FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 1039

FusionGeneSummary for AFTPH_ELF1

check button Fusion gene summary
Fusion gene informationFusion gene name: AFTPH_ELF1
Fusion gene ID: 1039
HgeneTgene
Gene symbol

AFTPH

ELF1

Gene ID

54812

84337

Gene nameaftiphilinelongation factor 1 homolog
SynonymsNbla10388ELF1
Cytomap

2p14

19p13.2

Type of geneprotein-codingprotein-coding
Descriptionaftiphilinaftiphilin proteintranscription elongation factor 1 homologELF1 homolog, elongation factor 1elongation factor 1 homolog (ELF1, S. cerevisiae)
Modification date2018052320180529
UniProtAcc

Q6ULP2

P32519

Ensembl transtripts involved in fusion geneENST00000238855, ENST00000422803, 
ENST00000238856, ENST00000409933, 
ENST00000409183, ENST00000487769, 
ENST00000442101, ENST00000498824, 
ENST00000239882, 
Fusion gene scores* DoF score6 X 5 X 5=1504 X 4 X 3=48
# samples 75
** MAII scorelog2(7/150*10)=-1.09953567355091
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(5/48*10)=0.0588936890535686
effective Gene in Pan-Cancer Fusion Genes (eGinPCFGs).
DoF>8 and MAII>0
Context

PubMed: AFTPH [Title/Abstract] AND ELF1 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationTranscription factor involved fusion gene, inframe and retained DNA-binding domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVREADTCGA-G5-6235-01AAFTPHchr2

64796813

+ELF1chr13

41556418

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000238855ENST00000442101AFTPHchr2

64796813

+ELF1chr13

41556418

-
5CDS-intronENST00000238855ENST00000498824AFTPHchr2

64796813

+ELF1chr13

41556418

-
5CDS-5UTRENST00000238855ENST00000239882AFTPHchr2

64796813

+ELF1chr13

41556418

-
In-frameENST00000422803ENST00000442101AFTPHchr2

64796813

+ELF1chr13

41556418

-
5CDS-intronENST00000422803ENST00000498824AFTPHchr2

64796813

+ELF1chr13

41556418

-
5CDS-5UTRENST00000422803ENST00000239882AFTPHchr2

64796813

+ELF1chr13

41556418

-
In-frameENST00000238856ENST00000442101AFTPHchr2

64796813

+ELF1chr13

41556418

-
5CDS-intronENST00000238856ENST00000498824AFTPHchr2

64796813

+ELF1chr13

41556418

-
5CDS-5UTRENST00000238856ENST00000239882AFTPHchr2

64796813

+ELF1chr13

41556418

-
In-frameENST00000409933ENST00000442101AFTPHchr2

64796813

+ELF1chr13

41556418

-
5CDS-intronENST00000409933ENST00000498824AFTPHchr2

64796813

+ELF1chr13

41556418

-
5CDS-5UTRENST00000409933ENST00000239882AFTPHchr2

64796813

+ELF1chr13

41556418

-
In-frameENST00000409183ENST00000442101AFTPHchr2

64796813

+ELF1chr13

41556418

-
5CDS-intronENST00000409183ENST00000498824AFTPHchr2

64796813

+ELF1chr13

41556418

-
5CDS-5UTRENST00000409183ENST00000239882AFTPHchr2

64796813

+ELF1chr13

41556418

-
intron-3CDSENST00000487769ENST00000442101AFTPHchr2

64796813

+ELF1chr13

41556418

-
intron-intronENST00000487769ENST00000498824AFTPHchr2

64796813

+ELF1chr13

41556418

-
intron-5UTRENST00000487769ENST00000239882AFTPHchr2

64796813

+ELF1chr13

41556418

-

Top

FusionProtFeatures for AFTPH_ELF1


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
AFTPH

Q6ULP2

ELF1

P32519

May play a role in membrane trafficking. Transcription factor that activates the LYN and BLKpromoters. Appears to be required for the T-cell-receptor-mediatedtrans activation of HIV-2 gene expression. Binds specifically totwo purine-rich motifs in the HIV-2 enhancer.{ECO:0000269|PubMed:8756667}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneAFTPHchr2:64796813chr13:41556418ENST00000238855+51028_31757937MotifNote=WXXF motif 1
HgeneAFTPHchr2:64796813chr13:41556418ENST00000238855+510432_435757937MotifNote=WXXF motif 2
HgeneAFTPHchr2:64796813chr13:41556418ENST00000238855+510436_438757937MotifNote=WXXF motif 3 (partial)
HgeneAFTPHchr2:64796813chr13:41556418ENST00000238855+510478_481757937MotifNote=WXXF motif 4
HgeneAFTPHchr2:64796813chr13:41556418ENST00000238856+5928_31757910MotifNote=WXXF motif 1
HgeneAFTPHchr2:64796813chr13:41556418ENST00000238856+59432_435757910MotifNote=WXXF motif 2
HgeneAFTPHchr2:64796813chr13:41556418ENST00000238856+59436_438757910MotifNote=WXXF motif 3 (partial)
HgeneAFTPHchr2:64796813chr13:41556418ENST00000238856+59478_481757910MotifNote=WXXF motif 4
HgeneAFTPHchr2:64796813chr13:41556418ENST00000409933+4928_31757937MotifNote=WXXF motif 1
HgeneAFTPHchr2:64796813chr13:41556418ENST00000409933+49432_435757937MotifNote=WXXF motif 2
HgeneAFTPHchr2:64796813chr13:41556418ENST00000409933+49436_438757937MotifNote=WXXF motif 3 (partial)
HgeneAFTPHchr2:64796813chr13:41556418ENST00000409933+49478_481757937MotifNote=WXXF motif 4
HgeneAFTPHchr2:64796813chr13:41556418ENST00000422803+51028_31757938MotifNote=WXXF motif 1
HgeneAFTPHchr2:64796813chr13:41556418ENST00000422803+510432_435757938MotifNote=WXXF motif 2
HgeneAFTPHchr2:64796813chr13:41556418ENST00000422803+510436_438757938MotifNote=WXXF motif 3 (partial)
HgeneAFTPHchr2:64796813chr13:41556418ENST00000422803+510478_481757938MotifNote=WXXF motif 4
TgeneELF1chr2:64796813chr13:41556418ENST00000239882-0975_80-76620Compositional biasNote=Poly-Asp
TgeneELF1chr2:64796813chr13:41556418ENST00000442101--1875_8024596Compositional biasNote=Poly-Asp
TgeneELF1chr2:64796813chr13:41556418ENST00000239882-09208_290-76620DNA bindingETS
TgeneELF1chr2:64796813chr13:41556418ENST00000442101--18208_29024596DNA bindingETS

- In-frame and not-retained protein feature among the 13 regional features.
>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneAFTPHchr2:64796813chr13:41556418ENST00000238855+510825_829757937RegionClathrin-binding
HgeneAFTPHchr2:64796813chr13:41556418ENST00000238856+59825_829757910RegionClathrin-binding
HgeneAFTPHchr2:64796813chr13:41556418ENST00000409933+49825_829757937RegionClathrin-binding
HgeneAFTPHchr2:64796813chr13:41556418ENST00000422803+510825_829757938RegionClathrin-binding


Top

FusionGeneSequence for AFTPH_ELF1


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_AFTPH_ENST00000238855_chr2_64796813_+_ELF1_ENST00000442101_chr13_41556418_-_757aa
MEPDIIRMYSSSPPPLDNGAEDDDDDEFGEFGGFSEVSPSGVGFVDFDTPDTTRPKEEFVPSNHFMPIHEFSENVDSLTSFKSIKNGNDK
DITAELSAPVKGQSDVLLSTTSKEIISSEMLATSIDGMERPGNLNKVVEQRQNVGTLESFSPGDFRTNMNVVHQNKQLESCNGEKPPCLE
ILTNGFAVLETVNPQGTDDLDNVADSKGRKPLSTHSTETNLDSVPSPAEEFADFATFSKKERIQLEEIECAVLNDREALTIRENNKINRV
NELNSVKEVALGRSLDNKGDTDGEDQVCVSEISIVTNRGFSVEKQGLPTLQQDEFLQSGVQSKAWSLVDSADNSEAIRREQCKTEEKLDL
LTSKCAHLCMDSVKTSDDEVGSPKEESRKFTNFQSPNIDPTEENDLDDSLSVKNGDSSNDFVTCNDINEDDFGDFGDFGSASGSTPPFVT
GTQDSMSDATFEESSEHFPHFSEPGDDFGEFGDINAVSCQEETILTKSDLKQTSDNLSEECQLARKSSGTGTEPVAKLKNGQEGEIGHFD
SVPNIQDDCNGFQDSDDFADFSSAGPSQVVDWNAFEDEQKDSCSWAAFGDQQATESHHRKEAWQSHRTDENIDTPGTPKTHSVPSATSKG
AVASGHLQESATSVQTALLNRLERIFEACFPSILVPDAEEEVTSLKHLLETSTLPIKTREALPESGELLDVWTELQDIHDAHGLRYQWGG

>In-frame_AFTPH_ENST00000422803_chr2_64796813_+_ELF1_ENST00000442101_chr13_41556418_-_757aa
MEPDIIRMYSSSPPPLDNGAEDDDDDEFGEFGGFSEVSPSGVGFVDFDTPDTTRPKEEFVPSNHFMPIHEFSENVDSLTSFKSIKNGNDK
DITAELSAPVKGQSDVLLSTTSKEIISSEMLATSIDGMERPGNLNKVVEQRQNVGTLESFSPGDFRTNMNVVHQNKQLESCNGEKPPCLE
ILTNGFAVLETVNPQGTDDLDNVADSKGRKPLSTHSTETNLDSVPSPAEEFADFATFSKKERIQLEEIECAVLNDREALTIRENNKINRV
NELNSVKEVALGRSLDNKGDTDGEDQVCVSEISIVTNRGFSVEKQGLPTLQQDEFLQSGVQSKAWSLVDSADNSEAIRREQCKTEEKLDL
LTSKCAHLCMDSVKTSDDEVGSPKEESRKFTNFQSPNIDPTEENDLDDSLSVKNGDSSNDFVTCNDINEDDFGDFGDFGSASGSTPPFVT
GTQDSMSDATFEESSEHFPHFSEPGDDFGEFGDINAVSCQEETILTKSDLKQTSDNLSEECQLARKSSGTGTEPVAKLKNGQEGEIGHFD
SVPNIQDDCNGFQDSDDFADFSSAGPSQVVDWNAFEDEQKDSCSWAAFGDQQATESHHRKEAWQSHRTDENIDTPGTPKTHSVPSATSKG
AVASGHLQESATSVQTALLNRLERIFEACFPSILVPDAEEEVTSLKHLLETSTLPIKTREALPESGELLDVWTELQDIHDAHGLRYQWGG

>In-frame_AFTPH_ENST00000238856_chr2_64796813_+_ELF1_ENST00000442101_chr13_41556418_-_757aa
MEPDIIRMYSSSPPPLDNGAEDDDDDEFGEFGGFSEVSPSGVGFVDFDTPDTTRPKEEFVPSNHFMPIHEFSENVDSLTSFKSIKNGNDK
DITAELSAPVKGQSDVLLSTTSKEIISSEMLATSIDGMERPGNLNKVVEQRQNVGTLESFSPGDFRTNMNVVHQNKQLESCNGEKPPCLE
ILTNGFAVLETVNPQGTDDLDNVADSKGRKPLSTHSTETNLDSVPSPAEEFADFATFSKKERIQLEEIECAVLNDREALTIRENNKINRV
NELNSVKEVALGRSLDNKGDTDGEDQVCVSEISIVTNRGFSVEKQGLPTLQQDEFLQSGVQSKAWSLVDSADNSEAIRREQCKTEEKLDL
LTSKCAHLCMDSVKTSDDEVGSPKEESRKFTNFQSPNIDPTEENDLDDSLSVKNGDSSNDFVTCNDINEDDFGDFGDFGSASGSTPPFVT
GTQDSMSDATFEESSEHFPHFSEPGDDFGEFGDINAVSCQEETILTKSDLKQTSDNLSEECQLARKSSGTGTEPVAKLKNGQEGEIGHFD
SVPNIQDDCNGFQDSDDFADFSSAGPSQVVDWNAFEDEQKDSCSWAAFGDQQATESHHRKEAWQSHRTDENIDTPGTPKTHSVPSATSKG
AVASGHLQESATSVQTALLNRLERIFEACFPSILVPDAEEEVTSLKHLLETSTLPIKTREALPESGELLDVWTELQDIHDAHGLRYQWGG

>In-frame_AFTPH_ENST00000409933_chr2_64796813_+_ELF1_ENST00000442101_chr13_41556418_-_757aa
MEPDIIRMYSSSPPPLDNGAEDDDDDEFGEFGGFSEVSPSGVGFVDFDTPDTTRPKEEFVPSNHFMPIHEFSENVDSLTSFKSIKNGNDK
DITAELSAPVKGQSDVLLSTTSKEIISSEMLATSIDGMERPGNLNKVVEQRQNVGTLESFSPGDFRTNMNVVHQNKQLESCNGEKPPCLE
ILTNGFAVLETVNPQGTDDLDNVADSKGRKPLSTHSTETNLDSVPSPAEEFADFATFSKKERIQLEEIECAVLNDREALTIRENNKINRV
NELNSVKEVALGRSLDNKGDTDGEDQVCVSEISIVTNRGFSVEKQGLPTLQQDEFLQSGVQSKAWSLVDSADNSEAIRREQCKTEEKLDL
LTSKCAHLCMDSVKTSDDEVGSPKEESRKFTNFQSPNIDPTEENDLDDSLSVKNGDSSNDFVTCNDINEDDFGDFGDFGSASGSTPPFVT
GTQDSMSDATFEESSEHFPHFSEPGDDFGEFGDINAVSCQEETILTKSDLKQTSDNLSEECQLARKSSGTGTEPVAKLKNGQEGEIGHFD
SVPNIQDDCNGFQDSDDFADFSSAGPSQVVDWNAFEDEQKDSCSWAAFGDQQATESHHRKEAWQSHRTDENIDTPGTPKTHSVPSATSKG
AVASGHLQESATSVQTALLNRLERIFEACFPSILVPDAEEEVTSLKHLLETSTLPIKTREALPESGELLDVWTELQDIHDAHGLRYQWGG

>In-frame_AFTPH_ENST00000409183_chr2_64796813_+_ELF1_ENST00000442101_chr13_41556418_-_388aa
MDSVKTSDDEVGSPKEESRKFTNFQSPNIDPTEENDLDDSLSVKNGDSSNDFVTCNDINEDDFGDFGDFGSASGSTPPFVTGTQDSMSDA
TFEESSEHFPHFSEPGDDFGEFGDINAVSCQEETILTKSDLKQTSDNLSEECQLARKSSGTGTEPVAKLKNGQEGEIGHFDSVPNIQDDC
NGFQDSDDFADFSSAGPSQVVDWNAFEDEQKDSCSWAAFGDQQATESHHRKEAWQSHRTDENIDTPGTPKTHSVPSATSKGAVASGHLQE
SATSVQTALLNRLERIFEACFPSILVPDAEEEVTSLKHLLETSTLPIKTREALPESGELLDVWTELQDIHDAHGLRYQWGGSHSNKKLLS


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_AFTPH_ENST00000238855_chr2_64796813_+_ELF1_ENST00000442101_chr13_41556418_-_2271nt
ATGGAGCCAGACATCATTCGAATGTACTCTTCATCCCCACCACCATTAGACAATGGAGCAGAGGATGATGATGATGATGAATTTGGGGAA
TTTGGTGGGTTTTCAGAAGTTAGCCCTTCTGGTGTAGGGTTTGTTGATTTCGATACACCAGATTATACTCGTCCCAAGGAAGAGTTTGTA
CCTTCAAACCATTTTATGCCAATTCATGAATTCTCAGAAAATGTAGATAGCCTTACAAGCTTTAAGTCCATTAAAAATGGTAATGATAAG
GACATCACTGCTGAACTTTCTGCTCCTGTGAAAGGACAGTCTGATGTTTTACTTTCTACCACCAGCAAAGAAATAATTTCATCTGAAATG
TTAGCTACTTCCATTGATGGCATGGAAAGACCAGGAAATTTAAATAAAGTAGTGGAGCAGAGACAGAATGTTGGAACACTTGAAAGTTTC
TCTCCAGGAGATTTTAGAACTAATATGAATGTTGTTCATCAAAACAAGCAGTTAGAGAGCTGCAATGGTGAAAAGCCTCCTTGTCTGGAG
ATTCTAACAAATGGGTTTGCAGTGTTGGAAACTGTAAATCCTCAGGGAACAGATGATCTGGACAATGTAGCTGATTCAAAGGGACGGAAG
CCTCTTAGCACTCATAGCACTGAGTATAATTTAGACTCTGTACCTAGTCCTGCTGAGGAATTTGCAGATTTTGCCACATTTTCCAAAAAG
GAAAGGATACAATTAGAAGAAATAGAATGTGCAGTTTTAAATGATAGAGAAGCACTAACCATTCGGGAAAACAATAAAATTAATAGAGTC
AATGAACTGAATTCTGTAAAAGAAGTGGCTTTGGGTAGAAGCTTGGATAACAAAGGAGACACTGATGGAGAGGATCAGGTTTGTGTTTCA
GAAATAAGCATAGTGACTAACAGAGGTTTCAGTGTTGAAAAACAAGGCCTTCCAACACTGCAACAGGATGAATTTTTACAGTCAGGTGTT
CAGTCAAAGGCTTGGAGTTTGGTAGACTCAGCTGATAATTCAGAAGCCATTAGGAGAGAACAATGTAAAACTGAAGAAAAACTTGACTTA
CTTACTTCTAAATGTGCTCACCTATGCATGGATTCTGTTAAAACTTCTGATGATGAAGTTGGTTCTCCCAAAGAAGAAAGTAGAAAGTTT
ACTAATTTCCAAAGCCCAAACATTGACCCCACAGAAGAAAATGATTTGGATGATTCTTTAAGTGTAAAAAATGGTGATAGTAGTAATGAC
TTTGTGACTTGCAATGATATCAATGAAGATGATTTTGGTGATTTTGGTGACTTTGGCTCTGCCAGTGGCTCAACTCCACCTTTTGTTACT
GGTACTCAAGATTCAATGAGTGATGCCACTTTTGAAGAGTCTTCAGAGCACTTTCCACATTTTAGTGAACCAGGTGATGACTTTGGAGAA
TTTGGGGATATAAATGCTGTTTCTTGCCAAGAGGAGACAATATTAACAAAGTCAGACCTAAAACAGACTTCTGATAATTTATCAGAAGAA
TGTCAATTGGCAAGAAAATCTAGTGGAACAGGCACTGAACCTGTTGCAAAACTTAAAAATGGGCAAGAAGGTGAGATTGGACATTTTGAT
TCTGTGCCAAATATTCAGGATGACTGCAATGGTTTTCAAGACTCTGATGATTTTGCAGACTTCAGTTCAGCTGGTCCTAGCCAAGTTGTA
GATTGGAATGCTTTTGAGGATGAACAAAAAGATAGTTGTTCTTGGGCTGCTTTTGGAGACCAGCAGGCTACTGAATCTCATCATCGAAAG
GAAGCCTGGCAGTCACATAGGACAGATGAAAATATTGATACTCCAGGAACCCCCAAAACGCACAGTGTACCTTCAGCAACTTCCAAAGGA
GCAGTTGCTAGTGGCCATTTACAGGAATCAGCCACTTCAGTTCAGACAGCTTTATTAAACCGCCTGGAGCGAATTTTCGAAGCATGTTTT
CCTTCCATACTTGTCCCTGATGCTGAAGAGGAAGTTACTTCCCTGAAGCACTTGCTGGAAACAAGCACTTTGCCAATAAAAACGAGAGAG
GCCTTACCTGAAAGTGGGGAATTGCTAGATGTGTGGACTGAGCTACAGGATATCCATGATGCACATGGCTTGAGATACCAGTGGGGCGGC
TCCCATAGCAACAAGAAGCTTTTGTCCTCCTTGGGAATAGACACCCGAAACATTCTCTTCACGGGCAATAAGAAGCAGCCTGTTATAGTG

>In-frame_AFTPH_ENST00000422803_chr2_64796813_+_ELF1_ENST00000442101_chr13_41556418_-_2271nt
ATGGAGCCAGACATCATTCGAATGTACTCTTCATCCCCACCACCATTAGACAATGGAGCAGAGGATGATGATGATGATGAATTTGGGGAA
TTTGGTGGGTTTTCAGAAGTTAGCCCTTCTGGTGTAGGGTTTGTTGATTTCGATACACCAGATTATACTCGTCCCAAGGAAGAGTTTGTA
CCTTCAAACCATTTTATGCCAATTCATGAATTCTCAGAAAATGTAGATAGCCTTACAAGCTTTAAGTCCATTAAAAATGGTAATGATAAG
GACATCACTGCTGAACTTTCTGCTCCTGTGAAAGGACAGTCTGATGTTTTACTTTCTACCACCAGCAAAGAAATAATTTCATCTGAAATG
TTAGCTACTTCCATTGATGGCATGGAAAGACCAGGAAATTTAAATAAAGTAGTGGAGCAGAGACAGAATGTTGGAACACTTGAAAGTTTC
TCTCCAGGAGATTTTAGAACTAATATGAATGTTGTTCATCAAAACAAGCAGTTAGAGAGCTGCAATGGTGAAAAGCCTCCTTGTCTGGAG
ATTCTAACAAATGGGTTTGCAGTGTTGGAAACTGTAAATCCTCAGGGAACAGATGATCTGGACAATGTAGCTGATTCAAAGGGACGGAAG
CCTCTTAGCACTCATAGCACTGAGTATAATTTAGACTCTGTACCTAGTCCTGCTGAGGAATTTGCAGATTTTGCCACATTTTCCAAAAAG
GAAAGGATACAATTAGAAGAAATAGAATGTGCAGTTTTAAATGATAGAGAAGCACTAACCATTCGGGAAAACAATAAAATTAATAGAGTC
AATGAACTGAATTCTGTAAAAGAAGTGGCTTTGGGTAGAAGCTTGGATAACAAAGGAGACACTGATGGAGAGGATCAGGTTTGTGTTTCA
GAAATAAGCATAGTGACTAACAGAGGTTTCAGTGTTGAAAAACAAGGCCTTCCAACACTGCAACAGGATGAATTTTTACAGTCAGGTGTT
CAGTCAAAGGCTTGGAGTTTGGTAGACTCAGCTGATAATTCAGAAGCCATTAGGAGAGAACAATGTAAAACTGAAGAAAAACTTGACTTA
CTTACTTCTAAATGTGCTCACCTATGCATGGATTCTGTTAAAACTTCTGATGATGAAGTTGGTTCTCCCAAAGAAGAAAGTAGAAAGTTT
ACTAATTTCCAAAGCCCAAACATTGACCCCACAGAAGAAAATGATTTGGATGATTCTTTAAGTGTAAAAAATGGTGATAGTAGTAATGAC
TTTGTGACTTGCAATGATATCAATGAAGATGATTTTGGTGATTTTGGTGACTTTGGCTCTGCCAGTGGCTCAACTCCACCTTTTGTTACT
GGTACTCAAGATTCAATGAGTGATGCCACTTTTGAAGAGTCTTCAGAGCACTTTCCACATTTTAGTGAACCAGGTGATGACTTTGGAGAA
TTTGGGGATATAAATGCTGTTTCTTGCCAAGAGGAGACAATATTAACAAAGTCAGACCTAAAACAGACTTCTGATAATTTATCAGAAGAA
TGTCAATTGGCAAGAAAATCTAGTGGAACAGGCACTGAACCTGTTGCAAAACTTAAAAATGGGCAAGAAGGTGAGATTGGACATTTTGAT
TCTGTGCCAAATATTCAGGATGACTGCAATGGTTTTCAAGACTCTGATGATTTTGCAGACTTCAGTTCAGCTGGTCCTAGCCAAGTTGTA
GATTGGAATGCTTTTGAGGATGAACAAAAAGATAGTTGTTCTTGGGCTGCTTTTGGAGACCAGCAGGCTACTGAATCTCATCATCGAAAG
GAAGCCTGGCAGTCACATAGGACAGATGAAAATATTGATACTCCAGGAACCCCCAAAACGCACAGTGTACCTTCAGCAACTTCCAAAGGA
GCAGTTGCTAGTGGCCATTTACAGGAATCAGCCACTTCAGTTCAGACAGCTTTATTAAACCGCCTGGAGCGAATTTTCGAAGCATGTTTT
CCTTCCATACTTGTCCCTGATGCTGAAGAGGAAGTTACTTCCCTGAAGCACTTGCTGGAAACAAGCACTTTGCCAATAAAAACGAGAGAG
GCCTTACCTGAAAGTGGGGAATTGCTAGATGTGTGGACTGAGCTACAGGATATCCATGATGCACATGGCTTGAGATACCAGTGGGGCGGC
TCCCATAGCAACAAGAAGCTTTTGTCCTCCTTGGGAATAGACACCCGAAACATTCTCTTCACGGGCAATAAGAAGCAGCCTGTTATAGTG

>In-frame_AFTPH_ENST00000238856_chr2_64796813_+_ELF1_ENST00000442101_chr13_41556418_-_2271nt
ATGGAGCCAGACATCATTCGAATGTACTCTTCATCCCCACCACCATTAGACAATGGAGCAGAGGATGATGATGATGATGAATTTGGGGAA
TTTGGTGGGTTTTCAGAAGTTAGCCCTTCTGGTGTAGGGTTTGTTGATTTCGATACACCAGATTATACTCGTCCCAAGGAAGAGTTTGTA
CCTTCAAACCATTTTATGCCAATTCATGAATTCTCAGAAAATGTAGATAGCCTTACAAGCTTTAAGTCCATTAAAAATGGTAATGATAAG
GACATCACTGCTGAACTTTCTGCTCCTGTGAAAGGACAGTCTGATGTTTTACTTTCTACCACCAGCAAAGAAATAATTTCATCTGAAATG
TTAGCTACTTCCATTGATGGCATGGAAAGACCAGGAAATTTAAATAAAGTAGTGGAGCAGAGACAGAATGTTGGAACACTTGAAAGTTTC
TCTCCAGGAGATTTTAGAACTAATATGAATGTTGTTCATCAAAACAAGCAGTTAGAGAGCTGCAATGGTGAAAAGCCTCCTTGTCTGGAG
ATTCTAACAAATGGGTTTGCAGTGTTGGAAACTGTAAATCCTCAGGGAACAGATGATCTGGACAATGTAGCTGATTCAAAGGGACGGAAG
CCTCTTAGCACTCATAGCACTGAGTATAATTTAGACTCTGTACCTAGTCCTGCTGAGGAATTTGCAGATTTTGCCACATTTTCCAAAAAG
GAAAGGATACAATTAGAAGAAATAGAATGTGCAGTTTTAAATGATAGAGAAGCACTAACCATTCGGGAAAACAATAAAATTAATAGAGTC
AATGAACTGAATTCTGTAAAAGAAGTGGCTTTGGGTAGAAGCTTGGATAACAAAGGAGACACTGATGGAGAGGATCAGGTTTGTGTTTCA
GAAATAAGCATAGTGACTAACAGAGGTTTCAGTGTTGAAAAACAAGGCCTTCCAACACTGCAACAGGATGAATTTTTACAGTCAGGTGTT
CAGTCAAAGGCTTGGAGTTTGGTAGACTCAGCTGATAATTCAGAAGCCATTAGGAGAGAACAATGTAAAACTGAAGAAAAACTTGACTTA
CTTACTTCTAAATGTGCTCACCTATGCATGGATTCTGTTAAAACTTCTGATGATGAAGTTGGTTCTCCCAAAGAAGAAAGTAGAAAGTTT
ACTAATTTCCAAAGCCCAAACATTGACCCCACAGAAGAAAATGATTTGGATGATTCTTTAAGTGTAAAAAATGGTGATAGTAGTAATGAC
TTTGTGACTTGCAATGATATCAATGAAGATGATTTTGGTGATTTTGGTGACTTTGGCTCTGCCAGTGGCTCAACTCCACCTTTTGTTACT
GGTACTCAAGATTCAATGAGTGATGCCACTTTTGAAGAGTCTTCAGAGCACTTTCCACATTTTAGTGAACCAGGTGATGACTTTGGAGAA
TTTGGGGATATAAATGCTGTTTCTTGCCAAGAGGAGACAATATTAACAAAGTCAGACCTAAAACAGACTTCTGATAATTTATCAGAAGAA
TGTCAATTGGCAAGAAAATCTAGTGGAACAGGCACTGAACCTGTTGCAAAACTTAAAAATGGGCAAGAAGGTGAGATTGGACATTTTGAT
TCTGTGCCAAATATTCAGGATGACTGCAATGGTTTTCAAGACTCTGATGATTTTGCAGACTTCAGTTCAGCTGGTCCTAGCCAAGTTGTA
GATTGGAATGCTTTTGAGGATGAACAAAAAGATAGTTGTTCTTGGGCTGCTTTTGGAGACCAGCAGGCTACTGAATCTCATCATCGAAAG
GAAGCCTGGCAGTCACATAGGACAGATGAAAATATTGATACTCCAGGAACCCCCAAAACGCACAGTGTACCTTCAGCAACTTCCAAAGGA
GCAGTTGCTAGTGGCCATTTACAGGAATCAGCCACTTCAGTTCAGACAGCTTTATTAAACCGCCTGGAGCGAATTTTCGAAGCATGTTTT
CCTTCCATACTTGTCCCTGATGCTGAAGAGGAAGTTACTTCCCTGAAGCACTTGCTGGAAACAAGCACTTTGCCAATAAAAACGAGAGAG
GCCTTACCTGAAAGTGGGGAATTGCTAGATGTGTGGACTGAGCTACAGGATATCCATGATGCACATGGCTTGAGATACCAGTGGGGCGGC
TCCCATAGCAACAAGAAGCTTTTGTCCTCCTTGGGAATAGACACCCGAAACATTCTCTTCACGGGCAATAAGAAGCAGCCTGTTATAGTG

>In-frame_AFTPH_ENST00000409933_chr2_64796813_+_ELF1_ENST00000442101_chr13_41556418_-_2271nt
ATGGAGCCAGACATCATTCGAATGTACTCTTCATCCCCACCACCATTAGACAATGGAGCAGAGGATGATGATGATGATGAATTTGGGGAA
TTTGGTGGGTTTTCAGAAGTTAGCCCTTCTGGTGTAGGGTTTGTTGATTTCGATACACCAGATTATACTCGTCCCAAGGAAGAGTTTGTA
CCTTCAAACCATTTTATGCCAATTCATGAATTCTCAGAAAATGTAGATAGCCTTACAAGCTTTAAGTCCATTAAAAATGGTAATGATAAG
GACATCACTGCTGAACTTTCTGCTCCTGTGAAAGGACAGTCTGATGTTTTACTTTCTACCACCAGCAAAGAAATAATTTCATCTGAAATG
TTAGCTACTTCCATTGATGGCATGGAAAGACCAGGAAATTTAAATAAAGTAGTGGAGCAGAGACAGAATGTTGGAACACTTGAAAGTTTC
TCTCCAGGAGATTTTAGAACTAATATGAATGTTGTTCATCAAAACAAGCAGTTAGAGAGCTGCAATGGTGAAAAGCCTCCTTGTCTGGAG
ATTCTAACAAATGGGTTTGCAGTGTTGGAAACTGTAAATCCTCAGGGAACAGATGATCTGGACAATGTAGCTGATTCAAAGGGACGGAAG
CCTCTTAGCACTCATAGCACTGAGTATAATTTAGACTCTGTACCTAGTCCTGCTGAGGAATTTGCAGATTTTGCCACATTTTCCAAAAAG
GAAAGGATACAATTAGAAGAAATAGAATGTGCAGTTTTAAATGATAGAGAAGCACTAACCATTCGGGAAAACAATAAAATTAATAGAGTC
AATGAACTGAATTCTGTAAAAGAAGTGGCTTTGGGTAGAAGCTTGGATAACAAAGGAGACACTGATGGAGAGGATCAGGTTTGTGTTTCA
GAAATAAGCATAGTGACTAACAGAGGTTTCAGTGTTGAAAAACAAGGCCTTCCAACACTGCAACAGGATGAATTTTTACAGTCAGGTGTT
CAGTCAAAGGCTTGGAGTTTGGTAGACTCAGCTGATAATTCAGAAGCCATTAGGAGAGAACAATGTAAAACTGAAGAAAAACTTGACTTA
CTTACTTCTAAATGTGCTCACCTATGCATGGATTCTGTTAAAACTTCTGATGATGAAGTTGGTTCTCCCAAAGAAGAAAGTAGAAAGTTT
ACTAATTTCCAAAGCCCAAACATTGACCCCACAGAAGAAAATGATTTGGATGATTCTTTAAGTGTAAAAAATGGTGATAGTAGTAATGAC
TTTGTGACTTGCAATGATATCAATGAAGATGATTTTGGTGATTTTGGTGACTTTGGCTCTGCCAGTGGCTCAACTCCACCTTTTGTTACT
GGTACTCAAGATTCAATGAGTGATGCCACTTTTGAAGAGTCTTCAGAGCACTTTCCACATTTTAGTGAACCAGGTGATGACTTTGGAGAA
TTTGGGGATATAAATGCTGTTTCTTGCCAAGAGGAGACAATATTAACAAAGTCAGACCTAAAACAGACTTCTGATAATTTATCAGAAGAA
TGTCAATTGGCAAGAAAATCTAGTGGAACAGGCACTGAACCTGTTGCAAAACTTAAAAATGGGCAAGAAGGTGAGATTGGACATTTTGAT
TCTGTGCCAAATATTCAGGATGACTGCAATGGTTTTCAAGACTCTGATGATTTTGCAGACTTCAGTTCAGCTGGTCCTAGCCAAGTTGTA
GATTGGAATGCTTTTGAGGATGAACAAAAAGATAGTTGTTCTTGGGCTGCTTTTGGAGACCAGCAGGCTACTGAATCTCATCATCGAAAG
GAAGCCTGGCAGTCACATAGGACAGATGAAAATATTGATACTCCAGGAACCCCCAAAACGCACAGTGTACCTTCAGCAACTTCCAAAGGA
GCAGTTGCTAGTGGCCATTTACAGGAATCAGCCACTTCAGTTCAGACAGCTTTATTAAACCGCCTGGAGCGAATTTTCGAAGCATGTTTT
CCTTCCATACTTGTCCCTGATGCTGAAGAGGAAGTTACTTCCCTGAAGCACTTGCTGGAAACAAGCACTTTGCCAATAAAAACGAGAGAG
GCCTTACCTGAAAGTGGGGAATTGCTAGATGTGTGGACTGAGCTACAGGATATCCATGATGCACATGGCTTGAGATACCAGTGGGGCGGC
TCCCATAGCAACAAGAAGCTTTTGTCCTCCTTGGGAATAGACACCCGAAACATTCTCTTCACGGGCAATAAGAAGCAGCCTGTTATAGTG

>In-frame_AFTPH_ENST00000409183_chr2_64796813_+_ELF1_ENST00000442101_chr13_41556418_-_1164nt
ATGGATTCTGTTAAAACTTCTGATGATGAAGTTGGTTCTCCCAAAGAAGAAAGTAGAAAGTTTACTAATTTCCAAAGCCCAAACATTGAC
CCCACAGAAGAAAATGATTTGGATGATTCTTTAAGTGTAAAAAATGGTGATAGTAGTAATGACTTTGTGACTTGCAATGATATCAATGAA
GATGATTTTGGTGATTTTGGTGACTTTGGCTCTGCCAGTGGCTCAACTCCACCTTTTGTTACTGGTACTCAAGATTCAATGAGTGATGCC
ACTTTTGAAGAGTCTTCAGAGCACTTTCCACATTTTAGTGAACCAGGTGATGACTTTGGAGAATTTGGGGATATAAATGCTGTTTCTTGC
CAAGAGGAGACAATATTAACAAAGTCAGACCTAAAACAGACTTCTGATAATTTATCAGAAGAATGTCAATTGGCAAGAAAATCTAGTGGA
ACAGGCACTGAACCTGTTGCAAAACTTAAAAATGGGCAAGAAGGTGAGATTGGACATTTTGATTCTGTGCCAAATATTCAGGATGACTGC
AATGGTTTTCAAGACTCTGATGATTTTGCAGACTTCAGTTCAGCTGGTCCTAGCCAAGTTGTAGATTGGAATGCTTTTGAGGATGAACAA
AAAGATAGTTGTTCTTGGGCTGCTTTTGGAGACCAGCAGGCTACTGAATCTCATCATCGAAAGGAAGCCTGGCAGTCACATAGGACAGAT
GAAAATATTGATACTCCAGGAACCCCCAAAACGCACAGTGTACCTTCAGCAACTTCCAAAGGAGCAGTTGCTAGTGGCCATTTACAGGAA
TCAGCCACTTCAGTTCAGACAGCTTTATTAAACCGCCTGGAGCGAATTTTCGAAGCATGTTTTCCTTCCATACTTGTCCCTGATGCTGAA
GAGGAAGTTACTTCCCTGAAGCACTTGCTGGAAACAAGCACTTTGCCAATAAAAACGAGAGAGGCCTTACCTGAAAGTGGGGAATTGCTA
GATGTGTGGACTGAGCTACAGGATATCCATGATGCACATGGCTTGAGATACCAGTGGGGCGGCTCCCATAGCAACAAGAAGCTTTTGTCC


* Fusion transcript sequences (Full-length transcript).
>In-frame_AFTPH_ENST00000238855_chr2_64796813_+_ELF1_ENST00000442101_chr13_41556418_-_6106nt
GCATGATGGGAGAGTGTGTGGAGTGGGCGGGGGGTCTCCGCGGAGGAGGTGGAGGAGGCGGCGGCGGCGGCGGAAGAGGGCGGAGGGTAG
TGGGATGGGGGTCCCGCGGCAGCGGTGAAACTCCGGGTGGGCGTCCATGGTGCTGCTGCGCTGACAGGGCTGTGAGCAGCCGGCCTTCCG
CTCTCACCAGTTCCGCGTCGGAATAGACGGTCCTTCCCCGGGGAGTCAGTTCCTCCCCGGGCCCCTGAGCCATGCCCATCGCAGCCGCCC
CGAAGGAGCCAGGTGTAAATTAATTATTTGAAAGCAACTGAACAATGGAGCCAGACATCATTCGAATGTACTCTTCATCCCCACCACCAT
TAGACAATGGAGCAGAGGATGATGATGATGATGAATTTGGGGAATTTGGTGGGTTTTCAGAAGTTAGCCCTTCTGGTGTAGGGTTTGTTG
ATTTCGATACACCAGATTATACTCGTCCCAAGGAAGAGTTTGTACCTTCAAACCATTTTATGCCAATTCATGAATTCTCAGAAAATGTAG
ATAGCCTTACAAGCTTTAAGTCCATTAAAAATGGTAATGATAAGGACATCACTGCTGAACTTTCTGCTCCTGTGAAAGGACAGTCTGATG
TTTTACTTTCTACCACCAGCAAAGAAATAATTTCATCTGAAATGTTAGCTACTTCCATTGATGGCATGGAAAGACCAGGAAATTTAAATA
AAGTAGTGGAGCAGAGACAGAATGTTGGAACACTTGAAAGTTTCTCTCCAGGAGATTTTAGAACTAATATGAATGTTGTTCATCAAAACA
AGCAGTTAGAGAGCTGCAATGGTGAAAAGCCTCCTTGTCTGGAGATTCTAACAAATGGGTTTGCAGTGTTGGAAACTGTAAATCCTCAGG
GAACAGATGATCTGGACAATGTAGCTGATTCAAAGGGACGGAAGCCTCTTAGCACTCATAGCACTGAGTATAATTTAGACTCTGTACCTA
GTCCTGCTGAGGAATTTGCAGATTTTGCCACATTTTCCAAAAAGGAAAGGATACAATTAGAAGAAATAGAATGTGCAGTTTTAAATGATA
GAGAAGCACTAACCATTCGGGAAAACAATAAAATTAATAGAGTCAATGAACTGAATTCTGTAAAAGAAGTGGCTTTGGGTAGAAGCTTGG
ATAACAAAGGAGACACTGATGGAGAGGATCAGGTTTGTGTTTCAGAAATAAGCATAGTGACTAACAGAGGTTTCAGTGTTGAAAAACAAG
GCCTTCCAACACTGCAACAGGATGAATTTTTACAGTCAGGTGTTCAGTCAAAGGCTTGGAGTTTGGTAGACTCAGCTGATAATTCAGAAG
CCATTAGGAGAGAACAATGTAAAACTGAAGAAAAACTTGACTTACTTACTTCTAAATGTGCTCACCTATGCATGGATTCTGTTAAAACTT
CTGATGATGAAGTTGGTTCTCCCAAAGAAGAAAGTAGAAAGTTTACTAATTTCCAAAGCCCAAACATTGACCCCACAGAAGAAAATGATT
TGGATGATTCTTTAAGTGTAAAAAATGGTGATAGTAGTAATGACTTTGTGACTTGCAATGATATCAATGAAGATGATTTTGGTGATTTTG
GTGACTTTGGCTCTGCCAGTGGCTCAACTCCACCTTTTGTTACTGGTACTCAAGATTCAATGAGTGATGCCACTTTTGAAGAGTCTTCAG
AGCACTTTCCACATTTTAGTGAACCAGGTGATGACTTTGGAGAATTTGGGGATATAAATGCTGTTTCTTGCCAAGAGGAGACAATATTAA
CAAAGTCAGACCTAAAACAGACTTCTGATAATTTATCAGAAGAATGTCAATTGGCAAGAAAATCTAGTGGAACAGGCACTGAACCTGTTG
CAAAACTTAAAAATGGGCAAGAAGGTGAGATTGGACATTTTGATTCTGTGCCAAATATTCAGGATGACTGCAATGGTTTTCAAGACTCTG
ATGATTTTGCAGACTTCAGTTCAGCTGGTCCTAGCCAAGTTGTAGATTGGAATGCTTTTGAGGATGAACAAAAAGATAGTTGTTCTTGGG
CTGCTTTTGGAGACCAGCAGGCTACTGAATCTCATCATCGAAAGGAAGCCTGGCAGTCACATAGGACAGATGAAAATATTGATACTCCAG
GAACCCCCAAAACGCACAGTGTACCTTCAGCAACTTCCAAAGGAGCAGTTGCTAGTGGCCATTTACAGGAATCAGCCACTTCAGTTCAGA
CAGCTTTATTAAACCGCCTGGAGCGAATTTTCGAAGCATGTTTTCCTTCCATACTTGTCCCTGATGCTGAAGAGGAAGTTACTTCCCTGA
AGCACTTGCTGGAAACAAGCACTTTGCCAATAAAAACGAGAGAGGCCTTACCTGAAAGTGGGGAATTGCTAGATGTGTGGACTGAGCTAC
AGGATATCCATGATGCACATGGCTTGAGATACCAGTGGGGCGGCTCCCATAGCAACAAGAAGCTTTTGTCCTCCTTGGGAATAGACACCC
GAAACATTCTCTTCACGGGCAATAAGAAGCAGCCTGTTATAGTGCCCATGTATGCAGCAGGATTGGCCAAGAAGCTTGAGAGAAGAAAAA
TTTCAGAAAAATTGTCTCAATTTGACTAGAATATCAATGAACCAGGAAAACTGAAGCACCTTCCCTAAAGAAAACTTGGGTATACAATTA
CTCCACAGACAGAGCTGAGGGTTTTTTACCCAAATCAGTCACTGGATTTTGCTGCCTGATACGTGAATCTTCTTGGAATTTTTCTCATGT
GGATCTAAGGGGAATGCTTTATTATGGCTGCTGTTGTCCAACAGAACGACCTAGTATTTGAATTTGCTAGTAACGTCATGGAGGATGAAC
GACAGCTTGGTGATCCAGCTATTTTTCCTGCCGTAATTGTGGAACATGTTCCTGGTGCTGATATTCTCAATAGTTATGCCGGTCTAGCCT
GTGTGGAAGAGCCCAATGACATGATTACTGAGAGTTCACTGGATGTTGCTGAAGAAGAAATCATAGACGATGATGATGATGACATCACCC
TTACAGTTGAAGCTTCTTGTCATGACGGGGATGAAACAATTGAAACTATTGAGGCTGCTGAGGCACTCCTCAATATGGATTCCCCTGGCC
CTATGCTGGATGAAAAACGAATAAATGGGATTCCTGAAGTGATGGAAACACAGCAGGTGCAAGAAAAATATGCAGACTCACCGGGAGCCT
CATCACCAGAACAGCCTAAGAGGAAAAAAGGAAGAAAAACTAAACCACCACGACCAGATTCCCCAGCCACTACGCCAAATATATCTGTGA
AGAAGAAAAACAAAGATGGAAAGGGAAACACAATTTATCTTTGGGAGTTTTTACTGGCACTGCTCCAGGACAAGGCTACTTGTCCTAAAT
ACATCAAGTGGACCCAGCGAGAGAAAGGCATTTTTAAATTGGTGGATTCTAAAGCAGTGTCCAGGTTGTGGGGGAAGCACAAAAACAAAC
CTGATATGAATTATGAGACCATGGGAAGAGCACTCAGGTACTATTACCAAAGGGGTATTCTGGCAAAAGTGGAAGGTCAGCGCTTGGTGT
ATCAGTTTAAAGAAATGCCAAAAGATCTTATATATATAAATGATGAGGATCCAAGTTCCAGCATAGAGTCTTCAGATCCATCGCTATCTT
CATCAGCCACTTCAAATAGGAATCAAACCAGCCGGTCGAGAGTATCTTCAAGTCCAGGGGTAAAAGGAGGAGCCACTACAGTTCTAAAAC
CAGGGAATTCTAAAGCTGCAAAACCCAAAGATCCTGTGGAAGTTGCACAACCATCAGAAGTTTTGAGGACAGTGCAGCCCACGCAGTCTC
CATATCCTACCCAGCTCTTCCGGACTGTTCATGTAGTACAGCCAGTACAGGCTGTCCCAGAGGGAGAAGCAGCTAGAACCAGTACCATGC
AGGATGAAACATTAAATTCTTCCGTTCAGAGTATTAGGACTATACAGGCTCCAACCCAAGTTCCAGTGGTTGTGTCTCCTAGGAATCAGC
AGTTGCATACAGTAACACTCCAAACAGTGCCACTCACAACAGTTATAGCCAGCACAGATCCATCAGCAGGTACTGGATCTCAGAAGTTTA
TTTTACAAGCCATTCCATCATCACAGCCCATGACAGTACTGAAAGAAAATGTCATGCTGCAGTCACAAAAGGCGGGCTCTCCTCCTTCAA
TTGTCTTGGGCCCTGCCCAGGTTCAGCAGGTCCTTACTAGCAATGTTCAGACCATTTGCAATGGAACCGTCAGTGTGGCTTCCTCTCCAT
CCTTCAGTGCTACTGCACCTGTGGTGACCTTTTCTCCTCGCAGTTCACAGCTGGTTGCTCACCCACCTGGCACTGTAATCACTTCAGTTA
TCAAAACTCAAGAAACAAAAACTCTTACACAGGAAGTAGAGAAAAAGGAATCTGAAGATCATTTGAAAGAGAACACTGAGAAAACGGAGC
AGCAGCCACAGCCTTATGTGATGGTAGTGTCCAGTTCCAATGGATTTACTTCTCAGGTAGCTATGAAACAAAACGAACTGCTGGAACCCA
ACTCTTTTTAGTTAATATACCAAAGCTTATGAATAATTGTTTGTTAATTGAACATTTTCAATTATATGCAGACTGACTGATTCTAAGATA
AATTCTAAGGAGGTTTCTAATTTTGTAATTGTTAAAAATAGAGTTAATTTTGACTTTGTTAGATGAGGGAGGAAAACTCAACTGTTTCTC
TTTGTTATCTAAATGTTTCAGAATTCAATCGTGAAGGAACAGGCATTTTACACTATGAAGACATTCTTTTGAGATTTTTATTTCAGTTGC
TATATCATAAGCATTTTTAAAGTTTCTTTTCTAATTTTACATTGTATTAGATTTTCTGATTCTTTTGTAAATACAGAACTTAAATAGAAG
GCAACAGGAAATTTATATAGGAACTATTTTCATTCCACTTGTGTAAGTTAAGTCTTGACTCTTTCAAATGCAAAAAACCTATTTTATGCT
TTGTTAAAATTATGGTGTCACTTAGATTGACTTTAGTTGACTGCACTATATAATATAGAACTATGAATATGTAGAATAACATGAAAAATT
GGAGGTGCTGGTGGTATGGCTGACCCTGTTTCAGAAGCAGGATAGTATAAAAGCATCAGCCTAAGAATGGCACTCCCACTAACTAGCTAT
GTAATCTTGACCTCTTTGGGCTTTAGTTCCTCTCATAAAAGGAAGAGATGTATTGGATTAGACTAGATGATCACCACTTTCTCTTCTAGT
TCTAATTTTTTTAATTCTAATACCTATATTTTCAAGTTATGTCAATTAAATCATTATCAGGTTATTTCCTAATGTAAGAATAGCTAAAAT
GTTGCAGAGAAATAAGTGACCCAACAAAATTTATTCATCTGTTATGGGTAAGATCTGCCATAAATTCTTCCTAAATAATTTGTTTACTAA
CTCTTTAGGCCACTGTGCTTTGCGGTCCATTAGTAAACTTGTGTTGCTAAGTGCTAAACAGAATACTGCTATTTTGAGAGAGTCAAGACT
CTTTCTTAAGGGCCAAGAAAGCAACTTGAGCCTTGGGCTAATCTGGCTGAGTAGTCAGTTATAAAAGCATAATTGCTTTATATTTTGGAT
CATTTTTTACTGGGGGCGGACTTGGGGGGGGTTGCATACAAAGATAACATATATATCCAACTTTCTGAAATGAAATGTTTTTAGATTACT
TTTTCAACTGTAAATAATGTACATTTAATGTCACAAGAAAAAAATGTCTTCTGCAAATTTTCTAGTATAACAGAAATTTTTGTAGATGAA
AAAAATCATTATGTTTAGAGGTCTAATGCTATGTTTTCATATTACAGAGTGAATTTGTATTTAAACAAAAATTTAAATTTTGGAATCCTC
TAAACATTTTTGTATCTTTAATTGGTTTATTATTAAATAAATCATATAAAAATTCTCAGTGTCTGTTTTCAGGCAAAAGTTTCTTAAAGA

>In-frame_AFTPH_ENST00000422803_chr2_64796813_+_ELF1_ENST00000442101_chr13_41556418_-_6106nt
GCATGATGGGAGAGTGTGTGGAGTGGGCGGGGGGTCTCCGCGGAGGAGGTGGAGGAGGCGGCGGCGGCGGCGGAAGAGGGCGGAGGGTAG
TGGGATGGGGGTCCCGCGGCAGCGGTGAAACTCCGGGTGGGCGTCCATGGTGCTGCTGCGCTGACAGGGCTGTGAGCAGCCGGCCTTCCG
CTCTCACCAGTTCCGCGTCGGAATAGACGGTCCTTCCCCGGGGAGTCAGTTCCTCCCCGGGCCCCTGAGCCATGCCCATCGCAGCCGCCC
CGAAGGAGCCAGGTGTAAATTAATTATTTGAAAGCAACTGAACAATGGAGCCAGACATCATTCGAATGTACTCTTCATCCCCACCACCAT
TAGACAATGGAGCAGAGGATGATGATGATGATGAATTTGGGGAATTTGGTGGGTTTTCAGAAGTTAGCCCTTCTGGTGTAGGGTTTGTTG
ATTTCGATACACCAGATTATACTCGTCCCAAGGAAGAGTTTGTACCTTCAAACCATTTTATGCCAATTCATGAATTCTCAGAAAATGTAG
ATAGCCTTACAAGCTTTAAGTCCATTAAAAATGGTAATGATAAGGACATCACTGCTGAACTTTCTGCTCCTGTGAAAGGACAGTCTGATG
TTTTACTTTCTACCACCAGCAAAGAAATAATTTCATCTGAAATGTTAGCTACTTCCATTGATGGCATGGAAAGACCAGGAAATTTAAATA
AAGTAGTGGAGCAGAGACAGAATGTTGGAACACTTGAAAGTTTCTCTCCAGGAGATTTTAGAACTAATATGAATGTTGTTCATCAAAACA
AGCAGTTAGAGAGCTGCAATGGTGAAAAGCCTCCTTGTCTGGAGATTCTAACAAATGGGTTTGCAGTGTTGGAAACTGTAAATCCTCAGG
GAACAGATGATCTGGACAATGTAGCTGATTCAAAGGGACGGAAGCCTCTTAGCACTCATAGCACTGAGTATAATTTAGACTCTGTACCTA
GTCCTGCTGAGGAATTTGCAGATTTTGCCACATTTTCCAAAAAGGAAAGGATACAATTAGAAGAAATAGAATGTGCAGTTTTAAATGATA
GAGAAGCACTAACCATTCGGGAAAACAATAAAATTAATAGAGTCAATGAACTGAATTCTGTAAAAGAAGTGGCTTTGGGTAGAAGCTTGG
ATAACAAAGGAGACACTGATGGAGAGGATCAGGTTTGTGTTTCAGAAATAAGCATAGTGACTAACAGAGGTTTCAGTGTTGAAAAACAAG
GCCTTCCAACACTGCAACAGGATGAATTTTTACAGTCAGGTGTTCAGTCAAAGGCTTGGAGTTTGGTAGACTCAGCTGATAATTCAGAAG
CCATTAGGAGAGAACAATGTAAAACTGAAGAAAAACTTGACTTACTTACTTCTAAATGTGCTCACCTATGCATGGATTCTGTTAAAACTT
CTGATGATGAAGTTGGTTCTCCCAAAGAAGAAAGTAGAAAGTTTACTAATTTCCAAAGCCCAAACATTGACCCCACAGAAGAAAATGATT
TGGATGATTCTTTAAGTGTAAAAAATGGTGATAGTAGTAATGACTTTGTGACTTGCAATGATATCAATGAAGATGATTTTGGTGATTTTG
GTGACTTTGGCTCTGCCAGTGGCTCAACTCCACCTTTTGTTACTGGTACTCAAGATTCAATGAGTGATGCCACTTTTGAAGAGTCTTCAG
AGCACTTTCCACATTTTAGTGAACCAGGTGATGACTTTGGAGAATTTGGGGATATAAATGCTGTTTCTTGCCAAGAGGAGACAATATTAA
CAAAGTCAGACCTAAAACAGACTTCTGATAATTTATCAGAAGAATGTCAATTGGCAAGAAAATCTAGTGGAACAGGCACTGAACCTGTTG
CAAAACTTAAAAATGGGCAAGAAGGTGAGATTGGACATTTTGATTCTGTGCCAAATATTCAGGATGACTGCAATGGTTTTCAAGACTCTG
ATGATTTTGCAGACTTCAGTTCAGCTGGTCCTAGCCAAGTTGTAGATTGGAATGCTTTTGAGGATGAACAAAAAGATAGTTGTTCTTGGG
CTGCTTTTGGAGACCAGCAGGCTACTGAATCTCATCATCGAAAGGAAGCCTGGCAGTCACATAGGACAGATGAAAATATTGATACTCCAG
GAACCCCCAAAACGCACAGTGTACCTTCAGCAACTTCCAAAGGAGCAGTTGCTAGTGGCCATTTACAGGAATCAGCCACTTCAGTTCAGA
CAGCTTTATTAAACCGCCTGGAGCGAATTTTCGAAGCATGTTTTCCTTCCATACTTGTCCCTGATGCTGAAGAGGAAGTTACTTCCCTGA
AGCACTTGCTGGAAACAAGCACTTTGCCAATAAAAACGAGAGAGGCCTTACCTGAAAGTGGGGAATTGCTAGATGTGTGGACTGAGCTAC
AGGATATCCATGATGCACATGGCTTGAGATACCAGTGGGGCGGCTCCCATAGCAACAAGAAGCTTTTGTCCTCCTTGGGAATAGACACCC
GAAACATTCTCTTCACGGGCAATAAGAAGCAGCCTGTTATAGTGCCCATGTATGCAGCAGGATTGGCCAAGAAGCTTGAGAGAAGAAAAA
TTTCAGAAAAATTGTCTCAATTTGACTAGAATATCAATGAACCAGGAAAACTGAAGCACCTTCCCTAAAGAAAACTTGGGTATACAATTA
CTCCACAGACAGAGCTGAGGGTTTTTTACCCAAATCAGTCACTGGATTTTGCTGCCTGATACGTGAATCTTCTTGGAATTTTTCTCATGT
GGATCTAAGGGGAATGCTTTATTATGGCTGCTGTTGTCCAACAGAACGACCTAGTATTTGAATTTGCTAGTAACGTCATGGAGGATGAAC
GACAGCTTGGTGATCCAGCTATTTTTCCTGCCGTAATTGTGGAACATGTTCCTGGTGCTGATATTCTCAATAGTTATGCCGGTCTAGCCT
GTGTGGAAGAGCCCAATGACATGATTACTGAGAGTTCACTGGATGTTGCTGAAGAAGAAATCATAGACGATGATGATGATGACATCACCC
TTACAGTTGAAGCTTCTTGTCATGACGGGGATGAAACAATTGAAACTATTGAGGCTGCTGAGGCACTCCTCAATATGGATTCCCCTGGCC
CTATGCTGGATGAAAAACGAATAAATGGGATTCCTGAAGTGATGGAAACACAGCAGGTGCAAGAAAAATATGCAGACTCACCGGGAGCCT
CATCACCAGAACAGCCTAAGAGGAAAAAAGGAAGAAAAACTAAACCACCACGACCAGATTCCCCAGCCACTACGCCAAATATATCTGTGA
AGAAGAAAAACAAAGATGGAAAGGGAAACACAATTTATCTTTGGGAGTTTTTACTGGCACTGCTCCAGGACAAGGCTACTTGTCCTAAAT
ACATCAAGTGGACCCAGCGAGAGAAAGGCATTTTTAAATTGGTGGATTCTAAAGCAGTGTCCAGGTTGTGGGGGAAGCACAAAAACAAAC
CTGATATGAATTATGAGACCATGGGAAGAGCACTCAGGTACTATTACCAAAGGGGTATTCTGGCAAAAGTGGAAGGTCAGCGCTTGGTGT
ATCAGTTTAAAGAAATGCCAAAAGATCTTATATATATAAATGATGAGGATCCAAGTTCCAGCATAGAGTCTTCAGATCCATCGCTATCTT
CATCAGCCACTTCAAATAGGAATCAAACCAGCCGGTCGAGAGTATCTTCAAGTCCAGGGGTAAAAGGAGGAGCCACTACAGTTCTAAAAC
CAGGGAATTCTAAAGCTGCAAAACCCAAAGATCCTGTGGAAGTTGCACAACCATCAGAAGTTTTGAGGACAGTGCAGCCCACGCAGTCTC
CATATCCTACCCAGCTCTTCCGGACTGTTCATGTAGTACAGCCAGTACAGGCTGTCCCAGAGGGAGAAGCAGCTAGAACCAGTACCATGC
AGGATGAAACATTAAATTCTTCCGTTCAGAGTATTAGGACTATACAGGCTCCAACCCAAGTTCCAGTGGTTGTGTCTCCTAGGAATCAGC
AGTTGCATACAGTAACACTCCAAACAGTGCCACTCACAACAGTTATAGCCAGCACAGATCCATCAGCAGGTACTGGATCTCAGAAGTTTA
TTTTACAAGCCATTCCATCATCACAGCCCATGACAGTACTGAAAGAAAATGTCATGCTGCAGTCACAAAAGGCGGGCTCTCCTCCTTCAA
TTGTCTTGGGCCCTGCCCAGGTTCAGCAGGTCCTTACTAGCAATGTTCAGACCATTTGCAATGGAACCGTCAGTGTGGCTTCCTCTCCAT
CCTTCAGTGCTACTGCACCTGTGGTGACCTTTTCTCCTCGCAGTTCACAGCTGGTTGCTCACCCACCTGGCACTGTAATCACTTCAGTTA
TCAAAACTCAAGAAACAAAAACTCTTACACAGGAAGTAGAGAAAAAGGAATCTGAAGATCATTTGAAAGAGAACACTGAGAAAACGGAGC
AGCAGCCACAGCCTTATGTGATGGTAGTGTCCAGTTCCAATGGATTTACTTCTCAGGTAGCTATGAAACAAAACGAACTGCTGGAACCCA
ACTCTTTTTAGTTAATATACCAAAGCTTATGAATAATTGTTTGTTAATTGAACATTTTCAATTATATGCAGACTGACTGATTCTAAGATA
AATTCTAAGGAGGTTTCTAATTTTGTAATTGTTAAAAATAGAGTTAATTTTGACTTTGTTAGATGAGGGAGGAAAACTCAACTGTTTCTC
TTTGTTATCTAAATGTTTCAGAATTCAATCGTGAAGGAACAGGCATTTTACACTATGAAGACATTCTTTTGAGATTTTTATTTCAGTTGC
TATATCATAAGCATTTTTAAAGTTTCTTTTCTAATTTTACATTGTATTAGATTTTCTGATTCTTTTGTAAATACAGAACTTAAATAGAAG
GCAACAGGAAATTTATATAGGAACTATTTTCATTCCACTTGTGTAAGTTAAGTCTTGACTCTTTCAAATGCAAAAAACCTATTTTATGCT
TTGTTAAAATTATGGTGTCACTTAGATTGACTTTAGTTGACTGCACTATATAATATAGAACTATGAATATGTAGAATAACATGAAAAATT
GGAGGTGCTGGTGGTATGGCTGACCCTGTTTCAGAAGCAGGATAGTATAAAAGCATCAGCCTAAGAATGGCACTCCCACTAACTAGCTAT
GTAATCTTGACCTCTTTGGGCTTTAGTTCCTCTCATAAAAGGAAGAGATGTATTGGATTAGACTAGATGATCACCACTTTCTCTTCTAGT
TCTAATTTTTTTAATTCTAATACCTATATTTTCAAGTTATGTCAATTAAATCATTATCAGGTTATTTCCTAATGTAAGAATAGCTAAAAT
GTTGCAGAGAAATAAGTGACCCAACAAAATTTATTCATCTGTTATGGGTAAGATCTGCCATAAATTCTTCCTAAATAATTTGTTTACTAA
CTCTTTAGGCCACTGTGCTTTGCGGTCCATTAGTAAACTTGTGTTGCTAAGTGCTAAACAGAATACTGCTATTTTGAGAGAGTCAAGACT
CTTTCTTAAGGGCCAAGAAAGCAACTTGAGCCTTGGGCTAATCTGGCTGAGTAGTCAGTTATAAAAGCATAATTGCTTTATATTTTGGAT
CATTTTTTACTGGGGGCGGACTTGGGGGGGGTTGCATACAAAGATAACATATATATCCAACTTTCTGAAATGAAATGTTTTTAGATTACT
TTTTCAACTGTAAATAATGTACATTTAATGTCACAAGAAAAAAATGTCTTCTGCAAATTTTCTAGTATAACAGAAATTTTTGTAGATGAA
AAAAATCATTATGTTTAGAGGTCTAATGCTATGTTTTCATATTACAGAGTGAATTTGTATTTAAACAAAAATTTAAATTTTGGAATCCTC
TAAACATTTTTGTATCTTTAATTGGTTTATTATTAAATAAATCATATAAAAATTCTCAGTGTCTGTTTTCAGGCAAAAGTTTCTTAAAGA

>In-frame_AFTPH_ENST00000238856_chr2_64796813_+_ELF1_ENST00000442101_chr13_41556418_-_6106nt
GCATGATGGGAGAGTGTGTGGAGTGGGCGGGGGGTCTCCGCGGAGGAGGTGGAGGAGGCGGCGGCGGCGGCGGAAGAGGGCGGAGGGTAG
TGGGATGGGGGTCCCGCGGCAGCGGTGAAACTCCGGGTGGGCGTCCATGGTGCTGCTGCGCTGACAGGGCTGTGAGCAGCCGGCCTTCCG
CTCTCACCAGTTCCGCGTCGGAATAGACGGTCCTTCCCCGGGGAGTCAGTTCCTCCCCGGGCCCCTGAGCCATGCCCATCGCAGCCGCCC
CGAAGGAGCCAGGTGTAAATTAATTATTTGAAAGCAACTGAACAATGGAGCCAGACATCATTCGAATGTACTCTTCATCCCCACCACCAT
TAGACAATGGAGCAGAGGATGATGATGATGATGAATTTGGGGAATTTGGTGGGTTTTCAGAAGTTAGCCCTTCTGGTGTAGGGTTTGTTG
ATTTCGATACACCAGATTATACTCGTCCCAAGGAAGAGTTTGTACCTTCAAACCATTTTATGCCAATTCATGAATTCTCAGAAAATGTAG
ATAGCCTTACAAGCTTTAAGTCCATTAAAAATGGTAATGATAAGGACATCACTGCTGAACTTTCTGCTCCTGTGAAAGGACAGTCTGATG
TTTTACTTTCTACCACCAGCAAAGAAATAATTTCATCTGAAATGTTAGCTACTTCCATTGATGGCATGGAAAGACCAGGAAATTTAAATA
AAGTAGTGGAGCAGAGACAGAATGTTGGAACACTTGAAAGTTTCTCTCCAGGAGATTTTAGAACTAATATGAATGTTGTTCATCAAAACA
AGCAGTTAGAGAGCTGCAATGGTGAAAAGCCTCCTTGTCTGGAGATTCTAACAAATGGGTTTGCAGTGTTGGAAACTGTAAATCCTCAGG
GAACAGATGATCTGGACAATGTAGCTGATTCAAAGGGACGGAAGCCTCTTAGCACTCATAGCACTGAGTATAATTTAGACTCTGTACCTA
GTCCTGCTGAGGAATTTGCAGATTTTGCCACATTTTCCAAAAAGGAAAGGATACAATTAGAAGAAATAGAATGTGCAGTTTTAAATGATA
GAGAAGCACTAACCATTCGGGAAAACAATAAAATTAATAGAGTCAATGAACTGAATTCTGTAAAAGAAGTGGCTTTGGGTAGAAGCTTGG
ATAACAAAGGAGACACTGATGGAGAGGATCAGGTTTGTGTTTCAGAAATAAGCATAGTGACTAACAGAGGTTTCAGTGTTGAAAAACAAG
GCCTTCCAACACTGCAACAGGATGAATTTTTACAGTCAGGTGTTCAGTCAAAGGCTTGGAGTTTGGTAGACTCAGCTGATAATTCAGAAG
CCATTAGGAGAGAACAATGTAAAACTGAAGAAAAACTTGACTTACTTACTTCTAAATGTGCTCACCTATGCATGGATTCTGTTAAAACTT
CTGATGATGAAGTTGGTTCTCCCAAAGAAGAAAGTAGAAAGTTTACTAATTTCCAAAGCCCAAACATTGACCCCACAGAAGAAAATGATT
TGGATGATTCTTTAAGTGTAAAAAATGGTGATAGTAGTAATGACTTTGTGACTTGCAATGATATCAATGAAGATGATTTTGGTGATTTTG
GTGACTTTGGCTCTGCCAGTGGCTCAACTCCACCTTTTGTTACTGGTACTCAAGATTCAATGAGTGATGCCACTTTTGAAGAGTCTTCAG
AGCACTTTCCACATTTTAGTGAACCAGGTGATGACTTTGGAGAATTTGGGGATATAAATGCTGTTTCTTGCCAAGAGGAGACAATATTAA
CAAAGTCAGACCTAAAACAGACTTCTGATAATTTATCAGAAGAATGTCAATTGGCAAGAAAATCTAGTGGAACAGGCACTGAACCTGTTG
CAAAACTTAAAAATGGGCAAGAAGGTGAGATTGGACATTTTGATTCTGTGCCAAATATTCAGGATGACTGCAATGGTTTTCAAGACTCTG
ATGATTTTGCAGACTTCAGTTCAGCTGGTCCTAGCCAAGTTGTAGATTGGAATGCTTTTGAGGATGAACAAAAAGATAGTTGTTCTTGGG
CTGCTTTTGGAGACCAGCAGGCTACTGAATCTCATCATCGAAAGGAAGCCTGGCAGTCACATAGGACAGATGAAAATATTGATACTCCAG
GAACCCCCAAAACGCACAGTGTACCTTCAGCAACTTCCAAAGGAGCAGTTGCTAGTGGCCATTTACAGGAATCAGCCACTTCAGTTCAGA
CAGCTTTATTAAACCGCCTGGAGCGAATTTTCGAAGCATGTTTTCCTTCCATACTTGTCCCTGATGCTGAAGAGGAAGTTACTTCCCTGA
AGCACTTGCTGGAAACAAGCACTTTGCCAATAAAAACGAGAGAGGCCTTACCTGAAAGTGGGGAATTGCTAGATGTGTGGACTGAGCTAC
AGGATATCCATGATGCACATGGCTTGAGATACCAGTGGGGCGGCTCCCATAGCAACAAGAAGCTTTTGTCCTCCTTGGGAATAGACACCC
GAAACATTCTCTTCACGGGCAATAAGAAGCAGCCTGTTATAGTGCCCATGTATGCAGCAGGATTGGCCAAGAAGCTTGAGAGAAGAAAAA
TTTCAGAAAAATTGTCTCAATTTGACTAGAATATCAATGAACCAGGAAAACTGAAGCACCTTCCCTAAAGAAAACTTGGGTATACAATTA
CTCCACAGACAGAGCTGAGGGTTTTTTACCCAAATCAGTCACTGGATTTTGCTGCCTGATACGTGAATCTTCTTGGAATTTTTCTCATGT
GGATCTAAGGGGAATGCTTTATTATGGCTGCTGTTGTCCAACAGAACGACCTAGTATTTGAATTTGCTAGTAACGTCATGGAGGATGAAC
GACAGCTTGGTGATCCAGCTATTTTTCCTGCCGTAATTGTGGAACATGTTCCTGGTGCTGATATTCTCAATAGTTATGCCGGTCTAGCCT
GTGTGGAAGAGCCCAATGACATGATTACTGAGAGTTCACTGGATGTTGCTGAAGAAGAAATCATAGACGATGATGATGATGACATCACCC
TTACAGTTGAAGCTTCTTGTCATGACGGGGATGAAACAATTGAAACTATTGAGGCTGCTGAGGCACTCCTCAATATGGATTCCCCTGGCC
CTATGCTGGATGAAAAACGAATAAATGGGATTCCTGAAGTGATGGAAACACAGCAGGTGCAAGAAAAATATGCAGACTCACCGGGAGCCT
CATCACCAGAACAGCCTAAGAGGAAAAAAGGAAGAAAAACTAAACCACCACGACCAGATTCCCCAGCCACTACGCCAAATATATCTGTGA
AGAAGAAAAACAAAGATGGAAAGGGAAACACAATTTATCTTTGGGAGTTTTTACTGGCACTGCTCCAGGACAAGGCTACTTGTCCTAAAT
ACATCAAGTGGACCCAGCGAGAGAAAGGCATTTTTAAATTGGTGGATTCTAAAGCAGTGTCCAGGTTGTGGGGGAAGCACAAAAACAAAC
CTGATATGAATTATGAGACCATGGGAAGAGCACTCAGGTACTATTACCAAAGGGGTATTCTGGCAAAAGTGGAAGGTCAGCGCTTGGTGT
ATCAGTTTAAAGAAATGCCAAAAGATCTTATATATATAAATGATGAGGATCCAAGTTCCAGCATAGAGTCTTCAGATCCATCGCTATCTT
CATCAGCCACTTCAAATAGGAATCAAACCAGCCGGTCGAGAGTATCTTCAAGTCCAGGGGTAAAAGGAGGAGCCACTACAGTTCTAAAAC
CAGGGAATTCTAAAGCTGCAAAACCCAAAGATCCTGTGGAAGTTGCACAACCATCAGAAGTTTTGAGGACAGTGCAGCCCACGCAGTCTC
CATATCCTACCCAGCTCTTCCGGACTGTTCATGTAGTACAGCCAGTACAGGCTGTCCCAGAGGGAGAAGCAGCTAGAACCAGTACCATGC
AGGATGAAACATTAAATTCTTCCGTTCAGAGTATTAGGACTATACAGGCTCCAACCCAAGTTCCAGTGGTTGTGTCTCCTAGGAATCAGC
AGTTGCATACAGTAACACTCCAAACAGTGCCACTCACAACAGTTATAGCCAGCACAGATCCATCAGCAGGTACTGGATCTCAGAAGTTTA
TTTTACAAGCCATTCCATCATCACAGCCCATGACAGTACTGAAAGAAAATGTCATGCTGCAGTCACAAAAGGCGGGCTCTCCTCCTTCAA
TTGTCTTGGGCCCTGCCCAGGTTCAGCAGGTCCTTACTAGCAATGTTCAGACCATTTGCAATGGAACCGTCAGTGTGGCTTCCTCTCCAT
CCTTCAGTGCTACTGCACCTGTGGTGACCTTTTCTCCTCGCAGTTCACAGCTGGTTGCTCACCCACCTGGCACTGTAATCACTTCAGTTA
TCAAAACTCAAGAAACAAAAACTCTTACACAGGAAGTAGAGAAAAAGGAATCTGAAGATCATTTGAAAGAGAACACTGAGAAAACGGAGC
AGCAGCCACAGCCTTATGTGATGGTAGTGTCCAGTTCCAATGGATTTACTTCTCAGGTAGCTATGAAACAAAACGAACTGCTGGAACCCA
ACTCTTTTTAGTTAATATACCAAAGCTTATGAATAATTGTTTGTTAATTGAACATTTTCAATTATATGCAGACTGACTGATTCTAAGATA
AATTCTAAGGAGGTTTCTAATTTTGTAATTGTTAAAAATAGAGTTAATTTTGACTTTGTTAGATGAGGGAGGAAAACTCAACTGTTTCTC
TTTGTTATCTAAATGTTTCAGAATTCAATCGTGAAGGAACAGGCATTTTACACTATGAAGACATTCTTTTGAGATTTTTATTTCAGTTGC
TATATCATAAGCATTTTTAAAGTTTCTTTTCTAATTTTACATTGTATTAGATTTTCTGATTCTTTTGTAAATACAGAACTTAAATAGAAG
GCAACAGGAAATTTATATAGGAACTATTTTCATTCCACTTGTGTAAGTTAAGTCTTGACTCTTTCAAATGCAAAAAACCTATTTTATGCT
TTGTTAAAATTATGGTGTCACTTAGATTGACTTTAGTTGACTGCACTATATAATATAGAACTATGAATATGTAGAATAACATGAAAAATT
GGAGGTGCTGGTGGTATGGCTGACCCTGTTTCAGAAGCAGGATAGTATAAAAGCATCAGCCTAAGAATGGCACTCCCACTAACTAGCTAT
GTAATCTTGACCTCTTTGGGCTTTAGTTCCTCTCATAAAAGGAAGAGATGTATTGGATTAGACTAGATGATCACCACTTTCTCTTCTAGT
TCTAATTTTTTTAATTCTAATACCTATATTTTCAAGTTATGTCAATTAAATCATTATCAGGTTATTTCCTAATGTAAGAATAGCTAAAAT
GTTGCAGAGAAATAAGTGACCCAACAAAATTTATTCATCTGTTATGGGTAAGATCTGCCATAAATTCTTCCTAAATAATTTGTTTACTAA
CTCTTTAGGCCACTGTGCTTTGCGGTCCATTAGTAAACTTGTGTTGCTAAGTGCTAAACAGAATACTGCTATTTTGAGAGAGTCAAGACT
CTTTCTTAAGGGCCAAGAAAGCAACTTGAGCCTTGGGCTAATCTGGCTGAGTAGTCAGTTATAAAAGCATAATTGCTTTATATTTTGGAT
CATTTTTTACTGGGGGCGGACTTGGGGGGGGTTGCATACAAAGATAACATATATATCCAACTTTCTGAAATGAAATGTTTTTAGATTACT
TTTTCAACTGTAAATAATGTACATTTAATGTCACAAGAAAAAAATGTCTTCTGCAAATTTTCTAGTATAACAGAAATTTTTGTAGATGAA
AAAAATCATTATGTTTAGAGGTCTAATGCTATGTTTTCATATTACAGAGTGAATTTGTATTTAAACAAAAATTTAAATTTTGGAATCCTC
TAAACATTTTTGTATCTTTAATTGGTTTATTATTAAATAAATCATATAAAAATTCTCAGTGTCTGTTTTCAGGCAAAAGTTTCTTAAAGA

>In-frame_AFTPH_ENST00000409933_chr2_64796813_+_ELF1_ENST00000442101_chr13_41556418_-_5792nt
ATGGAGCCAGACATCATTCGAATGTACTCTTCATCCCCACCACCATTAGACAATGGAGCAGAGGATGATGATGATGATGAATTTGGGGAA
TTTGGTGGGTTTTCAGAAGTTAGCCCTTCTGGTGTAGGGTTTGTTGATTTCGATACACCAGATTATACTCGTCCCAAGGAAGAGTTTGTA
CCTTCAAACCATTTTATGCCAATTCATGAATTCTCAGAAAATGTAGATAGCCTTACAAGCTTTAAGTCCATTAAAAATGGTAATGATAAG
GACATCACTGCTGAACTTTCTGCTCCTGTGAAAGGACAGTCTGATGTTTTACTTTCTACCACCAGCAAAGAAATAATTTCATCTGAAATG
TTAGCTACTTCCATTGATGGCATGGAAAGACCAGGAAATTTAAATAAAGTAGTGGAGCAGAGACAGAATGTTGGAACACTTGAAAGTTTC
TCTCCAGGAGATTTTAGAACTAATATGAATGTTGTTCATCAAAACAAGCAGTTAGAGAGCTGCAATGGTGAAAAGCCTCCTTGTCTGGAG
ATTCTAACAAATGGGTTTGCAGTGTTGGAAACTGTAAATCCTCAGGGAACAGATGATCTGGACAATGTAGCTGATTCAAAGGGACGGAAG
CCTCTTAGCACTCATAGCACTGAGTATAATTTAGACTCTGTACCTAGTCCTGCTGAGGAATTTGCAGATTTTGCCACATTTTCCAAAAAG
GAAAGGATACAATTAGAAGAAATAGAATGTGCAGTTTTAAATGATAGAGAAGCACTAACCATTCGGGAAAACAATAAAATTAATAGAGTC
AATGAACTGAATTCTGTAAAAGAAGTGGCTTTGGGTAGAAGCTTGGATAACAAAGGAGACACTGATGGAGAGGATCAGGTTTGTGTTTCA
GAAATAAGCATAGTGACTAACAGAGGTTTCAGTGTTGAAAAACAAGGCCTTCCAACACTGCAACAGGATGAATTTTTACAGTCAGGTGTT
CAGTCAAAGGCTTGGAGTTTGGTAGACTCAGCTGATAATTCAGAAGCCATTAGGAGAGAACAATGTAAAACTGAAGAAAAACTTGACTTA
CTTACTTCTAAATGTGCTCACCTATGCATGGATTCTGTTAAAACTTCTGATGATGAAGTTGGTTCTCCCAAAGAAGAAAGTAGAAAGTTT
ACTAATTTCCAAAGCCCAAACATTGACCCCACAGAAGAAAATGATTTGGATGATTCTTTAAGTGTAAAAAATGGTGATAGTAGTAATGAC
TTTGTGACTTGCAATGATATCAATGAAGATGATTTTGGTGATTTTGGTGACTTTGGCTCTGCCAGTGGCTCAACTCCACCTTTTGTTACT
GGTACTCAAGATTCAATGAGTGATGCCACTTTTGAAGAGTCTTCAGAGCACTTTCCACATTTTAGTGAACCAGGTGATGACTTTGGAGAA
TTTGGGGATATAAATGCTGTTTCTTGCCAAGAGGAGACAATATTAACAAAGTCAGACCTAAAACAGACTTCTGATAATTTATCAGAAGAA
TGTCAATTGGCAAGAAAATCTAGTGGAACAGGCACTGAACCTGTTGCAAAACTTAAAAATGGGCAAGAAGGTGAGATTGGACATTTTGAT
TCTGTGCCAAATATTCAGGATGACTGCAATGGTTTTCAAGACTCTGATGATTTTGCAGACTTCAGTTCAGCTGGTCCTAGCCAAGTTGTA
GATTGGAATGCTTTTGAGGATGAACAAAAAGATAGTTGTTCTTGGGCTGCTTTTGGAGACCAGCAGGCTACTGAATCTCATCATCGAAAG
GAAGCCTGGCAGTCACATAGGACAGATGAAAATATTGATACTCCAGGAACCCCCAAAACGCACAGTGTACCTTCAGCAACTTCCAAAGGA
GCAGTTGCTAGTGGCCATTTACAGGAATCAGCCACTTCAGTTCAGACAGCTTTATTAAACCGCCTGGAGCGAATTTTCGAAGCATGTTTT
CCTTCCATACTTGTCCCTGATGCTGAAGAGGAAGTTACTTCCCTGAAGCACTTGCTGGAAACAAGCACTTTGCCAATAAAAACGAGAGAG
GCCTTACCTGAAAGTGGGGAATTGCTAGATGTGTGGACTGAGCTACAGGATATCCATGATGCACATGGCTTGAGATACCAGTGGGGCGGC
TCCCATAGCAACAAGAAGCTTTTGTCCTCCTTGGGAATAGACACCCGAAACATTCTCTTCACGGGCAATAAGAAGCAGCCTGTTATAGTG
CCCATGTATGCAGCAGGATTGGCCAAGAAGCTTGAGAGAAGAAAAATTTCAGAAAAATTGTCTCAATTTGACTAGAATATCAATGAACCA
GGAAAACTGAAGCACCTTCCCTAAAGAAAACTTGGGTATACAATTACTCCACAGACAGAGCTGAGGGTTTTTTACCCAAATCAGTCACTG
GATTTTGCTGCCTGATACGTGAATCTTCTTGGAATTTTTCTCATGTGGATCTAAGGGGAATGCTTTATTATGGCTGCTGTTGTCCAACAG
AACGACCTAGTATTTGAATTTGCTAGTAACGTCATGGAGGATGAACGACAGCTTGGTGATCCAGCTATTTTTCCTGCCGTAATTGTGGAA
CATGTTCCTGGTGCTGATATTCTCAATAGTTATGCCGGTCTAGCCTGTGTGGAAGAGCCCAATGACATGATTACTGAGAGTTCACTGGAT
GTTGCTGAAGAAGAAATCATAGACGATGATGATGATGACATCACCCTTACAGTTGAAGCTTCTTGTCATGACGGGGATGAAACAATTGAA
ACTATTGAGGCTGCTGAGGCACTCCTCAATATGGATTCCCCTGGCCCTATGCTGGATGAAAAACGAATAAATGGGATTCCTGAAGTGATG
GAAACACAGCAGGTGCAAGAAAAATATGCAGACTCACCGGGAGCCTCATCACCAGAACAGCCTAAGAGGAAAAAAGGAAGAAAAACTAAA
CCACCACGACCAGATTCCCCAGCCACTACGCCAAATATATCTGTGAAGAAGAAAAACAAAGATGGAAAGGGAAACACAATTTATCTTTGG
GAGTTTTTACTGGCACTGCTCCAGGACAAGGCTACTTGTCCTAAATACATCAAGTGGACCCAGCGAGAGAAAGGCATTTTTAAATTGGTG
GATTCTAAAGCAGTGTCCAGGTTGTGGGGGAAGCACAAAAACAAACCTGATATGAATTATGAGACCATGGGAAGAGCACTCAGGTACTAT
TACCAAAGGGGTATTCTGGCAAAAGTGGAAGGTCAGCGCTTGGTGTATCAGTTTAAAGAAATGCCAAAAGATCTTATATATATAAATGAT
GAGGATCCAAGTTCCAGCATAGAGTCTTCAGATCCATCGCTATCTTCATCAGCCACTTCAAATAGGAATCAAACCAGCCGGTCGAGAGTA
TCTTCAAGTCCAGGGGTAAAAGGAGGAGCCACTACAGTTCTAAAACCAGGGAATTCTAAAGCTGCAAAACCCAAAGATCCTGTGGAAGTT
GCACAACCATCAGAAGTTTTGAGGACAGTGCAGCCCACGCAGTCTCCATATCCTACCCAGCTCTTCCGGACTGTTCATGTAGTACAGCCA
GTACAGGCTGTCCCAGAGGGAGAAGCAGCTAGAACCAGTACCATGCAGGATGAAACATTAAATTCTTCCGTTCAGAGTATTAGGACTATA
CAGGCTCCAACCCAAGTTCCAGTGGTTGTGTCTCCTAGGAATCAGCAGTTGCATACAGTAACACTCCAAACAGTGCCACTCACAACAGTT
ATAGCCAGCACAGATCCATCAGCAGGTACTGGATCTCAGAAGTTTATTTTACAAGCCATTCCATCATCACAGCCCATGACAGTACTGAAA
GAAAATGTCATGCTGCAGTCACAAAAGGCGGGCTCTCCTCCTTCAATTGTCTTGGGCCCTGCCCAGGTTCAGCAGGTCCTTACTAGCAAT
GTTCAGACCATTTGCAATGGAACCGTCAGTGTGGCTTCCTCTCCATCCTTCAGTGCTACTGCACCTGTGGTGACCTTTTCTCCTCGCAGT
TCACAGCTGGTTGCTCACCCACCTGGCACTGTAATCACTTCAGTTATCAAAACTCAAGAAACAAAAACTCTTACACAGGAAGTAGAGAAA
AAGGAATCTGAAGATCATTTGAAAGAGAACACTGAGAAAACGGAGCAGCAGCCACAGCCTTATGTGATGGTAGTGTCCAGTTCCAATGGA
TTTACTTCTCAGGTAGCTATGAAACAAAACGAACTGCTGGAACCCAACTCTTTTTAGTTAATATACCAAAGCTTATGAATAATTGTTTGT
TAATTGAACATTTTCAATTATATGCAGACTGACTGATTCTAAGATAAATTCTAAGGAGGTTTCTAATTTTGTAATTGTTAAAAATAGAGT
TAATTTTGACTTTGTTAGATGAGGGAGGAAAACTCAACTGTTTCTCTTTGTTATCTAAATGTTTCAGAATTCAATCGTGAAGGAACAGGC
ATTTTACACTATGAAGACATTCTTTTGAGATTTTTATTTCAGTTGCTATATCATAAGCATTTTTAAAGTTTCTTTTCTAATTTTACATTG
TATTAGATTTTCTGATTCTTTTGTAAATACAGAACTTAAATAGAAGGCAACAGGAAATTTATATAGGAACTATTTTCATTCCACTTGTGT
AAGTTAAGTCTTGACTCTTTCAAATGCAAAAAACCTATTTTATGCTTTGTTAAAATTATGGTGTCACTTAGATTGACTTTAGTTGACTGC
ACTATATAATATAGAACTATGAATATGTAGAATAACATGAAAAATTGGAGGTGCTGGTGGTATGGCTGACCCTGTTTCAGAAGCAGGATA
GTATAAAAGCATCAGCCTAAGAATGGCACTCCCACTAACTAGCTATGTAATCTTGACCTCTTTGGGCTTTAGTTCCTCTCATAAAAGGAA
GAGATGTATTGGATTAGACTAGATGATCACCACTTTCTCTTCTAGTTCTAATTTTTTTAATTCTAATACCTATATTTTCAAGTTATGTCA
ATTAAATCATTATCAGGTTATTTCCTAATGTAAGAATAGCTAAAATGTTGCAGAGAAATAAGTGACCCAACAAAATTTATTCATCTGTTA
TGGGTAAGATCTGCCATAAATTCTTCCTAAATAATTTGTTTACTAACTCTTTAGGCCACTGTGCTTTGCGGTCCATTAGTAAACTTGTGT
TGCTAAGTGCTAAACAGAATACTGCTATTTTGAGAGAGTCAAGACTCTTTCTTAAGGGCCAAGAAAGCAACTTGAGCCTTGGGCTAATCT
GGCTGAGTAGTCAGTTATAAAAGCATAATTGCTTTATATTTTGGATCATTTTTTACTGGGGGCGGACTTGGGGGGGGTTGCATACAAAGA
TAACATATATATCCAACTTTCTGAAATGAAATGTTTTTAGATTACTTTTTCAACTGTAAATAATGTACATTTAATGTCACAAGAAAAAAA
TGTCTTCTGCAAATTTTCTAGTATAACAGAAATTTTTGTAGATGAAAAAAATCATTATGTTTAGAGGTCTAATGCTATGTTTTCATATTA
CAGAGTGAATTTGTATTTAAACAAAAATTTAAATTTTGGAATCCTCTAAACATTTTTGTATCTTTAATTGGTTTATTATTAAATAAATCA
TATAAAAATTCTCAGTGTCTGTTTTCAGGCAAAAGTTTCTTAAAGAATAAGTGTGCAGAGAATATTACTAGAACATCAGCATTACTTAAT

>In-frame_AFTPH_ENST00000409183_chr2_64796813_+_ELF1_ENST00000442101_chr13_41556418_-_4755nt
CATTAGGAGAGAACAATGTAAAACTGAAGAAAAACTTGACTTACTTACTTCTAAATGTGCTCACCTATGCATGGATTCTGTTAAAACTTC
TGATGATGAAGTTGGTTCTCCCAAAGAAGAAAGTAGAAAGTTTACTAATTTCCAAAGCCCAAACATTGACCCCACAGAAGAAAATGATTT
GGATGATTCTTTAAGTGTAAAAAATGGTGATAGTAGTAATGACTTTGTGACTTGCAATGATATCAATGAAGATGATTTTGGTGATTTTGG
TGACTTTGGCTCTGCCAGTGGCTCAACTCCACCTTTTGTTACTGGTACTCAAGATTCAATGAGTGATGCCACTTTTGAAGAGTCTTCAGA
GCACTTTCCACATTTTAGTGAACCAGGTGATGACTTTGGAGAATTTGGGGATATAAATGCTGTTTCTTGCCAAGAGGAGACAATATTAAC
AAAGTCAGACCTAAAACAGACTTCTGATAATTTATCAGAAGAATGTCAATTGGCAAGAAAATCTAGTGGAACAGGCACTGAACCTGTTGC
AAAACTTAAAAATGGGCAAGAAGGTGAGATTGGACATTTTGATTCTGTGCCAAATATTCAGGATGACTGCAATGGTTTTCAAGACTCTGA
TGATTTTGCAGACTTCAGTTCAGCTGGTCCTAGCCAAGTTGTAGATTGGAATGCTTTTGAGGATGAACAAAAAGATAGTTGTTCTTGGGC
TGCTTTTGGAGACCAGCAGGCTACTGAATCTCATCATCGAAAGGAAGCCTGGCAGTCACATAGGACAGATGAAAATATTGATACTCCAGG
AACCCCCAAAACGCACAGTGTACCTTCAGCAACTTCCAAAGGAGCAGTTGCTAGTGGCCATTTACAGGAATCAGCCACTTCAGTTCAGAC
AGCTTTATTAAACCGCCTGGAGCGAATTTTCGAAGCATGTTTTCCTTCCATACTTGTCCCTGATGCTGAAGAGGAAGTTACTTCCCTGAA
GCACTTGCTGGAAACAAGCACTTTGCCAATAAAAACGAGAGAGGCCTTACCTGAAAGTGGGGAATTGCTAGATGTGTGGACTGAGCTACA
GGATATCCATGATGCACATGGCTTGAGATACCAGTGGGGCGGCTCCCATAGCAACAAGAAGCTTTTGTCCTCCTTGGGAATAGACACCCG
AAACATTCTCTTCACGGGCAATAAGAAGCAGCCTGTTATAGTGCCCATGTATGCAGCAGGATTGGCCAAGAAGCTTGAGAGAAGAAAAAT
TTCAGAAAAATTGTCTCAATTTGACTAGAATATCAATGAACCAGGAAAACTGAAGCACCTTCCCTAAAGAAAACTTGGGTATACAATTAC
TCCACAGACAGAGCTGAGGGTTTTTTACCCAAATCAGTCACTGGATTTTGCTGCCTGATACGTGAATCTTCTTGGAATTTTTCTCATGTG
GATCTAAGGGGAATGCTTTATTATGGCTGCTGTTGTCCAACAGAACGACCTAGTATTTGAATTTGCTAGTAACGTCATGGAGGATGAACG
ACAGCTTGGTGATCCAGCTATTTTTCCTGCCGTAATTGTGGAACATGTTCCTGGTGCTGATATTCTCAATAGTTATGCCGGTCTAGCCTG
TGTGGAAGAGCCCAATGACATGATTACTGAGAGTTCACTGGATGTTGCTGAAGAAGAAATCATAGACGATGATGATGATGACATCACCCT
TACAGTTGAAGCTTCTTGTCATGACGGGGATGAAACAATTGAAACTATTGAGGCTGCTGAGGCACTCCTCAATATGGATTCCCCTGGCCC
TATGCTGGATGAAAAACGAATAAATGGGATTCCTGAAGTGATGGAAACACAGCAGGTGCAAGAAAAATATGCAGACTCACCGGGAGCCTC
ATCACCAGAACAGCCTAAGAGGAAAAAAGGAAGAAAAACTAAACCACCACGACCAGATTCCCCAGCCACTACGCCAAATATATCTGTGAA
GAAGAAAAACAAAGATGGAAAGGGAAACACAATTTATCTTTGGGAGTTTTTACTGGCACTGCTCCAGGACAAGGCTACTTGTCCTAAATA
CATCAAGTGGACCCAGCGAGAGAAAGGCATTTTTAAATTGGTGGATTCTAAAGCAGTGTCCAGGTTGTGGGGGAAGCACAAAAACAAACC
TGATATGAATTATGAGACCATGGGAAGAGCACTCAGGTACTATTACCAAAGGGGTATTCTGGCAAAAGTGGAAGGTCAGCGCTTGGTGTA
TCAGTTTAAAGAAATGCCAAAAGATCTTATATATATAAATGATGAGGATCCAAGTTCCAGCATAGAGTCTTCAGATCCATCGCTATCTTC
ATCAGCCACTTCAAATAGGAATCAAACCAGCCGGTCGAGAGTATCTTCAAGTCCAGGGGTAAAAGGAGGAGCCACTACAGTTCTAAAACC
AGGGAATTCTAAAGCTGCAAAACCCAAAGATCCTGTGGAAGTTGCACAACCATCAGAAGTTTTGAGGACAGTGCAGCCCACGCAGTCTCC
ATATCCTACCCAGCTCTTCCGGACTGTTCATGTAGTACAGCCAGTACAGGCTGTCCCAGAGGGAGAAGCAGCTAGAACCAGTACCATGCA
GGATGAAACATTAAATTCTTCCGTTCAGAGTATTAGGACTATACAGGCTCCAACCCAAGTTCCAGTGGTTGTGTCTCCTAGGAATCAGCA
GTTGCATACAGTAACACTCCAAACAGTGCCACTCACAACAGTTATAGCCAGCACAGATCCATCAGCAGGTACTGGATCTCAGAAGTTTAT
TTTACAAGCCATTCCATCATCACAGCCCATGACAGTACTGAAAGAAAATGTCATGCTGCAGTCACAAAAGGCGGGCTCTCCTCCTTCAAT
TGTCTTGGGCCCTGCCCAGGTTCAGCAGGTCCTTACTAGCAATGTTCAGACCATTTGCAATGGAACCGTCAGTGTGGCTTCCTCTCCATC
CTTCAGTGCTACTGCACCTGTGGTGACCTTTTCTCCTCGCAGTTCACAGCTGGTTGCTCACCCACCTGGCACTGTAATCACTTCAGTTAT
CAAAACTCAAGAAACAAAAACTCTTACACAGGAAGTAGAGAAAAAGGAATCTGAAGATCATTTGAAAGAGAACACTGAGAAAACGGAGCA
GCAGCCACAGCCTTATGTGATGGTAGTGTCCAGTTCCAATGGATTTACTTCTCAGGTAGCTATGAAACAAAACGAACTGCTGGAACCCAA
CTCTTTTTAGTTAATATACCAAAGCTTATGAATAATTGTTTGTTAATTGAACATTTTCAATTATATGCAGACTGACTGATTCTAAGATAA
ATTCTAAGGAGGTTTCTAATTTTGTAATTGTTAAAAATAGAGTTAATTTTGACTTTGTTAGATGAGGGAGGAAAACTCAACTGTTTCTCT
TTGTTATCTAAATGTTTCAGAATTCAATCGTGAAGGAACAGGCATTTTACACTATGAAGACATTCTTTTGAGATTTTTATTTCAGTTGCT
ATATCATAAGCATTTTTAAAGTTTCTTTTCTAATTTTACATTGTATTAGATTTTCTGATTCTTTTGTAAATACAGAACTTAAATAGAAGG
CAACAGGAAATTTATATAGGAACTATTTTCATTCCACTTGTGTAAGTTAAGTCTTGACTCTTTCAAATGCAAAAAACCTATTTTATGCTT
TGTTAAAATTATGGTGTCACTTAGATTGACTTTAGTTGACTGCACTATATAATATAGAACTATGAATATGTAGAATAACATGAAAAATTG
GAGGTGCTGGTGGTATGGCTGACCCTGTTTCAGAAGCAGGATAGTATAAAAGCATCAGCCTAAGAATGGCACTCCCACTAACTAGCTATG
TAATCTTGACCTCTTTGGGCTTTAGTTCCTCTCATAAAAGGAAGAGATGTATTGGATTAGACTAGATGATCACCACTTTCTCTTCTAGTT
CTAATTTTTTTAATTCTAATACCTATATTTTCAAGTTATGTCAATTAAATCATTATCAGGTTATTTCCTAATGTAAGAATAGCTAAAATG
TTGCAGAGAAATAAGTGACCCAACAAAATTTATTCATCTGTTATGGGTAAGATCTGCCATAAATTCTTCCTAAATAATTTGTTTACTAAC
TCTTTAGGCCACTGTGCTTTGCGGTCCATTAGTAAACTTGTGTTGCTAAGTGCTAAACAGAATACTGCTATTTTGAGAGAGTCAAGACTC
TTTCTTAAGGGCCAAGAAAGCAACTTGAGCCTTGGGCTAATCTGGCTGAGTAGTCAGTTATAAAAGCATAATTGCTTTATATTTTGGATC
ATTTTTTACTGGGGGCGGACTTGGGGGGGGTTGCATACAAAGATAACATATATATCCAACTTTCTGAAATGAAATGTTTTTAGATTACTT
TTTCAACTGTAAATAATGTACATTTAATGTCACAAGAAAAAAATGTCTTCTGCAAATTTTCTAGTATAACAGAAATTTTTGTAGATGAAA
AAAATCATTATGTTTAGAGGTCTAATGCTATGTTTTCATATTACAGAGTGAATTTGTATTTAAACAAAAATTTAAATTTTGGAATCCTCT
AAACATTTTTGTATCTTTAATTGGTTTATTATTAAATAAATCATATAAAAATTCTCAGTGTCTGTTTTCAGGCAAAAGTTTCTTAAAGAA


Top

FusionGenePPI for AFTPH_ELF1


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
AFTPHUBE3A, LIG4, STAT5B, VAPB, NTRK1, XPO1, AP1S2, VAPA, AP1M2ELF1HMGA1, NFKB1, REL, SP1, NFYA, HOXC13, RUNX1, HSPBP1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for AFTPH_ELF1


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for AFTPH_ELF1


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource