPSSQGYKKEGREQGTGNSYTDTSGPKETSSATPGRDS
KTIQKGSESGRGRQKSPAQSDSTTQRRTVGKKQPKKAEKAAAEEPRGGLKIESETPVDLASSMPSSRHKAATKGSRKPNIKKESKSSPRP
TAEKKKTKSTSKSSQKSREIIETDTSSSDSDESESLPPSSQTPKYPESNRTPVKPSSVEEEDSFFRQRMFSPMEEKELLSPLSEPDDRYP
LIVKIDLNLLTRIPGKPYKETEPPKGEKKNVPEKHTREAQKQASEKVSNKGKRKHKNEDDNRASESKKPKTEDKNSAGHKPSSNRESSKQ
SAAKEKDLLPSPAGPVPSKDPKTEHGSRKRTISQSSSLKSSSNSNKETSGSSKNSSSTSKQKKTEGKTSSSSKEVKVKCWGPGAFENHST

>In-frame_DTWD2_ENST00000510708_chr5_118264232_-_AFF4_ENST00000265343_chr5_132234833_-_967aa
MESQKEARTLQEPVARPSGASSSQTPNDKERREGGAVPAAAALGAEADDDSADGLWELPVEPAERRPECTRCSRPQKVCLCPFLPAHPLH
ISTHLYIIQHPAEENKVLRTVPLLAACLPQDKCKVKIGRRFSEERDPELSTVCRKSGTLILTPGAEAANLEEFILDSPVTPSTIIIIDGT
WSQAKDIFTKNSLFRHPKQDCDKTMPRSTPGSNSEPSHHNSEGADNSRDDSSSHSGSESSSGSDSESESSSSDSEANEPSQSASPEPEPP
PTNKWQLDNWLNKVNPHKVSPASSVDSNIPSSQGYKKEGREQGTGNSYTDTSGPKETSSATPGRDSKTIQKGSESGRGRQKSPAQSDSTT
QRRTVGKKQPKKAEKAAAEEPRGGLKIESETPVDLASSMPSSRHKAATKGSRKPNIKKESKSSPRPTAEKKKTKSTSKSSQKSREIIETD
TSSSDSDESESLPPSSQTPKYPESNRTPVKPSSVEEEDSFFRQRMFSPMEEKELLSPLSEPDDRYPLIVKIDLNLLTRIPGKPYKETEPP
KGEKKNVPEKHTREAQKQASEKVSNKGKRKHKNEDDNRASESKKPKTEDKNSAGHKPSSNRESSKQSAAKEKDLLPSPAGPVPSKDPKTE
HGSRKRTISQSSSLKSSSNSNKETSGSSKNSSSTSKQKKTEGKTSSSSKEVKEKAPSSSSNCPPSAPTLDSSKPRRTKLVFDDRNTSADH
TLQEAKKLKHNADALSDRFEKAVYTLDAVVSFIECGNALEKNAQESKSPFPMTSETVDLIKYTMKLKNYLAPDATAADKRLTVLCLRCES
LLYLRLFKLKKENALKYSKTLTEHLKNSTNNSQAPSPGLGSKAVGMPSPVSPKLSPGNSGNTSSGASSASASGSSVTIPQKIHQMAASTV

>In-frame_DTWD2_ENST00000510708_chr5_118264232_-_AFF4_ENST00000378595_chr5_132234833_-_704aa
MESQKEARTLQEPVARPSGASSSQTPNDKERREGGAVPAAAALGAEADDDSADGLWELPVEPAERRPECTRCSRPQKVCLCPFLPAHPLH
ISTHLYIIQHPAEENKVLRTVPLLAACLPQDKCKVKIGRRFSEERDPELSTVCRKSGTLILTPGAEAANLEEFILDSPVTPSTIIIIDGT
WSQAKDIFTKNSLFRHPKQDCDKTMPRSTPGSNSEPSHHNSEGADNSRDDSSSHSGSESSSGSDSESESSSSDSEANEPSQSASPEPEPP
PTNKWQLDNWLNKVNPHKVSPASSVDSNIPSSQGYKKEGREQGTGNSYTDTSGPKETSSATPGRDSKTIQKGSESGRGRQKSPAQSDSTT
QRRTVGKKQPKKAEKAAAEEPRGGLKIESETPVDLASSMPSSRHKAATKGSRKPNIKKESKSSPRPTAEKKKTKSTSKSSQKSREIIETD
TSSSDSDESESLPPSSQTPKYPESNRTPVKPSSVEEEDSFFRQRMFSPMEEKELLSPLSEPDDRYPLIVKIDLNLLTRIPGKPYKETEPP
KGEKKNVPEKHTREAQKQASEKVSNKGKRKHKNEDDNRASESKKPKTEDKNSAGHKPSSNRESSKQSAAKEKDLLPSPAGPVPSKDPKTE


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_DTWD2_ENST00000304058_chr5_118264232_-_AFF4_ENST00000265343_chr5_132234833_-_2703nt
ATGCCAGGCACAGCTACCTACCGGCCTCAGAAAGTGTGTTTGTGTCCATTTCTCCCAGCGCACCCTCTGCATATCTCTACCCACTTGTAC
ATAATTCAGCATCCAGCAGAGGAAAACAAAGTGTTGCGTACAGTTCCTCTACTAGCAGCATGCCTCCCCCAGGACAAGTGTAAAGTGAAG
ATCGGTCGTCGCTTCAGTGAAGAAAGAGATCCTGAACTTTCAACTGTTTGCCGGAAGTCTGGTACATTAATATTATATCCAGGGGCTGAA
GCTGCTAATTTGGAAGAATTTATATTAGATTCTCCTGTTTATCCTTCTACAATCATCATCATTGATGGTACATGGAGCCAGGCTAAGGAC
ATTTTCTATAAGAACTCCTTGTTCCGACATCCCAAACAGGATTGTGATAAGACAATGCCGAGGAGTACACCAGGAAGTAACTCTGAACCT
TCACACCATAATAGTGAAGGAGCAGATAACTCCAGGGATGATTCTAGTAGCCACAGTGGATCTGAAAGCAGCTCTGGATCTGACTCAGAG
AGTGAAAGTAGTTCCAGTGACAGTGAGGCAAATGAGCCATCCCAGAGTGCATCTCCCGAGCCTGAACCCCCGCCAACAAACAAATGGCAA
CTTGATAATTGGCTGAATAAAGTGAACCCACATAAAGTGTCACCCGCCTCTTCAGTGGACAGTAACATCCCATCATCTCAAGGCTACAAA
AAGGAAGGCCGAGAGCAGGGCACTGGGAATAGCTACACTGATACAAGTGGACCTAAAGAAACGAGTTCCGCTACTCCGGGACGAGACTCC
AAAACCATCCAAAAGGGATCAGAAAGTGGGCGTGGGAGGCAGAAATCTCCTGCACAGAGTGACAGCACAACACAGAGAAGAACTGTAGGC
AAAAAACAACCCAAAAAGGCTGAGAAGGCAGCTGCTGAAGAGCCTCGTGGAGGCCTGAAGATAGAAAGTGAAACCCCTGTAGACTTGGCT
AGCAGCATGCCCTCCAGCAGACACAAAGCAGCCACCAAAGGCTCAAGGAAACCCAATATAAAGAAGGAGTCTAAGTCTTCCCCTCGACCT
ACAGCAGAGAAAAAGAAATATAAGTCAACAAGTAAATCTTCCCAGAAATCAAGGGAAATCATAGAAACAGATACCTCATCCTCAGATTCA
GATGAAAGTGAGAGCCTTCCTCCTTCCTCACAAACTCCTAAGTACCCCGAGAGCAATAGGACTCCTGTTAAACCCTCCTCAGTGGAGGAA
GAAGATAGCTTTTTTCGGCAACGAATGTTCTCTCCTATGGAAGAGAAGGAACTTCTTTCACCCCTCAGTGAGCCTGATGACAGGTACCCA
CTTATTGTGAAGATTGACCTGAATCTTTTGACTAGAATACCAGGAAAGCCTTACAAAGAAACAGAGCCGCCCAAGGGGGAAAAGAAAAAT
GTGCCAGAAAAGCACACGAGAGAGGCTCAGAAACAAGCCTCAGAAAAAGTTTCCAACAAAGGCAAGAGGAAGCATAAGAATGAAGATGAT
AACCGAGCCAGTGAGAGCAAGAAACCCAAAACGGAGGACAAGAATTCAGCAGGCCATAAGCCATCCAGCAACAGAGAGTCATCTAAGCAG
AGTGCTGCAAAAGAAAAGGATTTGTTGCCTTCTCCCGCTGGGCCTGTTCCTTCAAAAGATCCAAAAACAGAGCATGGCTCTCGGAAGAGG
ACTATTAGTCAGTCTTCTTCCTTAAAGTCAAGCAGTAACAGCAACAAGGAGACGAGTGGCAGCAGCAAAAACAGTTCCTCCACATCAAAG
CAGAAGAAGACCGAAGGGAAGACTTCCAGTAGCTCCAAGGAGGTTAAGGAAAAGGCTCCAAGTAGCTCCTCTAACTGTCCTCCATCTGCA
CCAACTCTTGATTCTTCTAAGCCTCGGAGAACAAAGCTTGTCTTTGATGACAGAAATTATTCAGCAGACCATTATTTACAAGAAGCAAAA
AAGCTAAAGCACAATGCAGATGCATTGTCTGATAGGTTTGAGAAAGCTGTATACTATCTTGATGCTGTGGTATCTTTCATTGAATGTGGG
AATGCATTAGAGAAGAATGCTCAGGAATCCAAATCCCCATTCCCTATGTATTCAGAGACGGTGGATCTCATCAAATACACTATGAAGCTA
AAGAATTACTTGGCACCAGATGCTACAGCTGCAGATAAACGACTCACAGTACTTTGCCTGCGATGCGAGTCTTTGCTGTACCTGAGGCTG
TTCAAACTGAAGAAGGAAAATGCTCTGAAGTACTCAAAGACACTGACAGAGCACCTGAAGAATTCTTATAATAATTCTCAAGCACCATCG
CCTGGCTTGGGAAGCAAAGCTGTGGGGATGCCTTCCCCTGTTTCTCCAAAGCTGTCACCAGGCAATTCAGGAAATTATTCATCTGGGGCC
AGTAGTGCTTCTGCAAGTGGTTCTTCAGTGACCATTCCACAGAAGATCCACCAGATGGCAGCCAGCTATGTTCAGGTCACATCCAACTTC
CTCTATGCCACCGAAATTTGGGACCAAGCTGAACAGCTTTCCAAAGAGCAAAAAGAATTCTTTGCTGAACTGGATAAAGTAATGGGCCCT
CTCATCTTTAATGCAAGCATCATGACAGATCTAGTTCGTTATACCCGGCAGGGACTGCACTGGCTTCGCCAGGATGCCAAGTTGATATCT

>In-frame_DTWD2_ENST00000304058_chr5_118264232_-_AFF4_ENST00000378595_chr5_132234833_-_1914nt
ATGCCAGGCACAGCTACCTACCGGCCTCAGAAAGTGTGTTTGTGTCCATTTCTCCCAGCGCACCCTCTGCATATCTCTACCCACTTGTAC
ATAATTCAGCATCCAGCAGAGGAAAACAAAGTGTTGCGTACAGTTCCTCTACTAGCAGCATGCCTCCCCCAGGACAAGTGTAAAGTGAAG
ATCGGTCGTCGCTTCAGTGAAGAAAGAGATCCTGAACTTTCAACTGTTTGCCGGAAGTCTGGTACATTAATATTATATCCAGGGGCTGAA
GCTGCTAATTTGGAAGAATTTATATTAGATTCTCCTGTTTATCCTTCTACAATCATCATCATTGATGGTACATGGAGCCAGGCTAAGGAC
ATTTTCTATAAGAACTCCTTGTTCCGACATCCCAAACAGGATTGTGATAAGACAATGCCGAGGAGTACACCAGGAAGTAACTCTGAACCT
TCACACCATAATAGTGAAGGAGCAGATAACTCCAGGGATGATTCTAGTAGCCACAGTGGATCTGAAAGCAGCTCTGGATCTGACTCAGAG
AGTGAAAGTAGTTCCAGTGACAGTGAGGCAAATGAGCCATCCCAGAGTGCATCTCCCGAGCCTGAACCCCCGCCAACAAACAAATGGCAA
CTTGATAATTGGCTGAATAAAGTGAACCCACATAAAGTGTCACCCGCCTCTTCAGTGGACAGTAACATCCCATCATCTCAAGGCTACAAA
AAGGAAGGCCGAGAGCAGGGCACTGGGAATAGCTACACTGATACAAGTGGACCTAAAGAAACGAGTTCCGCTACTCCGGGACGAGACTCC
AAAACCATCCAAAAGGGATCAGAAAGTGGGCGTGGGAGGCAGAAATCTCCTGCACAGAGTGACAGCACAACACAGAGAAGAACTGTAGGC
AAAAAACAACCCAAAAAGGCTGAGAAGGCAGCTGCTGAAGAGCCTCGTGGAGGCCTGAAGATAGAAAGTGAAACCCCTGTAGACTTGGCT
AGCAGCATGCCCTCCAGCAGACACAAAGCAGCCACCAAAGGCTCAAGGAAACCCAATATAAAGAAGGAGTCTAAGTCTTCCCCTCGACCT
ACAGCAGAGAAAAAGAAATATAAGTCAACAAGTAAATCTTCCCAGAAATCAAGGGAAATCATAGAAACAGATACCTCATCCTCAGATTCA
GATGAAAGTGAGAGCCTTCCTCCTTCCTCACAAACTCCTAAGTACCCCGAGAGCAATAGGACTCCTGTTAAACCCTCCTCAGTGGAGGAA
GAAGATAGCTTTTTTCGGCAACGAATGTTCTCTCCTATGGAAGAGAAGGAACTTCTTTCACCCCTCAGTGAGCCTGATGACAGGTACCCA
CTTATTGTGAAGATTGACCTGAATCTTTTGACTAGAATACCAGGAAAGCCTTACAAAGAAACAGAGCCGCCCAAGGGGGAAAAGAAAAAT
GTGCCAGAAAAGCACACGAGAGAGGCTCAGAAACAAGCCTCAGAAAAAGTTTCCAACAAAGGCAAGAGGAAGCATAAGAATGAAGATGAT
AACCGAGCCAGTGAGAGCAAGAAACCCAAAACGGAGGACAAGAATTCAGCAGGCCATAAGCCATCCAGCAACAGAGAGTCATCTAAGCAG
AGTGCTGCAAAAGAAAAGGATTTGTTGCCTTCTCCCGCTGGGCCTGTTCCTTCAAAAGATCCAAAAACAGAGCATGGCTCTCGGAAGAGG
ACTATTAGTCAGTCTTCTTCCTTAAAGTCAAGCAGTAACAGCAACAAGGAGACGAGTGGCAGCAGCAAAAACAGTTCCTCCACATCAAAG
CAGAAGAAGACCGAAGGGAAGACTTCCAGTAGCTCCAAGGAGGTTAAGGTAAAGTGTTGGGGGCCTGGGGCTTTTGAAAATCATTCAACT

>In-frame_DTWD2_ENST00000510708_chr5_118264232_-_AFF4_ENST00000265343_chr5_132234833_-_2901nt
ATGGAGTCGCAGAAAGAGGCACGAACACTCCAGGAGCCCGTTGCGCGGCCTTCTGGGGCCTCAAGCTCTCAGACGCCGAACGACAAGGAG
CGGCGGGAGGGCGGCGCAGTGCCGGCGGCGGCTGCCCTGGGCGCAGAGGCGGACGACGACAGTGCGGACGGGCTGTGGGAGCTGCCGGTG
GAGCCGGCCGAGCGGAGGCCTGAGTGCACCCGCTGCAGCCGGCCTCAGAAAGTGTGTTTGTGTCCATTTCTCCCAGCGCACCCTCTGCAT
ATCTCTACCCACTTGTACATAATTCAGCATCCAGCAGAGGAAAACAAAGTGTTGCGTACAGTTCCTCTACTAGCAGCATGCCTCCCCCAG
GACAAGTGTAAAGTGAAGATCGGTCGTCGCTTCAGTGAAGAAAGAGATCCTGAACTTTCAACTGTTTGCCGGAAGTCTGGTACATTAATA
TTATATCCAGGGGCTGAAGCTGCTAATTTGGAAGAATTTATATTAGATTCTCCTGTTTATCCTTCTACAATCATCATCATTGATGGTACA
TGGAGCCAGGCTAAGGACATTTTCTATAAGAACTCCTTGTTCCGACATCCCAAACAGGATTGTGATAAGACAATGCCGAGGAGTACACCA
GGAAGTAACTCTGAACCTTCACACCATAATAGTGAAGGAGCAGATAACTCCAGGGATGATTCTAGTAGCCACAGTGGATCTGAAAGCAGC
TCTGGATCTGACTCAGAGAGTGAAAGTAGTTCCAGTGACAGTGAGGCAAATGAGCCATCCCAGAGTGCATCTCCCGAGCCTGAACCCCCG
CCAACAAACAAATGGCAACTTGATAATTGGCTGAATAAAGTGAACCCACATAAAGTGTCACCCGCCTCTTCAGTGGACAGTAACATCCCA
TCATCTCAAGGCTACAAAAAGGAAGGCCGAGAGCAGGGCACTGGGAATAGCTACACTGATACAAGTGGACCTAAAGAAACGAGTTCCGCT
ACTCCGGGACGAGACTCCAAAACCATCCAAAAGGGATCAGAAAGTGGGCGTGGGAGGCAGAAATCTCCTGCACAGAGTGACAGCACAACA
CAGAGAAGAACTGTAGGCAAAAAACAACCCAAAAAGGCTGAGAAGGCAGCTGCTGAAGAGCCTCGTGGAGGCCTGAAGATAGAAAGTGAA
ACCCCTGTAGACTTGGCTAGCAGCATGCCCTCCAGCAGACACAAAGCAGCCACCAAAGGCTCAAGGAAACCCAATATAAAGAAGGAGTCT
AAGTCTTCCCCTCGACCTACAGCAGAGAAAAAGAAATATAAGTCAACAAGTAAATCTTCCCAGAAATCAAGGGAAATCATAGAAACAGAT
ACCTCATCCTCAGATTCAGATGAAAGTGAGAGCCTTCCTCCTTCCTCACAAACTCCTAAGTACCCCGAGAGCAATAGGACTCCTGTTAAA
CCCTCCTCAGTGGAGGAAGAAGATAGCTTTTTTCGGCAACGAATGTTCTCTCCTATGGAAGAGAAGGAACTTCTTTCACCCCTCAGTGAG
CCTGATGACAGGTACCCACTTATTGTGAAGATTGACCTGAATCTTTTGACTAGAATACCAGGAAAGCCTTACAAAGAAACAGAGCCGCCC
AAGGGGGAAAAGAAAAATGTGCCAGAAAAGCACACGAGAGAGGCTCAGAAACAAGCCTCAGAAAAAGTTTCCAACAAAGGCAAGAGGAAG
CATAAGAATGAAGATGATAACCGAGCCAGTGAGAGCAAGAAACCCAAAACGGAGGACAAGAATTCAGCAGGCCATAAGCCATCCAGCAAC
AGAGAGTCATCTAAGCAGAGTGCTGCAAAAGAAAAGGATTTGTTGCCTTCTCCCGCTGGGCCTGTTCCTTCAAAAGATCCAAAAACAGAG
CATGGCTCTCGGAAGAGGACTATTAGTCAGTCTTCTTCCTTAAAGTCAAGCAGTAACAGCAACAAGGAGACGAGTGGCAGCAGCAAAAAC
AGTTCCTCCACATCAAAGCAGAAGAAGACCGAAGGGAAGACTTCCAGTAGCTCCAAGGAGGTTAAGGAAAAGGCTCCAAGTAGCTCCTCT
AACTGTCCTCCATCTGCACCAACTCTTGATTCTTCTAAGCCTCGGAGAACAAAGCTTGTCTTTGATGACAGAAATTATTCAGCAGACCAT
TATTTACAAGAAGCAAAAAAGCTAAAGCACAATGCAGATGCATTGTCTGATAGGTTTGAGAAAGCTGTATACTATCTTGATGCTGTGGTA
TCTTTCATTGAATGTGGGAATGCATTAGAGAAGAATGCTCAGGAATCCAAATCCCCATTCCCTATGTATTCAGAGACGGTGGATCTCATC
AAATACACTATGAAGCTAAAGAATTACTTGGCACCAGATGCTACAGCTGCAGATAAACGACTCACAGTACTTTGCCTGCGATGCGAGTCT
TTGCTGTACCTGAGGCTGTTCAAACTGAAGAAGGAAAATGCTCTGAAGTACTCAAAGACACTGACAGAGCACCTGAAGAATTCTTATAAT
AATTCTCAAGCACCATCGCCTGGCTTGGGAAGCAAAGCTGTGGGGATGCCTTCCCCTGTTTCTCCAAAGCTGTCACCAGGCAATTCAGGA
AATTATTCATCTGGGGCCAGTAGTGCTTCTGCAAGTGGTTCTTCAGTGACCATTCCACAGAAGATCCACCAGATGGCAGCCAGCTATGTT
CAGGTCACATCCAACTTCCTCTATGCCACCGAAATTTGGGACCAAGCTGAACAGCTTTCCAAAGAGCAAAAAGAATTCTTTGCTGAACTG
GATAAAGTAATGGGCCCTCTCATCTTTAATGCAAGCATCATGACAGATCTAGTTCGTTATACCCGGCAGGGACTGCACTGGCTTCGCCAG

>In-frame_DTWD2_ENST00000510708_chr5_118264232_-_AFF4_ENST00000378595_chr5_132234833_-_2112nt
ATGGAGTCGCAGAAAGAGGCACGAACACTCCAGGAGCCCGTTGCGCGGCCTTCTGGGGCCTCAAGCTCTCAGACGCCGAACGACAAGGAG
CGGCGGGAGGGCGGCGCAGTGCCGGCGGCGGCTGCCCTGGGCGCAGAGGCGGACGACGACAGTGCGGACGGGCTGTGGGAGCTGCCGGTG
GAGCCGGCCGAGCGGAGGCCTGAGTGCACCCGCTGCAGCCGGCCTCAGAAAGTGTGTTTGTGTCCATTTCTCCCAGCGCACCCTCTGCAT
ATCTCTACCCACTTGTACATAATTCAGCATCCAGCAGAGGAAAACAAAGTGTTGCGTACAGTTCCTCTACTAGCAGCATGCCTCCCCCAG
GACAAGTGTAAAGTGAAGATCGGTCGTCGCTTCAGTGAAGAAAGAGATCCTGAACTTTCAACTGTTTGCCGGAAGTCTGGTACATTAATA
TTATATCCAGGGGCTGAAGCTGCTAATTTGGAAGAATTTATATTAGATTCTCCTGTTTATCCTTCTACAATCATCATCATTGATGGTACA
TGGAGCCAGGCTAAGGACATTTTCTATAAGAACTCCTTGTTCCGACATCCCAAACAGGATTGTGATAAGACAATGCCGAGGAGTACACCA
GGAAGTAACTCTGAACCTTCACACCATAATAGTGAAGGAGCAGATAACTCCAGGGATGATTCTAGTAGCCACAGTGGATCTGAAAGCAGC
TCTGGATCTGACTCAGAGAGTGAAAGTAGTTCCAGTGACAGTGAGGCAAATGAGCCATCCCAGAGTGCATCTCCCGAGCCTGAACCCCCG
CCAACAAACAAATGGCAACTTGATAATTGGCTGAATAAAGTGAACCCACATAAAGTGTCACCCGCCTCTTCAGTGGACAGTAACATCCCA
TCATCTCAAGGCTACAAAAAGGAAGGCCGAGAGCAGGGCACTGGGAATAGCTACACTGATACAAGTGGACCTAAAGAAACGAGTTCCGCT
ACTCCGGGACGAGACTCCAAAACCATCCAAAAGGGATCAGAAAGTGGGCGTGGGAGGCAGAAATCTCCTGCACAGAGTGACAGCACAACA
CAGAGAAGAACTGTAGGCAAAAAACAACCCAAAAAGGCTGAGAAGGCAGCTGCTGAAGAGCCTCGTGGAGGCCTGAAGATAGAAAGTGAA
ACCCCTGTAGACTTGGCTAGCAGCATGCCCTCCAGCAGACACAAAGCAGCCACCAAAGGCTCAAGGAAACCCAATATAAAGAAGGAGTCT
AAGTCTTCCCCTCGACCTACAGCAGAGAAAAAGAAATATAAGTCAACAAGTAAATCTTCCCAGAAATCAAGGGAAATCATAGAAACAGAT
ACCTCATCCTCAGATTCAGATGAAAGTGAGAGCCTTCCTCCTTCCTCACAAACTCCTAAGTACCCCGAGAGCAATAGGACTCCTGTTAAA
CCCTCCTCAGTGGAGGAAGAAGATAGCTTTTTTCGGCAACGAATGTTCTCTCCTATGGAAGAGAAGGAACTTCTTTCACCCCTCAGTGAG
CCTGATGACAGGTACCCACTTATTGTGAAGATTGACCTGAATCTTTTGACTAGAATACCAGGAAAGCCTTACAAAGAAACAGAGCCGCCC
AAGGGGGAAAAGAAAAATGTGCCAGAAAAGCACACGAGAGAGGCTCAGAAACAAGCCTCAGAAAAAGTTTCCAACAAAGGCAAGAGGAAG
CATAAGAATGAAGATGATAACCGAGCCAGTGAGAGCAAGAAACCCAAAACGGAGGACAAGAATTCAGCAGGCCATAAGCCATCCAGCAAC
AGAGAGTCATCTAAGCAGAGTGCTGCAAAAGAAAAGGATTTGTTGCCTTCTCCCGCTGGGCCTGTTCCTTCAAAAGATCCAAAAACAGAG
CATGGCTCTCGGAAGAGGACTATTAGTCAGTCTTCTTCCTTAAAGTCAAGCAGTAACAGCAACAAGGAGACGAGTGGCAGCAGCAAAAAC
AGTTCCTCCACATCAAAGCAGAAGAAGACCGAAGGGAAGACTTCCAGTAGCTCCAAGGAGGTTAAGGTAAAGTGTTGGGGGCCTGGGGCT


* Fusion transcript sequences (Full-length transcript).
>In-frame_DTWD2_ENST00000304058_chr5_118264232_-_AFF4_ENST00000265343_chr5_132234833_-_8454nt
GGAGTCGGCGGCTCGGGCAGCTCTGCGATTAGGGCGGCGGAGTTGGCGGGTGCACGTTGGAAATCTCGGAAATGCCAGGCACAGCTACCT
ACCGGCCTCAGAAAGTGTGTTTGTGTCCATTTCTCCCAGCGCACCCTCTGCATATCTCTACCCACTTGTACATAATTCAGCATCCAGCAG
AGGAAAACAAAGTGTTGCGTACAGTTCCTCTACTAGCAGCATGCCTCCCCCAGGACAAGTGTAAAGTGAAGATCGGTCGTCGCTTCAGTG
AAGAAAGAGATCCTGAACTTTCAACTGTTTGCCGGAAGTCTGGTACATTAATATTATATCCAGGGGCTGAAGCTGCTAATTTGGAAGAAT
TTATATTAGATTCTCCTGTTTATCCTTCTACAATCATCATCATTGATGGTACATGGAGCCAGGCTAAGGACATTTTCTATAAGAACTCCT
TGTTCCGACATCCCAAACAGGATTGTGATAAGACAATGCCGAGGAGTACACCAGGAAGTAACTCTGAACCTTCACACCATAATAGTGAAG
GAGCAGATAACTCCAGGGATGATTCTAGTAGCCACAGTGGATCTGAAAGCAGCTCTGGATCTGACTCAGAGAGTGAAAGTAGTTCCAGTG
ACAGTGAGGCAAATGAGCCATCCCAGAGTGCATCTCCCGAGCCTGAACCCCCGCCAACAAACAAATGGCAACTTGATAATTGGCTGAATA
AAGTGAACCCACATAAAGTGTCACCCGCCTCTTCAGTGGACAGTAACATCCCATCATCTCAAGGCTACAAAAAGGAAGGCCGAGAGCAGG
GCACTGGGAATAGCTACACTGATACAAGTGGACCTAAAGAAACGAGTTCCGCTACTCCGGGACGAGACTCCAAAACCATCCAAAAGGGAT
CAGAAAGTGGGCGTGGGAGGCAGAAATCTCCTGCACAGAGTGACAGCACAACACAGAGAAGAACTGTAGGCAAAAAACAACCCAAAAAGG
CTGAGAAGGCAGCTGCTGAAGAGCCTCGTGGAGGCCTGAAGATAGAAAGTGAAACCCCTGTAGACTTGGCTAGCAGCATGCCCTCCAGCA
GACACAAAGCAGCCACCAAAGGCTCAAGGAAACCCAATATAAAGAAGGAGTCTAAGTCTTCCCCTCGACCTACAGCAGAGAAAAAGAAAT
ATAAGTCAACAAGTAAATCTTCCCAGAAATCAAGGGAAATCATAGAAACAGATACCTCATCCTCAGATTCAGATGAAAGTGAGAGCCTTC
CTCCTTCCTCACAAACTCCTAAGTACCCCGAGAGCAATAGGACTCCTGTTAAACCCTCCTCAGTGGAGGAAGAAGATAGCTTTTTTCGGC
AACGAATGTTCTCTCCTATGGAAGAGAAGGAACTTCTTTCACCCCTCAGTGAGCCTGATGACAGGTACCCACTTATTGTGAAGATTGACC
TGAATCTTTTGACTAGAATACCAGGAAAGCCTTACAAAGAAACAGAGCCGCCCAAGGGGGAAAAGAAAAATGTGCCAGAAAAGCACACGA
GAGAGGCTCAGAAACAAGCCTCAGAAAAAGTTTCCAACAAAGGCAAGAGGAAGCATAAGAATGAAGATGATAACCGAGCCAGTGAGAGCA
AGAAACCCAAAACGGAGGACAAGAATTCAGCAGGCCATAAGCCATCCAGCAACAGAGAGTCATCTAAGCAGAGTGCTGCAAAAGAAAAGG
ATTTGTTGCCTTCTCCCGCTGGGCCTGTTCCTTCAAAAGATCCAAAAACAGAGCATGGCTCTCGGAAGAGGACTATTAGTCAGTCTTCTT
CCTTAAAGTCAAGCAGTAACAGCAACAAGGAGACGAGTGGCAGCAGCAAAAACAGTTCCTCCACATCAAAGCAGAAGAAGACCGAAGGGA
AGACTTCCAGTAGCTCCAAGGAGGTTAAGGAAAAGGCTCCAAGTAGCTCCTCTAACTGTCCTCCATCTGCACCAACTCTTGATTCTTCTA
AGCCTCGGAGAACAAAGCTTGTCTTTGATGACAGAAATTATTCAGCAGACCATTATTTACAAGAAGCAAAAAAGCTAAAGCACAATGCAG
ATGCATTGTCTGATAGGTTTGAGAAAGCTGTATACTATCTTGATGCTGTGGTATCTTTCATTGAATGTGGGAATGCATTAGAGAAGAATG
CTCAGGAATCCAAATCCCCATTCCCTATGTATTCAGAGACGGTGGATCTCATCAAATACACTATGAAGCTAAAGAATTACTTGGCACCAG
ATGCTACAGCTGCAGATAAACGACTCACAGTACTTTGCCTGCGATGCGAGTCTTTGCTGTACCTGAGGCTGTTCAAACTGAAGAAGGAAA
ATGCTCTGAAGTACTCAAAGACACTGACAGAGCACCTGAAGAATTCTTATAATAATTCTCAAGCACCATCGCCTGGCTTGGGAAGCAAAG
CTGTGGGGATGCCTTCCCCTGTTTCTCCAAAGCTGTCACCAGGCAATTCAGGAAATTATTCATCTGGGGCCAGTAGTGCTTCTGCAAGTG
GTTCTTCAGTGACCATTCCACAGAAGATCCACCAGATGGCAGCCAGCTATGTTCAGGTCACATCCAACTTCCTCTATGCCACCGAAATTT
GGGACCAAGCTGAACAGCTTTCCAAAGAGCAAAAAGAATTCTTTGCTGAACTGGATAAAGTAATGGGCCCTCTCATCTTTAATGCAAGCA
TCATGACAGATCTAGTTCGTTATACCCGGCAGGGACTGCACTGGCTTCGCCAGGATGCCAAGTTGATATCTTGAACTGAACACATTCTCG
TTGCCTCTGATTTTCTCCACAACACTGTGTCACATCACGAAGGAAAACTGCCATAACATACCACCTAGTCGACACTAAGAATGAGGAATA
GTTTTCTCCTCGTTGGTTCATGTGTTGTTGTTTTTGATAATCCAAAGCGATCATGTCAGTTGGCCCTTTAATATTTCCAATGTGAAAGAT
TATTTAAATGCTTTTAAATCTGCAGCACATTGATAAGATGGTTTCCGTGAGCTATGATAAGATTGAAATTCCAGTTGCAATTCATAACTA
ATGAATTGAAATTTTATTTATTTTAATTTTTTTAAGTTCCCAGATTGGGGCTAGTTTAAGACTTAGTTATTTCTGCCTATAAATTTACTC
TGTTGAATATTTAGCATAAATTTAATGTAGACATTTTTATTTATATACCTTGGGAGCTTTATTACCTAATATCTTTTTGTGGTAGCTGTT
CTAAGAGTAAGAATTGGTTCGTCTAAAATAAGGACATATTCTTTCTACACCTGCTACCTGACCTGATATTTGAAATCTTAACTCCAATTT
TATTATTGTGGAATTTACAGTTAGTATTAAGGATATTCTTCTACACATGAAAAAATCACTTAAATATGAGAAAATGGCATTCTACATGTA
TGTACTATGAAATGTGTCTGATTTGGTATGCATTATTTCAAAAACTGTGAATGTGTGTTAATAACACTACAGCAATCACACAGTGACTAT
AGCTTGCATTTAATGCATTACAAAAGAGGGAGGACAAACTTTCTAGAAGAAGCATTTCATGTTGAAGGGTTTCATAAAAGGACAATCCTG
AACGTTACGGATTTTATTAAAACCATATGTTATTTTTTGTTGCTAATCATTTGACACTTAATCGAAACAGAATAAGTTACTGTGGAAAAA
AGGATGATCCAACTCCTGAGGATTGCCGCCTGTGTGTCTTTAATTGATTATCTTTGATAGTTAGAGTTATTTTTCAGATTTTTCCCCCTC
ATACTGGATTGTGATGCTCTGATATGAGCATGCAATGACTGATACAGAAATAGGCTGGAGCTTCGGTGTGTGCTTTTGCTATACAGCTTA
CAGTTCTAATGCCTGATGTAGAGATGATGAATTTCTCCTTTTTAAACCTATCTTCTGTTTACTCCTTTTGCATTATGAAGGCCCTCTTCA
ATGATGTATGTTTCTGATGGAATCAGAAAATTTCACACTAGAAAAGTGTACCTAACTTGATTCAGTGTGAGCTCTTGGGACAGGGAGTGG
AGCCAGGGGTAGAGCTTAAAGAAGCTGGCTCTGTAAGAGTTGTATATCAAAGTACCTTTTGCTACAAGGTGCATATAGAAGTCTAAGATA
AGAAATGTACCCTCTATACTTTATTTTTCATGCCCCTATCATGTTTGGTGTGCCTTAAATCTTACCTTTAAATGAAGACTCTATGGATTG
TTTACAAATGAAGTTTTACACTAGGACCAGATCGTCCATACATGATTGGTCTTCTACAATAATAATGTTCAATTCTTTCATTTTAAATCT
TTCTTTAGGGTCATATAAAGATTAGTTCTTTCAGAAAAGCTATTGCTTTGGTACATGACTTAGTCTAACCAGTTGGGTAATGCTGCTTTG
AAAAATAGTTTGTCCCTCTCCCCATTCCAAAAATGAATCCATTCAGTCAGAAAAAAAGATTATCCTACTATTTGTAGATGATTGCTAAGG
CTTGAAATAGGAAAGGGGAAAGAAGGGATAGAAAAGTTTCAAGTCCAGTAGTGCAGTGAATCCTTTGTGTTTGAGACTTTTTTACACTTA
TTTCTGAAGTTAGTGAACTTTCATTGTCCCTGTGGCCTCATATTTATAGAGCTTCTTAACTGTTTTGTACCTCAGATTGTTTTTAGATGT
CATTGAAGATTGAGATGTACAAATTATGTTGAATTTAACCTGTTTCTCTTGGAGAAATTGCCTCTGATATCTTTCTAACTTAATCTTAGT
GTGTTCTAGGAACAGTTTTCCATAAGAGGACAACTTCTCAATGATCATGATAGTTATTTAGTAAGAAATAATGGTTGTTAATCAAATACA
TGTTATGTCTTGTCCTTCTCTGATTTTTCTGACTTGGATTCCTTAATTTGCAGTGATGTCTTAGAAATGGAAAAAGTATCCTCTGGGCTT
TCAGACTTTCAGCAACAACAGCCAGTGGGATACCTCTGAGTTCTTGTGTTCTAGTCTCTTGTATGTCCTGAAAGGCAGCAGGAGCATTTT
TGGGGTCACACTGATATTTTGTTAAAGCAGAGTTTCCTGCATGGTTTATGGTGCTGCTCTAATATTTTCTCTTTAAAACTGTGTCAATTT
TTGGAGAATGAATTTTTCAACCTTTTCATTGTGGAGGATTTTTCCCACAAGGTAGTAATGGGCAATGGATCAAAATCCTATCATAAATGA
TTGAATTTTCAATGTCATAGTGTGTGGAAATACTACTCCCTTTCCTCCATGTCTATCTTCTTAGATGTTCTGTCTTTGTCATCATCTGCT
CCAGCACATACTTTGGACTCCTTTACAGGTGACCTTCCCCCCTCCCTCCTCAATAGGTGTCCTCAGTGTTTTCTAAGCATTTAAAACTGA
ATTTGACAAGTGGCTAAAAACTTAGTCTGAGACTTGTACTTAGTATATGGTTAATTATAGAAACAACAACTATTTTAAACAGTTACTCTG
TTGACTGCTCTTTATGACTACACTTGTATGCCAGGAGGCAGCAGCCTATACACCATTAGACTCTTTACAAGCAACCAACGAACCAATTGC
AGTGGTTGCAGTTGTCACAGTAGTCTTGCCTGGGCCAGACTGGGCTGGGCTGTGGGAAGCATTCCCCTTCAGGGGAGTTTCCACAGCTCA
GCCCAGGCTCCAGTCTGGCTAGAGAGCATCCAGCCCATTCCTTGCCTCAGTGCCACCTTTTTCTGGGCAAGTAGCCAAGAAGTGACTTTA
TATGCAGTGAGTACTTCAGATAAACTTACAGCTACAGCTGCCGAAGAGTGGAGAAGGTTGACCACCATTTATTTAATTCTCTAGTGTAAA
AACAATTGAGAGCAGTGTGCGTGAGCCCACAGACACCTGTGTTTCTGGGAGCTCTGGCAGTGGCGGATTCATAGGCACTTGGGCTGCACT
TTGAATGACACACTTGGCTTTATTAGATTCACTAGTTTTTAAAAAATTGTTGTTCGTTTCTTTTCATTAAAGGTTTAATCAGACAGATCA
GACAGCATAATTTTGTATTTAATGACAGAAACGTTGGTACATTTCTTCATGAATGAGCTTGCATTCTGAAGCAAGAGCCTACAAAAGGCA
CTTGTTATAAATGAAAGTTCTGGCTCTAGAGGCCAGTACTCTGGAGTTTCAGAGCAGCCAGTGATTGTTCCAGTCAGTGATGCCTAGTTA
TATAGAGGAGGAGTACACTGTGCACTCTTCTAGGTGTAAGGGTATGCAACTTTGGATCTTAAAATTCTGTACACATACACACTTTATATA
TATGTATGTATGTATGAAAACATGAAATTAGTTTGTCAAATATGTGTGTGTTTAGTATTTTAGCTTAGTGCAACTATTTCCACATTATTT
ATTAAATTGATCTAAGACACTTTCTTGTTGACACCTTGAATATTAATGTTCAAGGGTGCAATGTGTATTCCTTTAGATTGTTAAAGCTTA
ATTACTATGATTTGTAGTAAATTAACTTTTAAAATGTATTTGAGCCCTTCTGTAGTGTCGTAGGGCTCTTACAGGGTGGGAAAGATTTTA
ATTTTCCAGTTGCTAATTGAACAGTATGGCCTCATTATATATTTTGATTTATAGGAGTTTGTGTCTGGGTCCCAGGAACATCTACTGGGG
ATGACTGTTAGGCAGCTTGTGATGATGTTTTTTAAAAAACCTAAGTAACTTGGGGAGACAGAGCATTTCAAACCCATATAGACACCTATC
ATACCTGTATATCCCCTAATACATGGAACATAAATTTCATTTCAGCTTTATGCATTAATGTATTGAAGAGGCAGGCTTTTTTTCCAGTAA
TAATACTGTACATCTAAGGTTGCTATTCAGTAAAACTAATAGAAGAGATAATTATTGAATACCTTGGAATATGTAGTGAGAAGAGGCCAA
ATTTTTCATGTTTGTGAGCATGTCTTTCAGATACTCGCTAATGGAGAAATTCACTTTAGACCTCTAGACCCCAAAACCAAGTTAGCAAGT
GACAAAAAGTAAATTATTAATAGTCTGTAAAGTGGATGCTGGTCTTACAAAGCTCCTATTCACATGAACCCTATGGTTAATTAGAAAGAA
CTTGCTGTCTCCAGAAAAGGGAATGGAAATAATAACTATGTATCTTCTTTTCATGTAATTTGGTCACAGAATAAGGTATTCAAGTTAAGT
CTAATCCAAGTCTTAGAGATCTTTAAGTATCCTAAAATAGCAGCCTAAGTAGTCATCATGTAAAGAAGTTGACTTTCAGGAATGTCAGCA
TTGACCTCTCCTTGCCACTGTTACTCAGCTAAACATAACTTGCCATTCTTAAAAATAAAAAAGCTCCCACCCAGAAACTCTAGTGATACT
CAGTTTTGACCTCTTACTGCTTCCATGTGGGACTTCTTTTCAGCTTTTAACCATTGGAATTTTCTACCTGCTATGTTCCTCTCTGGAAAA
TATCAATTTGGAAATGCTGCCTTTCAAATCAATGCCATGATCATCCATATTGTTGAGTTTGTTGTTGGTGTTCCAGAAGTGTCCCCATTT
TACAACTTTATGCACACACCTGGCAAATCATTAACATGAGCATTCAACAGTACTGGGATGGGTGGGGTGGGGGTAGGGGGCTCACCAACA
GAACTGGCCAGTTGACATTGCCTGAAAAGGCACCACCTTTAAGGGCCAGTTGTGGGGTTGGTAAGCACAGTTATGAAAATTTCTATCTAG
CCTCCGTTTTGAATGGTTTTAAGAAATTTTGTATATGGAGGATGGAAATGCTTATATATTTATTGAAAATCCTTTTATTTGAAATTAAAA
TTATTTGGTATATAATTGTTTGATATTTGGGGAGGGTTTTGGAGGGGAGATAATGTCACTGATAAATTAAAAGCCTGTTGATTTTGCAGA
AAGGTACTGTTAGTGACTGATAAGGATGCCTTTGTTTTGTACATGAACCAAATCTTTGTTTTACATTTCTTTTATCCAAAATATTTAGGC
ATCTGACATTTTCAACCAGAATTTCAATTATATACTGTGATTTTTATTTGTTGCAATACATTACAATTTCAGAGGTACTTTGGGGCTCAA
AAGCTAGGATTTCTAAGTCAGTATGTGCATTTCACACGATAAAGCTGTTAATGGTGAGCAAAGTATTATATACTAACTAGATTTTTCCAC
ATCTGTATAGTATATTATATGTATTTTGTGGTATTGAGAGTATAGAAAGTTTAGAGTGTCAAACATGCGTTTAATGTGTATTTTTAAACA
AATTTATGGCAATTAAAATATTTGGAGACAAGGGTATCACATTTCAATTTGTAAAGATCTTTTTAACTCTACTGTGTCATTAAGATGCTT

>In-frame_DTWD2_ENST00000304058_chr5_118264232_-_AFF4_ENST00000378595_chr5_132234833_-_2266nt
GGAGTCGGCGGCTCGGGCAGCTCTGCGATTAGGGCGGCGGAGTTGGCGGGTGCACGTTGGAAATCTCGGAAATGCCAGGCACAGCTACCT
ACCGGCCTCAGAAAGTGTGTTTGTGTCCATTTCTCCCAGCGCACCCTCTGCATATCTCTACCCACTTGTACATAATTCAGCATCCAGCAG
AGGAAAACAAAGTGTTGCGTACAGTTCCTCTACTAGCAGCATGCCTCCCCCAGGACAAGTGTAAAGTGAAGATCGGTCGTCGCTTCAGTG
AAGAAAGAGATCCTGAACTTTCAACTGTTTGCCGGAAGTCTGGTACATTAATATTATATCCAGGGGCTGAAGCTGCTAATTTGGAAGAAT
TTATATTAGATTCTCCTGTTTATCCTTCTACAATCATCATCATTGATGGTACATGGAGCCAGGCTAAGGACATTTTCTATAAGAACTCCT
TGTTCCGACATCCCAAACAGGATTGTGATAAGACAATGCCGAGGAGTACACCAGGAAGTAACTCTGAACCTTCACACCATAATAGTGAAG
GAGCAGATAACTCCAGGGATGATTCTAGTAGCCACAGTGGATCTGAAAGCAGCTCTGGATCTGACTCAGAGAGTGAAAGTAGTTCCAGTG
ACAGTGAGGCAAATGAGCCATCCCAGAGTGCATCTCCCGAGCCTGAACCCCCGCCAACAAACAAATGGCAACTTGATAATTGGCTGAATA
AAGTGAACCCACATAAAGTGTCACCCGCCTCTTCAGTGGACAGTAACATCCCATCATCTCAAGGCTACAAAAAGGAAGGCCGAGAGCAGG
GCACTGGGAATAGCTACACTGATACAAGTGGACCTAAAGAAACGAGTTCCGCTACTCCGGGACGAGACTCCAAAACCATCCAAAAGGGAT
CAGAAAGTGGGCGTGGGAGGCAGAAATCTCCTGCACAGAGTGACAGCACAACACAGAGAAGAACTGTAGGCAAAAAACAACCCAAAAAGG
CTGAGAAGGCAGCTGCTGAAGAGCCTCGTGGAGGCCTGAAGATAGAAAGTGAAACCCCTGTAGACTTGGCTAGCAGCATGCCCTCCAGCA
GACACAAAGCAGCCACCAAAGGCTCAAGGAAACCCAATATAAAGAAGGAGTCTAAGTCTTCCCCTCGACCTACAGCAGAGAAAAAGAAAT
ATAAGTCAACAAGTAAATCTTCCCAGAAATCAAGGGAAATCATAGAAACAGATACCTCATCCTCAGATTCAGATGAAAGTGAGAGCCTTC
CTCCTTCCTCACAAACTCCTAAGTACCCCGAGAGCAATAGGACTCCTGTTAAACCCTCCTCAGTGGAGGAAGAAGATAGCTTTTTTCGGC
AACGAATGTTCTCTCCTATGGAAGAGAAGGAACTTCTTTCACCCCTCAGTGAGCCTGATGACAGGTACCCACTTATTGTGAAGATTGACC
TGAATCTTTTGACTAGAATACCAGGAAAGCCTTACAAAGAAACAGAGCCGCCCAAGGGGGAAAAGAAAAATGTGCCAGAAAAGCACACGA
GAGAGGCTCAGAAACAAGCCTCAGAAAAAGTTTCCAACAAAGGCAAGAGGAAGCATAAGAATGAAGATGATAACCGAGCCAGTGAGAGCA
AGAAACCCAAAACGGAGGACAAGAATTCAGCAGGCCATAAGCCATCCAGCAACAGAGAGTCATCTAAGCAGAGTGCTGCAAAAGAAAAGG
ATTTGTTGCCTTCTCCCGCTGGGCCTGTTCCTTCAAAAGATCCAAAAACAGAGCATGGCTCTCGGAAGAGGACTATTAGTCAGTCTTCTT
CCTTAAAGTCAAGCAGTAACAGCAACAAGGAGACGAGTGGCAGCAGCAAAAACAGTTCCTCCACATCAAAGCAGAAGAAGACCGAAGGGA
AGACTTCCAGTAGCTCCAAGGAGGTTAAGGTAAAGTGTTGGGGGCCTGGGGCTTTTGAAAATCATTCAACTTGCCATGTGACTTTTCCAG
GGTGACACTGTGCTTTGAAATTATTGTAACATCTCAGTAAATATATAGGCCTATGTCTTTTACCCTCTATATGTAATAATCCTGATAAAT
GAATACAGTGATATAAGACTGTGAAGGTGGTAAGTCAGCTGGTCACATACATATTGAAAGAAAAACCCTTGGGTACAGTGGCTCATACCT
GTAGTCCCAGCTATTTGGGAGGCTAAGATGGAAGGATCATTTGAGGAATTTGAGTCCAGCCTGGGCAATGTGGTGAGACCCTGTCTGTAA

>In-frame_DTWD2_ENST00000510708_chr5_118264232_-_AFF4_ENST00000265343_chr5_132234833_-_8615nt
GCTTCAATGCCACGGCCTGACCGGAGTGTCCGCCATGGAGTCGCAGAAAGAGGCACGAACACTCCAGGAGCCCGTTGCGCGGCCTTCTGG
GGCCTCAAGCTCTCAGACGCCGAACGACAAGGAGCGGCGGGAGGGCGGCGCAGTGCCGGCGGCGGCTGCCCTGGGCGCAGAGGCGGACGA
CGACAGTGCGGACGGGCTGTGGGAGCTGCCGGTGGAGCCGGCCGAGCGGAGGCCTGAGTGCACCCGCTGCAGCCGGCCTCAGAAAGTGTG
TTTGTGTCCATTTCTCCCAGCGCACCCTCTGCATATCTCTACCCACTTGTACATAATTCAGCATCCAGCAGAGGAAAACAAAGTGTTGCG
TACAGTTCCTCTACTAGCAGCATGCCTCCCCCAGGACAAGTGTAAAGTGAAGATCGGTCGTCGCTTCAGTGAAGAAAGAGATCCTGAACT
TTCAACTGTTTGCCGGAAGTCTGGTACATTAATATTATATCCAGGGGCTGAAGCTGCTAATTTGGAAGAATTTATATTAGATTCTCCTGT
TTATCCTTCTACAATCATCATCATTGATGGTACATGGAGCCAGGCTAAGGACATTTTCTATAAGAACTCCTTGTTCCGACATCCCAAACA
GGATTGTGATAAGACAATGCCGAGGAGTACACCAGGAAGTAACTCTGAACCTTCACACCATAATAGTGAAGGAGCAGATAACTCCAGGGA
TGATTCTAGTAGCCACAGTGGATCTGAAAGCAGCTCTGGATCTGACTCAGAGAGTGAAAGTAGTTCCAGTGACAGTGAGGCAAATGAGCC
ATCCCAGAGTGCATCTCCCGAGCCTGAACCCCCGCCAACAAACAAATGGCAACTTGATAATTGGCTGAATAAAGTGAACCCACATAAAGT
GTCACCCGCCTCTTCAGTGGACAGTAACATCCCATCATCTCAAGGCTACAAAAAGGAAGGCCGAGAGCAGGGCACTGGGAATAGCTACAC
TGATACAAGTGGACCTAAAGAAACGAGTTCCGCTACTCCGGGACGAGACTCCAAAACCATCCAAAAGGGATCAGAAAGTGGGCGTGGGAG
GCAGAAATCTCCTGCACAGAGTGACAGCACAACACAGAGAAGAACTGTAGGCAAAAAACAACCCAAAAAGGCTGAGAAGGCAGCTGCTGA
AGAGCCTCGTGGAGGCCTGAAGATAGAAAGTGAAACCCCTGTAGACTTGGCTAGCAGCATGCCCTCCAGCAGACACAAAGCAGCCACCAA
AGGCTCAAGGAAACCCAATATAAAGAAGGAGTCTAAGTCTTCCCCTCGACCTACAGCAGAGAAAAAGAAATATAAGTCAACAAGTAAATC
TTCCCAGAAATCAAGGGAAATCATAGAAACAGATACCTCATCCTCAGATTCAGATGAAAGTGAGAGCCTTCCTCCTTCCTCACAAACTCC
TAAGTACCCCGAGAGCAATAGGACTCCTGTTAAACCCTCCTCAGTGGAGGAAGAAGATAGCTTTTTTCGGCAACGAATGTTCTCTCCTAT
GGAAGAGAAGGAACTTCTTTCACCCCTCAGTGAGCCTGATGACAGGTACCCACTTATTGTGAAGATTGACCTGAATCTTTTGACTAGAAT
ACCAGGAAAGCCTTACAAAGAAACAGAGCCGCCCAAGGGGGAAAAGAAAAATGTGCCAGAAAAGCACACGAGAGAGGCTCAGAAACAAGC
CTCAGAAAAAGTTTCCAACAAAGGCAAGAGGAAGCATAAGAATGAAGATGATAACCGAGCCAGTGAGAGCAAGAAACCCAAAACGGAGGA
CAAGAATTCAGCAGGCCATAAGCCATCCAGCAACAGAGAGTCATCTAAGCAGAGTGCTGCAAAAGAAAAGGATTTGTTGCCTTCTCCCGC
TGGGCCTGTTCCTTCAAAAGATCCAAAAACAGAGCATGGCTCTCGGAAGAGGACTATTAGTCAGTCTTCTTCCTTAAAGTCAAGCAGTAA
CAGCAACAAGGAGACGAGTGGCAGCAGCAAAAACAGTTCCTCCACATCAAAGCAGAAGAAGACCGAAGGGAAGACTTCCAGTAGCTCCAA
GGAGGTTAAGGAAAAGGCTCCAAGTAGCTCCTCTAACTGTCCTCCATCTGCACCAACTCTTGATTCTTCTAAGCCTCGGAGAACAAAGCT
TGTCTTTGATGACAGAAATTATTCAGCAGACCATTATTTACAAGAAGCAAAAAAGCTAAAGCACAATGCAGATGCATTGTCTGATAGGTT
TGAGAAAGCTGTATACTATCTTGATGCTGTGGTATCTTTCATTGAATGTGGGAATGCATTAGAGAAGAATGCTCAGGAATCCAAATCCCC
ATTCCCTATGTATTCAGAGACGGTGGATCTCATCAAATACACTATGAAGCTAAAGAATTACTTGGCACCAGATGCTACAGCTGCAGATAA
ACGACTCACAGTACTTTGCCTGCGATGCGAGTCTTTGCTGTACCTGAGGCTGTTCAAACTGAAGAAGGAAAATGCTCTGAAGTACTCAAA
GACACTGACAGAGCACCTGAAGAATTCTTATAATAATTCTCAAGCACCATCGCCTGGCTTGGGAAGCAAAGCTGTGGGGATGCCTTCCCC
TGTTTCTCCAAAGCTGTCACCAGGCAATTCAGGAAATTATTCATCTGGGGCCAGTAGTGCTTCTGCAAGTGGTTCTTCAGTGACCATTCC
ACAGAAGATCCACCAGATGGCAGCCAGCTATGTTCAGGTCACATCCAACTTCCTCTATGCCACCGAAATTTGGGACCAAGCTGAACAGCT
TTCCAAAGAGCAAAAAGAATTCTTTGCTGAACTGGATAAAGTAATGGGCCCTCTCATCTTTAATGCAAGCATCATGACAGATCTAGTTCG
TTATACCCGGCAGGGACTGCACTGGCTTCGCCAGGATGCCAAGTTGATATCTTGAACTGAACACATTCTCGTTGCCTCTGATTTTCTCCA
CAACACTGTGTCACATCACGAAGGAAAACTGCCATAACATACCACCTAGTCGACACTAAGAATGAGGAATAGTTTTCTCCTCGTTGGTTC
ATGTGTTGTTGTTTTTGATAATCCAAAGCGATCATGTCAGTTGGCCCTTTAATATTTCCAATGTGAAAGATTATTTAAATGCTTTTAAAT
CTGCAGCACATTGATAAGATGGTTTCCGTGAGCTATGATAAGATTGAAATTCCAGTTGCAATTCATAACTAATGAATTGAAATTTTATTT
ATTTTAATTTTTTTAAGTTCCCAGATTGGGGCTAGTTTAAGACTTAGTTATTTCTGCCTATAAATTTACTCTGTTGAATATTTAGCATAA
ATTTAATGTAGACATTTTTATTTATATACCTTGGGAGCTTTATTACCTAATATCTTTTTGTGGTAGCTGTTCTAAGAGTAAGAATTGGTT
CGTCTAAAATAAGGACATATTCTTTCTACACCTGCTACCTGACCTGATATTTGAAATCTTAACTCCAATTTTATTATTGTGGAATTTACA
GTTAGTATTAAGGATATTCTTCTACACATGAAAAAATCACTTAAATATGAGAAAATGGCATTCTACATGTATGTACTATGAAATGTGTCT
GATTTGGTATGCATTATTTCAAAAACTGTGAATGTGTGTTAATAACACTACAGCAATCACACAGTGACTATAGCTTGCATTTAATGCATT
ACAAAAGAGGGAGGACAAACTTTCTAGAAGAAGCATTTCATGTTGAAGGGTTTCATAAAAGGACAATCCTGAACGTTACGGATTTTATTA
AAACCATATGTTATTTTTTGTTGCTAATCATTTGACACTTAATCGAAACAGAATAAGTTACTGTGGAAAAAAGGATGATCCAACTCCTGA
GGATTGCCGCCTGTGTGTCTTTAATTGATTATCTTTGATAGTTAGAGTTATTTTTCAGATTTTTCCCCCTCATACTGGATTGTGATGCTC
TGATATGAGCATGCAATGACTGATACAGAAATAGGCTGGAGCTTCGGTGTGTGCTTTTGCTATACAGCTTACAGTTCTAATGCCTGATGT
AGAGATGATGAATTTCTCCTTTTTAAACCTATCTTCTGTTTACTCCTTTTGCATTATGAAGGCCCTCTTCAATGATGTATGTTTCTGATG
GAATCAGAAAATTTCACACTAGAAAAGTGTACCTAACTTGATTCAGTGTGAGCTCTTGGGACAGGGAGTGGAGCCAGGGGTAGAGCTTAA
AGAAGCTGGCTCTGTAAGAGTTGTATATCAAAGTACCTTTTGCTACAAGGTGCATATAGAAGTCTAAGATAAGAAATGTACCCTCTATAC
TTTATTTTTCATGCCCCTATCATGTTTGGTGTGCCTTAAATCTTACCTTTAAATGAAGACTCTATGGATTGTTTACAAATGAAGTTTTAC
ACTAGGACCAGATCGTCCATACATGATTGGTCTTCTACAATAATAATGTTCAATTCTTTCATTTTAAATCTTTCTTTAGGGTCATATAAA
GATTAGTTCTTTCAGAAAAGCTATTGCTTTGGTACATGACTTAGTCTAACCAGTTGGGTAATGCTGCTTTGAAAAATAGTTTGTCCCTCT
CCCCATTCCAAAAATGAATCCATTCAGTCAGAAAAAAAGATTATCCTACTATTTGTAGATGATTGCTAAGGCTTGAAATAGGAAAGGGGA
AAGAAGGGATAGAAAAGTTTCAAGTCCAGTAGTGCAGTGAATCCTTTGTGTTTGAGACTTTTTTACACTTATTTCTGAAGTTAGTGAACT
TTCATTGTCCCTGTGGCCTCATATTTATAGAGCTTCTTAACTGTTTTGTACCTCAGATTGTTTTTAGATGTCATTGAAGATTGAGATGTA
CAAATTATGTTGAATTTAACCTGTTTCTCTTGGAGAAATTGCCTCTGATATCTTTCTAACTTAATCTTAGTGTGTTCTAGGAACAGTTTT
CCATAAGAGGACAACTTCTCAATGATCATGATAGTTATTTAGTAAGAAATAATGGTTGTTAATCAAATACATGTTATGTCTTGTCCTTCT
CTGATTTTTCTGACTTGGATTCCTTAATTTGCAGTGATGTCTTAGAAATGGAAAAAGTATCCTCTGGGCTTTCAGACTTTCAGCAACAAC
AGCCAGTGGGATACCTCTGAGTTCTTGTGTTCTAGTCTCTTGTATGTCCTGAAAGGCAGCAGGAGCATTTTTGGGGTCACACTGATATTT
TGTTAAAGCAGAGTTTCCTGCATGGTTTATGGTGCTGCTCTAATATTTTCTCTTTAAAACTGTGTCAATTTTTGGAGAATGAATTTTTCA
ACCTTTTCATTGTGGAGGATTTTTCCCACAAGGTAGTAATGGGCAATGGATCAAAATCCTATCATAAATGATTGAATTTTCAATGTCATA
GTGTGTGGAAATACTACTCCCTTTCCTCCATGTCTATCTTCTTAGATGTTCTGTCTTTGTCATCATCTGCTCCAGCACATACTTTGGACT
CCTTTACAGGTGACCTTCCCCCCTCCCTCCTCAATAGGTGTCCTCAGTGTTTTCTAAGCATTTAAAACTGAATTTGACAAGTGGCTAAAA
ACTTAGTCTGAGACTTGTACTTAGTATATGGTTAATTATAGAAACAACAACTATTTTAAACAGTTACTCTGTTGACTGCTCTTTATGACT
ACACTTGTATGCCAGGAGGCAGCAGCCTATACACCATTAGACTCTTTACAAGCAACCAACGAACCAATTGCAGTGGTTGCAGTTGTCACA
GTAGTCTTGCCTGGGCCAGACTGGGCTGGGCTGTGGGAAGCATTCCCCTTCAGGGGAGTTTCCACAGCTCAGCCCAGGCTCCAGTCTGGC
TAGAGAGCATCCAGCCCATTCCTTGCCTCAGTGCCACCTTTTTCTGGGCAAGTAGCCAAGAAGTGACTTTATATGCAGTGAGTACTTCAG
ATAAACTTACAGCTACAGCTGCCGAAGAGTGGAGAAGGTTGACCACCATTTATTTAATTCTCTAGTGTAAAAACAATTGAGAGCAGTGTG
CGTGAGCCCACAGACACCTGTGTTTCTGGGAGCTCTGGCAGTGGCGGATTCATAGGCACTTGGGCTGCACTTTGAATGACACACTTGGCT
TTATTAGATTCACTAGTTTTTAAAAAATTGTTGTTCGTTTCTTTTCATTAAAGGTTTAATCAGACAGATCAGACAGCATAATTTTGTATT
TAATGACAGAAACGTTGGTACATTTCTTCATGAATGAGCTTGCATTCTGAAGCAAGAGCCTACAAAAGGCACTTGTTATAAATGAAAGTT
CTGGCTCTAGAGGCCAGTACTCTGGAGTTTCAGAGCAGCCAGTGATTGTTCCAGTCAGTGATGCCTAGTTATATAGAGGAGGAGTACACT
GTGCACTCTTCTAGGTGTAAGGGTATGCAACTTTGGATCTTAAAATTCTGTACACATACACACTTTATATATATGTATGTATGTATGAAA
ACATGAAATTAGTTTGTCAAATATGTGTGTGTTTAGTATTTTAGCTTAGTGCAACTATTTCCACATTATTTATTAAATTGATCTAAGACA
CTTTCTTGTTGACACCTTGAATATTAATGTTCAAGGGTGCAATGTGTATTCCTTTAGATTGTTAAAGCTTAATTACTATGATTTGTAGTA
AATTAACTTTTAAAATGTATTTGAGCCCTTCTGTAGTGTCGTAGGGCTCTTACAGGGTGGGAAAGATTTTAATTTTCCAGTTGCTAATTG
AACAGTATGGCCTCATTATATATTTTGATTTATAGGAGTTTGTGTCTGGGTCCCAGGAACATCTACTGGGGATGACTGTTAGGCAGCTTG
TGATGATGTTTTTTAAAAAACCTAAGTAACTTGGGGAGACAGAGCATTTCAAACCCATATAGACACCTATCATACCTGTATATCCCCTAA
TACATGGAACATAAATTTCATTTCAGCTTTATGCATTAATGTATTGAAGAGGCAGGCTTTTTTTCCAGTAATAATACTGTACATCTAAGG
TTGCTATTCAGTAAAACTAATAGAAGAGATAATTATTGAATACCTTGGAATATGTAGTGAGAAGAGGCCAAATTTTTCATGTTTGTGAGC
ATGTCTTTCAGATACTCGCTAATGGAGAAATTCACTTTAGACCTCTAGACCCCAAAACCAAGTTAGCAAGTGACAAAAAGTAAATTATTA
ATAGTCTGTAAAGTGGATGCTGGTCTTACAAAGCTCCTATTCACATGAACCCTATGGTTAATTAGAAAGAACTTGCTGTCTCCAGAAAAG
GGAATGGAAATAATAACTATGTATCTTCTTTTCATGTAATTTGGTCACAGAATAAGGTATTCAAGTTAAGTCTAATCCAAGTCTTAGAGA
TCTTTAAGTATCCTAAAATAGCAGCCTAAGTAGTCATCATGTAAAGAAGTTGACTTTCAGGAATGTCAGCATTGACCTCTCCTTGCCACT
GTTACTCAGCTAAACATAACTTGCCATTCTTAAAAATAAAAAAGCTCCCACCCAGAAACTCTAGTGATACTCAGTTTTGACCTCTTACTG
CTTCCATGTGGGACTTCTTTTCAGCTTTTAACCATTGGAATTTTCTACCTGCTATGTTCCTCTCTGGAAAATATCAATTTGGAAATGCTG
CCTTTCAAATCAATGCCATGATCATCCATATTGTTGAGTTTGTTGTTGGTGTTCCAGAAGTGTCCCCATTTTACAACTTTATGCACACAC
CTGGCAAATCATTAACATGAGCATTCAACAGTACTGGGATGGGTGGGGTGGGGGTAGGGGGCTCACCAACAGAACTGGCCAGTTGACATT
GCCTGAAAAGGCACCACCTTTAAGGGCCAGTTGTGGGGTTGGTAAGCACAGTTATGAAAATTTCTATCTAGCCTCCGTTTTGAATGGTTT
TAAGAAATTTTGTATATGGAGGATGGAAATGCTTATATATTTATTGAAAATCCTTTTATTTGAAATTAAAATTATTTGGTATATAATTGT
TTGATATTTGGGGAGGGTTTTGGAGGGGAGATAATGTCACTGATAAATTAAAAGCCTGTTGATTTTGCAGAAAGGTACTGTTAGTGACTG
ATAAGGATGCCTTTGTTTTGTACATGAACCAAATCTTTGTTTTACATTTCTTTTATCCAAAATATTTAGGCATCTGACATTTTCAACCAG
AATTTCAATTATATACTGTGATTTTTATTTGTTGCAATACATTACAATTTCAGAGGTACTTTGGGGCTCAAAAGCTAGGATTTCTAAGTC
AGTATGTGCATTTCACACGATAAAGCTGTTAATGGTGAGCAAAGTATTATATACTAACTAGATTTTTCCACATCTGTATAGTATATTATA
TGTATTTTGTGGTATTGAGAGTATAGAAAGTTTAGAGTGTCAAACATGCGTTTAATGTGTATTTTTAAACAAATTTATGGCAATTAAAAT
ATTTGGAGACAAGGGTATCACATTTCAATTTGTAAAGATCTTTTTAACTCTACTGTGTCATTAAGATGCTTTGTACAATGCCAAACCATA

>In-frame_DTWD2_ENST00000510708_chr5_118264232_-_AFF4_ENST00000378595_chr5_132234833_-_2427nt
GCTTCAATGCCACGGCCTGACCGGAGTGTCCGCCATGGAGTCGCAGAAAGAGGCACGAACACTCCAGGAGCCCGTTGCGCGGCCTTCTGG
GGCCTCAAGCTCTCAGACGCCGAACGACAAGGAGCGGCGGGAGGGCGGCGCAGTGCCGGCGGCGGCTGCCCTGGGCGCAGAGGCGGACGA
CGACAGTGCGGACGGGCTGTGGGAGCTGCCGGTGGAGCCGGCCGAGCGGAGGCCTGAGTGCACCCGCTGCAGCCGGCCTCAGAAAGTGTG
TTTGTGTCCATTTCTCCCAGCGCACCCTCTGCATATCTCTACCCACTTGTACATAATTCAGCATCCAGCAGAGGAAAACAAAGTGTTGCG
TACAGTTCCTCTACTAGCAGCATGCCTCCCCCAGGACAAGTGTAAAGTGAAGATCGGTCGTCGCTTCAGTGAAGAAAGAGATCCTGAACT
TTCAACTGTTTGCCGGAAGTCTGGTACATTAATATTATATCCAGGGGCTGAAGCTGCTAATTTGGAAGAATTTATATTAGATTCTCCTGT
TTATCCTTCTACAATCATCATCATTGATGGTACATGGAGCCAGGCTAAGGACATTTTCTATAAGAACTCCTTGTTCCGACATCCCAAACA
GGATTGTGATAAGACAATGCCGAGGAGTACACCAGGAAGTAACTCTGAACCTTCACACCATAATAGTGAAGGAGCAGATAACTCCAGGGA
TGATTCTAGTAGCCACAGTGGATCTGAAAGCAGCTCTGGATCTGACTCAGAGAGTGAAAGTAGTTCCAGTGACAGTGAGGCAAATGAGCC
ATCCCAGAGTGCATCTCCCGAGCCTGAACCCCCGCCAACAAACAAATGGCAACTTGATAATTGGCTGAATAAAGTGAACCCACATAAAGT
GTCACCCGCCTCTTCAGTGGACAGTAACATCCCATCATCTCAAGGCTACAAAAAGGAAGGCCGAGAGCAGGGCACTGGGAATAGCTACAC
TGATACAAGTGGACCTAAAGAAACGAGTTCCGCTACTCCGGGACGAGACTCCAAAACCATCCAAAAGGGATCAGAAAGTGGGCGTGGGAG
GCAGAAATCTCCTGCACAGAGTGACAGCACAACACAGAGAAGAACTGTAGGCAAAAAACAACCCAAAAAGGCTGAGAAGGCAGCTGCTGA
AGAGCCTCGTGGAGGCCTGAAGATAGAAAGTGAAACCCCTGTAGACTTGGCTAGCAGCATGCCCTCCAGCAGACACAAAGCAGCCACCAA
AGGCTCAAGGAAACCCAATATAAAGAAGGAGTCTAAGTCTTCCCCTCGACCTACAGCAGAGAAAAAGAAATATAAGTCAACAAGTAAATC
TTCCCAGAAATCAAGGGAAATCATAGAAACAGATACCTCATCCTCAGATTCAGATGAAAGTGAGAGCCTTCCTCCTTCCTCACAAACTCC
TAAGTACCCCGAGAGCAATAGGACTCCTGTTAAACCCTCCTCAGTGGAGGAAGAAGATAGCTTTTTTCGGCAACGAATGTTCTCTCCTAT
GGAAGAGAAGGAACTTCTTTCACCCCTCAGTGAGCCTGATGACAGGTACCCACTTATTGTGAAGATTGACCTGAATCTTTTGACTAGAAT
ACCAGGAAAGCCTTACAAAGAAACAGAGCCGCCCAAGGGGGAAAAGAAAAATGTGCCAGAAAAGCACACGAGAGAGGCTCAGAAACAAGC
CTCAGAAAAAGTTTCCAACAAAGGCAAGAGGAAGCATAAGAATGAAGATGATAACCGAGCCAGTGAGAGCAAGAAACCCAAAACGGAGGA
CAAGAATTCAGCAGGCCATAAGCCATCCAGCAACAGAGAGTCATCTAAGCAGAGTGCTGCAAAAGAAAAGGATTTGTTGCCTTCTCCCGC
TGGGCCTGTTCCTTCAAAAGATCCAAAAACAGAGCATGGCTCTCGGAAGAGGACTATTAGTCAGTCTTCTTCCTTAAAGTCAAGCAGTAA
CAGCAACAAGGAGACGAGTGGCAGCAGCAAAAACAGTTCCTCCACATCAAAGCAGAAGAAGACCGAAGGGAAGACTTCCAGTAGCTCCAA
GGAGGTTAAGGTAAAGTGTTGGGGGCCTGGGGCTTTTGAAAATCATTCAACTTGCCATGTGACTTTTCCAGGGTGACACTGTGCTTTGAA
ATTATTGTAACATCTCAGTAAATATATAGGCCTATGTCTTTTACCCTCTATATGTAATAATCCTGATAAATGAATACAGTGATATAAGAC
TGTGAAGGTGGTAAGTCAGCTGGTCACATACATATTGAAAGAAAAACCCTTGGGTACAGTGGCTCATACCTGTAGTCCCAGCTATTTGGG


Top

FusionGenePPI for DTWD2_AFF4


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
DTWD2MFAP3, POLE, FREM2, PCDH7, PC, TUBB8, CBWD1, ERBB2, PEX1, FAT3, CELSR2, CCRN4LAFF4TRAF2, SIAH1, CDK9, CCNT1, MLLT3, MLLT1, AFF1, KMT2A, ELL2, SPP1, GRK5, MED26, MED19, EAF1, ELL, EAF2, CCNT2, CDK15, HECW2, AP2B1, GOLGA2, MTUS2, FAM9A, HEXIM1, ELL3, EDA, DENND2D, RXRB, CTR9, CNOT1, PIP4K2A, CAMKV, MDK, PES1, ARRB2, RSBN1, EPB41L5, PBX2, TRIM25


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for DTWD2_AFF4


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for DTWD2_AFF4


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
TgeneAFF4C0005941Bone Diseases, Developmental1CTD_human
TgeneAFF4C0009241Cognition Disorders1CTD_human
TgeneAFF4C0018273Growth Disorders1CTD_human
TgeneAFF4C0018798Congenital Heart Defects1CTD_human
TgeneAFF4C0024115Lung diseases1CTD_human
TgeneAFF4C0028754Obesity1CTD_human;HPO
TgeneAFF4C0282631Facies1CTD_human
TgeneAFF4C4085597CHOPS SYNDROME1ORPHANET;UNIPROT