FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 1025

FusionGeneSummary for AFF4_FSTL4

check button Fusion gene summary
Fusion gene informationFusion gene name: AFF4_FSTL4
Fusion gene ID: 1025
HgeneTgene
Gene symbol

AFF4

FSTL4

Gene ID

27125

23105

Gene nameAF4/FMR2 family member 4follistatin like 4
SynonymsAF5Q31|CHOPS|MCEF-
Cytomap

5q31.1

5q31.1

Type of geneprotein-codingprotein-coding
DescriptionAF4/FMR2 family member 4ALL1-fused gene from chromosome 5q31 proteinmajor CDK9 elongation factor-associated proteinfollistatin-related protein 4follistatin-like protein 4
Modification date2018052320180519
UniProtAcc

Q9UHB7

Q6MZW2

Ensembl transtripts involved in fusion geneENST00000265343, ENST00000378595, 
ENST00000491831, 
ENST00000265342, 
ENST00000507112, 
Fusion gene scores* DoF score5 X 4 X 3=602 X 2 X 2=8
# samples 52
** MAII scorelog2(5/60*10)=-0.263034405833794
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(2/8*10)=1.32192809488736
Context

PubMed: AFF4 [Title/Abstract] AND FSTL4 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID

check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVBRCATCGA-E2-A1LE-01AAFF4chr5

132227856

-FSTL4chr5

132561511

-
TCGALDBRCATCGA-E2-A1LE-01AAFF4chr5

132224771

-FSTL4chr5

132561511

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
Frame-shitENST00000265343ENST00000265342AFF4chr5

132227856

-FSTL4chr5

132561511

-
5CDS-5UTRENST00000265343ENST00000507112AFF4chr5

132227856

-FSTL4chr5

132561511

-
intron-3CDSENST00000378595ENST00000265342AFF4chr5

132227856

-FSTL4chr5

132561511

-
intron-5UTRENST00000378595ENST00000507112AFF4chr5

132227856

-FSTL4chr5

132561511

-
intron-3CDSENST00000491831ENST00000265342AFF4chr5

132227856

-FSTL4chr5

132561511

-
intron-5UTRENST00000491831ENST00000507112AFF4chr5

132227856

-FSTL4chr5

132561511

-
In-frameENST00000265343ENST00000265342AFF4chr5

132224771

-FSTL4chr5

132561511

-
5CDS-5UTRENST00000265343ENST00000507112AFF4chr5

132224771

-FSTL4chr5

132561511

-
intron-3CDSENST00000378595ENST00000265342AFF4chr5

132224771

-FSTL4chr5

132561511

-
intron-5UTRENST00000378595ENST00000507112AFF4chr5

132224771

-FSTL4chr5

132561511

-
intron-3CDSENST00000491831ENST00000265342AFF4chr5

132224771

-FSTL4chr5

132561511

-
intron-5UTRENST00000491831ENST00000507112AFF4chr5

132224771

-FSTL4chr5

132561511

-

Top

FusionProtFeatures for AFF4_FSTL4


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
AFF4

Q9UHB7

FSTL4

Q6MZW2

Key component of the super elongation complex (SEC), acomplex required to increase the catalytic rate of RNA polymeraseII transcription by suppressing transient pausing by thepolymerase at multiple sites along the DNA. In the SEC complex,AFF4 acts as a central scaffold that recruits other factorsthrough direct interactions with ELL proteins (ELL, ELL2 or ELL3)and the P-TEFb complex. In case of infection by HIV-1 virus, theSEC complex is recruited by the viral Tat protein to stimulateviral gene expression. {ECO:0000269|PubMed:20159561,ECO:0000269|PubMed:20471948, ECO:0000269|PubMed:23251033}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneAFF4chr5:132224771chr5:132561511ENST00000265343-1421102_4619101164Compositional biasNote=Ser-rich
HgeneAFF4chr5:132224771chr5:132561511ENST00000265343-1421836_8999101164Compositional biasNote=Ser-rich
TgeneFSTL4chr5:132224771chr5:132561511ENST00000265342-716341_426338843DomainNote=Ig-like 2

- In-frame and not-retained protein feature among the 13 regional features.
>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneAFF4chr5:132224771chr5:132561511ENST00000378595-113102_461-122901Compositional biasNote=Ser-rich
HgeneAFF4chr5:132224771chr5:132561511ENST00000378595-113836_899-122901Compositional biasNote=Ser-rich
TgeneFSTL4chr5:132224771chr5:132561511ENST00000265342-716187_198338843Calcium bindingOntology_term=ECO:0000255
TgeneFSTL4chr5:132224771chr5:132561511ENST00000265342-716174_209338843DomainEF-hand
TgeneFSTL4chr5:132224771chr5:132561511ENST00000265342-716251_338338843DomainNote=Ig-like 1
TgeneFSTL4chr5:132224771chr5:132561511ENST00000265342-71681_135338843DomainKazal-like


Top

FusionGeneSequence for AFF4_FSTL4


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_AFF4_ENST00000265343_chr5_132224771_-_FSTL4_ENST00000265342_chr5_132561511_-_1415aa
MNREDRNVLRMKERERRNQEIQQGEDAFPPSSPLFAEPYKVTSKEDKLSSRIQSMLGNYDEMKDFIGDRSIPKLVAIPKPTVPPSADEKS
NPNFFEQRHGGSHQSSKWTPVGPAPSTSQSQKRSSGLQSGHSSQRTSAGSSSGTNSSGQRHDRESTNNSGSSSRKKGQHGSEHSKSRSSS
PGKPQAVSSLNSSHSRSHGNDHHSKEHQRSKSPRDPDANWDSPSRVPFSSGQHSTQSFPPSLMSKSNSMLQKPTATVRPMDGQESMEPKL
SSEHYSSQSHGNSMTELKPSSKAHLTKLKIPSQPLDASASGDVSCVDEILKEMTHSWPPPLTAIHTPCKTEPSKFPFPTKESQQSNFGTG
EQKRTNPSKTSNGHQSKSMLKDDLKLSSSEDSDGEQDCDKTMPRSTPGSNSEPSHHNSEGADNSRDDSSSHSGSESSSGSDSESESSSSD
SEANEPSQSASPEPEPPPTNKWQLDNWLNKVNPHKVSPASSVDSNIPSSQGYKKEGREQGTGNSYTDTSGPKETSSATPGRDSKTIQKGS
ESGRGRQKSPAQSDSTTQRRTVGKKQPKKAEKAAAEEPRGGLKIESETPVDLASSMPSSRHKAATKGSRKPNIKKESKSSPRPTAEKKKT
KSTSKSSQKSREIIETDTSSSDSDESESLPPSSQTPKYPESNRTPVKPSSVEEEDSFFRQRMFSPMEEKELLSPLSEPDDRYPLIVKIDL
NLLTRIPGKPYKETEPPKGEKKNVPEKHTREAQKQASEKVSNKGKRKHKNEDDNRASESKKPKTEDKNSAGHKPSSNRESSKQSAAKEKD
LLPSPAGPVPSKDPKTEHGSRKRTISQSSSLKSSSNSNKETSGSSKNSSSTSKQKKTEGKTSSSSKEVKEKAPSSSSNCPPSAPTLDSSK
PRRTKLVFDDSAASHPCLSREPGTGAWSGSQPKMPC_GHSHAQNHLAEKRRGCLNSDVQTALPFSQWERTPHQQCSV_RHRGIHLHCQK_
SGCG_RTLLALH_RLS_KDPCKHPVARGRPQRGKHVLCLLRRRTHRHPSCGL_DPEAPQTHGKDFHEL_RNLSSKRKKCNPALPVGICSQ
CPEPVHLCGPASTEQSPCGRHPSPESPTVHRCGPSAG_AVL_QVT_PSVGPELGGRAQVPTKSPGDHRSQHRPEPAPHPHTLCRSG_FLH
SPNKPHHQPHQVWLHLQQV_SCSPQGGPGNNDAPQDHRPAPPWLRAPGHGTHPPGRLLLHPVPTGQPRLCCPTAAR_QCHRLCAWPQW_C
NRHPTHIPRRALHSQCCS_QPLAARAGDHSAGRDPDPV_PANKLGHLRLGLPALLH_KQSIQHLRGSAHGAGPAVPGAVHGEGGHAEELK


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_AFF4_ENST00000265343_chr5_132224771_-_FSTL4_ENST00000265342_chr5_132561511_-_4246nt
ATGAACCGTGAAGACCGGAATGTGCTGCGTATGAAAGAACGGGAAAGGCGGAATCAGGAAATTCAGCAGGGCGAAGACGCCTTCCCACCT
AGCTCTCCTCTCTTTGCAGAGCCATACAAAGTTACTAGCAAAGAAGATAAGTTATCAAGTCGTATTCAGAGTATGCTTGGAAACTACGAT
GAAATGAAGGATTTCATAGGAGACAGATCTATACCAAAGCTTGTTGCAATTCCCAAGCCTACAGTACCACCATCAGCAGATGAAAAATCT
AACCCAAATTTCTTTGAACAGAGACATGGAGGCTCTCATCAGAGTAGCAAATGGACTCCAGTAGGACCCGCACCCAGCACTTCTCAGTCT
CAGAAACGGTCCTCAGGCTTACAGAGTGGACATAGTAGCCAGCGGACCAGCGCAGGTAGCAGTAGTGGCACTAACAGTAGTGGTCAGAGG
CACGACCGTGAGTCATATAACAATAGTGGGAGCAGTAGCCGGAAAAAAGGCCAGCATGGATCAGAACACTCCAAATCACGTTCTTCCAGC
CCTGGAAAACCCCAGGCTGTTTCTTCATTAAACTCTAGTCATTCCAGGTCTCATGGGAATGATCACCATAGCAAGGAACATCAACGCTCC
AAATCACCTCGGGACCCTGATGCAAACTGGGATTCTCCTTCCCGTGTACCTTTTTCAAGTGGGCAGCACTCAACTCAATCTTTCCCACCC
TCATTGATGTCAAAGTCCAATTCAATGTTACAGAAACCCACTGCCTATGTGCGGCCCATGGACGGACAGGAGTCCATGGAACCAAAGCTG
TCCTCTGAGCACTACAGCAGCCAATCCCATGGCAACAGCATGACTGAGCTGAAGCCCAGCAGCAAAGCACATCTCACCAAGCTGAAAATA
CCTTCCCAACCACTGGATGCATCAGCTTCTGGTGATGTGAGCTGTGTGGATGAAATCCTAAAAGAGATGACGCATTCATGGCCTCCCCCT
CTAACGGCTATTCATACACCATGCAAAACAGAACCTTCCAAATTTCCTTTTCCAACTAAGGAGTCTCAGCAGTCCAATTTTGGCACTGGA
GAACAAAAAAGATATAATCCTTCTAAAACTTCAAATGGGCACCAGTCTAAATCTATGTTAAAAGATGACTTAAAACTAAGCAGCAGTGAA
GACAGTGATGGGGAACAGGATTGTGATAAGACAATGCCGAGGAGTACACCAGGAAGTAACTCTGAACCTTCACACCATAATAGTGAAGGA
GCAGATAACTCCAGGGATGATTCTAGTAGCCACAGTGGATCTGAAAGCAGCTCTGGATCTGACTCAGAGAGTGAAAGTAGTTCCAGTGAC
AGTGAGGCAAATGAGCCATCCCAGAGTGCATCTCCCGAGCCTGAACCCCCGCCAACAAACAAATGGCAACTTGATAATTGGCTGAATAAA
GTGAACCCACATAAAGTGTCACCCGCCTCTTCAGTGGACAGTAACATCCCATCATCTCAAGGCTACAAAAAGGAAGGCCGAGAGCAGGGC
ACTGGGAATAGCTACACTGATACAAGTGGACCTAAAGAAACGAGTTCCGCTACTCCGGGACGAGACTCCAAAACCATCCAAAAGGGATCA
GAAAGTGGGCGTGGGAGGCAGAAATCTCCTGCACAGAGTGACAGCACAACACAGAGAAGAACTGTAGGCAAAAAACAACCCAAAAAGGCT
GAGAAGGCAGCTGCTGAAGAGCCTCGTGGAGGCCTGAAGATAGAAAGTGAAACCCCTGTAGACTTGGCTAGCAGCATGCCCTCCAGCAGA
CACAAAGCAGCCACCAAAGGCTCAAGGAAACCCAATATAAAGAAGGAGTCTAAGTCTTCCCCTCGACCTACAGCAGAGAAAAAGAAATAT
AAGTCAACAAGTAAATCTTCCCAGAAATCAAGGGAAATCATAGAAACAGATACCTCATCCTCAGATTCAGATGAAAGTGAGAGCCTTCCT
CCTTCCTCACAAACTCCTAAGTACCCCGAGAGCAATAGGACTCCTGTTAAACCCTCCTCAGTGGAGGAAGAAGATAGCTTTTTTCGGCAA
CGAATGTTCTCTCCTATGGAAGAGAAGGAACTTCTTTCACCCCTCAGTGAGCCTGATGACAGGTACCCACTTATTGTGAAGATTGACCTG
AATCTTTTGACTAGAATACCAGGAAAGCCTTACAAAGAAACAGAGCCGCCCAAGGGGGAAAAGAAAAATGTGCCAGAAAAGCACACGAGA
GAGGCTCAGAAACAAGCCTCAGAAAAAGTTTCCAACAAAGGCAAGAGGAAGCATAAGAATGAAGATGATAACCGAGCCAGTGAGAGCAAG
AAACCCAAAACGGAGGACAAGAATTCAGCAGGCCATAAGCCATCCAGCAACAGAGAGTCATCTAAGCAGAGTGCTGCAAAAGAAAAGGAT
TTGTTGCCTTCTCCCGCTGGGCCTGTTCCTTCAAAAGATCCAAAAACAGAGCATGGCTCTCGGAAGAGGACTATTAGTCAGTCTTCTTCC
TTAAAGTCAAGCAGTAACAGCAACAAGGAGACGAGTGGCAGCAGCAAAAACAGTTCCTCCACATCAAAGCAGAAGAAGACCGAAGGGAAG
ACTTCCAGTAGCTCCAAGGAGGTTAAGGAAAAGGCTCCAAGTAGCTCCTCTAACTGTCCTCCATCTGCACCAACTCTTGATTCTTCTAAG
CCTCGGAGAACAAAGCTTGTCTTTGATGACAGTGCCGCCAGTCATCCGTGTCTATCCAGAGAGCCAGGCACAGGAGCCTGGAGTGGCAGC
CAGCCTAAGATGCCATGCTGAGGGCATTCCCATGCCCAGAATCACTTGGCTGAAAAACGGCGTGGATGTCTCAACTCAGATGTCCAAACA
GCTCTCCCTTTTAGCCAATGGGAGCGAACTCCACATCAGCAGTGTTCGGTATGAAGACACAGGGGCATACACCTGCATTGCCAAAAATGA
AGTGGGTGTGGATGAAGATATCTCCTCGCTCTTCATTGAAGACTCAGCTAGAAAGACCCTTGCAAACATCCTGTGGCGAGAGGAAGGCCT
CAGCGTGGGAAACATGTTCTATGTCTTCTCCGACGACGGTATCATCGTCATCCATCCTGTGGACTGTGAGATCCAGAGGCACCTCAAACC
CACGGAAAAGATTTTCATGAGCTATGAAGAAATCTGTCCTCAAAGAGAAAAAAATGCAACCCAGCCCTGCCAGTGGGTATCTGCAGTCAA
TGTCCGGAACCGGTACATCTATGTGGCCCAGCCAGCACTGAGCAGAGTCCTTGTGGTCGACATCCAAGCCCAGAAAGTCCTACAGTCCAT
AGGTGTGGACCCTCTGCCGGCTAAGCTGTCCTATGACAAGTCACATGACCAAGTGTGGGTCCTGAGCTGGGGGGACGTGCACAAGTCCCG
ACCAAGTCTCCAGGTGATCACAGAAGCCAGCACCGGCCAGAGCCAGCACCTCATCCGCACACCCTTTGCAGGAGTGGATGATTTCTTCAT
TCCCCCAACAAACCTCATCATCAACCACATCAGGTTTGGCTTCATCTTCAACAAGTCTGATCCTGCAGTCCACAAGGTGGACCTGGAAAC
AATGATGCCCCTCAAGACCATCGGCCTGCACCACCATGGCTGCGTGCCCCAGGCCATGGCACACACCCACCTGGGCGGCTACTTCTTCAT
CCAGTGCCGACAGGACAGCCCCGCCTCTGCTGCCCGACAGCTGCTCGTTGACAGTGTCACAGACTCTGTGCTTGGCCCCAATGGTGATGT
AACAGGCACCCCACACACATCCCCCGACGGGCGCTTCATAGTCAGTGCTGCAGCTGACAGCCCCTGGCTGCACGTGCAGGAGATCACAGT
GCGGGGCGAGATCCAGACCCTGTATGACCTGCAAATAAACTCGGGCATCTCAGACTTGGCCTTCCAGCGCTCCTTCACTGAAAGCAATCA
ATACAACATCTACGCGGCTCTGCACACGGAGCCGGACCTGCTGTTCCTGGAGCTGTCCACGGGGAAGGTGGGCATGCTGAAGAACTTAAA
GGAGCCACCCGCAGGGCCAGCTCAGCCCTGGGGGGGTACCCACAGAATCATGAGGGACAGTGGGCTGTTTGGACAGTACCTCCTCACACC
AGCCCGAGAGTCACTGTTCCTCATCAATGGGAGACAAAACACGCTGCGGTGTGAGGTGTCAGGTATAAAGGGGGGGACCACAGTGGTGTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_AFF4_ENST00000265343_chr5_132224771_-_FSTL4_ENST00000265342_chr5_132561511_-_7266nt
GTCAGTCACAGCCCTGGCTGCAGGAGTCCAGCTGCCGTCGCCGCCGCCAGCGGACGGGGCGGGGATCCTGGTGCCAGGTCTTCGTTAACC
CGCCCCCGCCGCCTCAGTCAGCTGTCCCAGCCCGGGCCCGACCGTCATGGAGCGGTGCGGGGCCTACGCCTGTTCCGTGTGAGGCGCATC
GCTGCCGCCGCCGCCGACGCCGCCTTCGTTTGTCGAGGCCTCCGGAACCCCCGCCGCCTCCCGGAGCCCCTCGCCCTTGGCAGCCTGTCA
CCGCCCCCTGGGCGGGCTCGAATGCGCGTCCGGTGAAGGTGCAGGCCCGGCGCCGCCACTGCCGCAGCCAGGAGATGGTTCGGGCCTAGC
GGAGCCGGGACTGGAGCAACATGAACCGTGAAGACCGGAATGTGCTGCGTATGAAAGAACGGGAAAGGCGGAATCAGGAAATTCAGCAGG
GCGAAGACGCCTTCCCACCTAGCTCTCCTCTCTTTGCAGAGCCATACAAAGTTACTAGCAAAGAAGATAAGTTATCAAGTCGTATTCAGA
GTATGCTTGGAAACTACGATGAAATGAAGGATTTCATAGGAGACAGATCTATACCAAAGCTTGTTGCAATTCCCAAGCCTACAGTACCAC
CATCAGCAGATGAAAAATCTAACCCAAATTTCTTTGAACAGAGACATGGAGGCTCTCATCAGAGTAGCAAATGGACTCCAGTAGGACCCG
CACCCAGCACTTCTCAGTCTCAGAAACGGTCCTCAGGCTTACAGAGTGGACATAGTAGCCAGCGGACCAGCGCAGGTAGCAGTAGTGGCA
CTAACAGTAGTGGTCAGAGGCACGACCGTGAGTCATATAACAATAGTGGGAGCAGTAGCCGGAAAAAAGGCCAGCATGGATCAGAACACT
CCAAATCACGTTCTTCCAGCCCTGGAAAACCCCAGGCTGTTTCTTCATTAAACTCTAGTCATTCCAGGTCTCATGGGAATGATCACCATA
GCAAGGAACATCAACGCTCCAAATCACCTCGGGACCCTGATGCAAACTGGGATTCTCCTTCCCGTGTACCTTTTTCAAGTGGGCAGCACT
CAACTCAATCTTTCCCACCCTCATTGATGTCAAAGTCCAATTCAATGTTACAGAAACCCACTGCCTATGTGCGGCCCATGGACGGACAGG
AGTCCATGGAACCAAAGCTGTCCTCTGAGCACTACAGCAGCCAATCCCATGGCAACAGCATGACTGAGCTGAAGCCCAGCAGCAAAGCAC
ATCTCACCAAGCTGAAAATACCTTCCCAACCACTGGATGCATCAGCTTCTGGTGATGTGAGCTGTGTGGATGAAATCCTAAAAGAGATGA
CGCATTCATGGCCTCCCCCTCTAACGGCTATTCATACACCATGCAAAACAGAACCTTCCAAATTTCCTTTTCCAACTAAGGAGTCTCAGC
AGTCCAATTTTGGCACTGGAGAACAAAAAAGATATAATCCTTCTAAAACTTCAAATGGGCACCAGTCTAAATCTATGTTAAAAGATGACT
TAAAACTAAGCAGCAGTGAAGACAGTGATGGGGAACAGGATTGTGATAAGACAATGCCGAGGAGTACACCAGGAAGTAACTCTGAACCTT
CACACCATAATAGTGAAGGAGCAGATAACTCCAGGGATGATTCTAGTAGCCACAGTGGATCTGAAAGCAGCTCTGGATCTGACTCAGAGA
GTGAAAGTAGTTCCAGTGACAGTGAGGCAAATGAGCCATCCCAGAGTGCATCTCCCGAGCCTGAACCCCCGCCAACAAACAAATGGCAAC
TTGATAATTGGCTGAATAAAGTGAACCCACATAAAGTGTCACCCGCCTCTTCAGTGGACAGTAACATCCCATCATCTCAAGGCTACAAAA
AGGAAGGCCGAGAGCAGGGCACTGGGAATAGCTACACTGATACAAGTGGACCTAAAGAAACGAGTTCCGCTACTCCGGGACGAGACTCCA
AAACCATCCAAAAGGGATCAGAAAGTGGGCGTGGGAGGCAGAAATCTCCTGCACAGAGTGACAGCACAACACAGAGAAGAACTGTAGGCA
AAAAACAACCCAAAAAGGCTGAGAAGGCAGCTGCTGAAGAGCCTCGTGGAGGCCTGAAGATAGAAAGTGAAACCCCTGTAGACTTGGCTA
GCAGCATGCCCTCCAGCAGACACAAAGCAGCCACCAAAGGCTCAAGGAAACCCAATATAAAGAAGGAGTCTAAGTCTTCCCCTCGACCTA
CAGCAGAGAAAAAGAAATATAAGTCAACAAGTAAATCTTCCCAGAAATCAAGGGAAATCATAGAAACAGATACCTCATCCTCAGATTCAG
ATGAAAGTGAGAGCCTTCCTCCTTCCTCACAAACTCCTAAGTACCCCGAGAGCAATAGGACTCCTGTTAAACCCTCCTCAGTGGAGGAAG
AAGATAGCTTTTTTCGGCAACGAATGTTCTCTCCTATGGAAGAGAAGGAACTTCTTTCACCCCTCAGTGAGCCTGATGACAGGTACCCAC
TTATTGTGAAGATTGACCTGAATCTTTTGACTAGAATACCAGGAAAGCCTTACAAAGAAACAGAGCCGCCCAAGGGGGAAAAGAAAAATG
TGCCAGAAAAGCACACGAGAGAGGCTCAGAAACAAGCCTCAGAAAAAGTTTCCAACAAAGGCAAGAGGAAGCATAAGAATGAAGATGATA
ACCGAGCCAGTGAGAGCAAGAAACCCAAAACGGAGGACAAGAATTCAGCAGGCCATAAGCCATCCAGCAACAGAGAGTCATCTAAGCAGA
GTGCTGCAAAAGAAAAGGATTTGTTGCCTTCTCCCGCTGGGCCTGTTCCTTCAAAAGATCCAAAAACAGAGCATGGCTCTCGGAAGAGGA
CTATTAGTCAGTCTTCTTCCTTAAAGTCAAGCAGTAACAGCAACAAGGAGACGAGTGGCAGCAGCAAAAACAGTTCCTCCACATCAAAGC
AGAAGAAGACCGAAGGGAAGACTTCCAGTAGCTCCAAGGAGGTTAAGGAAAAGGCTCCAAGTAGCTCCTCTAACTGTCCTCCATCTGCAC
CAACTCTTGATTCTTCTAAGCCTCGGAGAACAAAGCTTGTCTTTGATGACAGTGCCGCCAGTCATCCGTGTCTATCCAGAGAGCCAGGCA
CAGGAGCCTGGAGTGGCAGCCAGCCTAAGATGCCATGCTGAGGGCATTCCCATGCCCAGAATCACTTGGCTGAAAAACGGCGTGGATGTC
TCAACTCAGATGTCCAAACAGCTCTCCCTTTTAGCCAATGGGAGCGAACTCCACATCAGCAGTGTTCGGTATGAAGACACAGGGGCATAC
ACCTGCATTGCCAAAAATGAAGTGGGTGTGGATGAAGATATCTCCTCGCTCTTCATTGAAGACTCAGCTAGAAAGACCCTTGCAAACATC
CTGTGGCGAGAGGAAGGCCTCAGCGTGGGAAACATGTTCTATGTCTTCTCCGACGACGGTATCATCGTCATCCATCCTGTGGACTGTGAG
ATCCAGAGGCACCTCAAACCCACGGAAAAGATTTTCATGAGCTATGAAGAAATCTGTCCTCAAAGAGAAAAAAATGCAACCCAGCCCTGC
CAGTGGGTATCTGCAGTCAATGTCCGGAACCGGTACATCTATGTGGCCCAGCCAGCACTGAGCAGAGTCCTTGTGGTCGACATCCAAGCC
CAGAAAGTCCTACAGTCCATAGGTGTGGACCCTCTGCCGGCTAAGCTGTCCTATGACAAGTCACATGACCAAGTGTGGGTCCTGAGCTGG
GGGGACGTGCACAAGTCCCGACCAAGTCTCCAGGTGATCACAGAAGCCAGCACCGGCCAGAGCCAGCACCTCATCCGCACACCCTTTGCA
GGAGTGGATGATTTCTTCATTCCCCCAACAAACCTCATCATCAACCACATCAGGTTTGGCTTCATCTTCAACAAGTCTGATCCTGCAGTC
CACAAGGTGGACCTGGAAACAATGATGCCCCTCAAGACCATCGGCCTGCACCACCATGGCTGCGTGCCCCAGGCCATGGCACACACCCAC
CTGGGCGGCTACTTCTTCATCCAGTGCCGACAGGACAGCCCCGCCTCTGCTGCCCGACAGCTGCTCGTTGACAGTGTCACAGACTCTGTG
CTTGGCCCCAATGGTGATGTAACAGGCACCCCACACACATCCCCCGACGGGCGCTTCATAGTCAGTGCTGCAGCTGACAGCCCCTGGCTG
CACGTGCAGGAGATCACAGTGCGGGGCGAGATCCAGACCCTGTATGACCTGCAAATAAACTCGGGCATCTCAGACTTGGCCTTCCAGCGC
TCCTTCACTGAAAGCAATCAATACAACATCTACGCGGCTCTGCACACGGAGCCGGACCTGCTGTTCCTGGAGCTGTCCACGGGGAAGGTG
GGCATGCTGAAGAACTTAAAGGAGCCACCCGCAGGGCCAGCTCAGCCCTGGGGGGGTACCCACAGAATCATGAGGGACAGTGGGCTGTTT
GGACAGTACCTCCTCACACCAGCCCGAGAGTCACTGTTCCTCATCAATGGGAGACAAAACACGCTGCGGTGTGAGGTGTCAGGTATAAAG
GGGGGGACCACAGTGGTGTGGGTGGGTGAGGTATGAAGGGCCCAGAGCAGAGCCCTGGGCCAAGGAACACCCCCTAGTCCTGACACTGCA
GCCTCAAGCAGGTACGCTGTACATTTTTACAGACAAAAGCAAAAACCTGTACTCGCTTTGTGGTTCAACACTGGTCTCCTTGCAAGTTTC
CTAGTATAAGGTATGCGCTGCTACCAAGATTGGGGTTTTTTCGTTAGGAAGTATGATTTATGCCTTGAGCTACGATGAGAACATATGCTG
CTGTGTAAAGGGATCATTTCTGTGCCAAGCTGCACACCGAGTGACCTGGGGACATCATGGAACCAAGGGATCCTGCTCTCCAAGCAGACA
CCTCTGTCAGTTGCCTTCACATAGTCATTGTCCCTTACTGCCAGACCCAGCCAGACTTTGCCCTGACGGAGTGGCCCGGAAGCAGAGGCT
GACCAGGAGCAGGGGCCTCCCTCCCGAACTGAAAGCCCATCCGTCCTCGCGTGGGACCGCATCTTCTCCCTCGCAGCTGCTTCTTGCTTT
TCTTTCCATTTGACTTGCTGTAAGCCTGAGGGAGAGCCAACAAGACTTACTGCATCTTGGGGGATGGGGAAATCACTCACTTTATTTTGG
AAATTTTTGATTAAAAAAAAATTTTATAATCTCAAATGCTAGTAAGCAGAAAGATGCTCTCCGAGGTCCAACTATATCCTTCCCTGCCTT
AGGCCGAGTCTCGGGGGTGGTCACAACCCCACATCCCACAGCCAGAAAGAACAATGGTCATCTGAGAATACTGGCCCTGTCGACTATTGC
CACCCTGCTTCTCCAAGAGCAGACCAGGCCACCTCATCCGTAAGGACTCGGTTCTGTGTTGGGACCCCAAAAAACCAGAACAAGTTCTGT
GTGCCTCCTTTCAGCACAGAAGGGAGACATCTCATTAGTCAGGTCTGGTACCCCAGATTCAGGGCAGACTGGGCTTGCCTGGCAAGGTAT
GGGTGGCCTCCAGGCTCAATGCAGAAACCCCAAGGACACGAGTGGGGCCAGGTGAGTTCCTGAAGCTATACCTTTTCAAAACAGATTTTG
TTTTCCTACCTGTGGCCCATCCACTCCTCTCTGGTACCCCATCCCCGCATCAGCACTGCAGAGAGAACACATTTCGGCGAGGGTTTTCTT
ACCCACATTCCCCAATCAATACACACACACTGCAGAACCCAGAACAGAAGGCCACAGGCTGGCACTACTGCATTCTCCTTATGTGTCTCA
GGCTGTGGTGACTCTCACATGGGCATCGAAGAAGTACAACCCACATAGCCCTCTGGAGACCGCCTAGATCAGAGACTCAGCAAAAACAGG
CTCGCCTTCCCTCTCCCACATATGAGTGGAACTTACATGTGTCCTGGTTTGAATGATCATTTTGCAAGCCACACGGGTTGGGAGAGGTGG
TCTCACCACAGACGTCTTTGCTAATTTGGCCACCTTCACCTACTGACATGACCAGGATTTTCCTTTGCCATTAAGGAATGAACTCTTTCA
AGGAGAGGAAACCCTAGACTCTGTGTCACTCTCAACACACACAGCTCCTTTCACTCCTGCCTGACTGCCAAGCCACCTGCATCCCCCGCC
CCAGATCTCATGAGATCAATCACTTGTATGTCTCACGCAACTTGGTCCACCAAACGCCTGTCCCCTGTAACTCCTAGGGGTGCGCCTAGA
CAGGTACGTCTGTTTTTTATTTTAAAAGATATGCTATGTAGATATAAGTTGAGGAAGCTCACCTCAAAAGCCTAGAATGCAGTTTCACAG
TAGCTGGGATGCATGGATGACCCATCTCACCCCTTTTTTTTTCCTGCCTCAATATCTTGATATGTTATGTTTACTCCCAATCTCCCATTT
TTACCACTAAAATTCTCCAACTTTCATAAACTTTTTTTTGGAAAAATTTCCATTGTATCAGCCCCTGACAGAAAAAGGATCTCTGAGCCT
AAAGGAGGAAAAGTCCCACCAACTACCAGACCAGAACACGAGCCCCTCTGGGCAGCAGGATTCCTAAGTCAAAGACCAGTTTGACCCAAA
CTGGCCTTTTAAAATAATCAGGAGTGACAGAGTCAACTTCTGCAGCACCTGCTTCTCCCCCACTGTCCCTTCCATCTTGGAATGTGTCTA
AAAAAGCATAGCTGCCCTTTGCTGTCCTCAGAGTGCATTTCCTGGAGACGGCAGGCTTAGGTCTCACTGACAGCATGCCAGACACAACTG
AATCGAAGCAGGCCTGAAGCCTAGGTCAGGGTTTCAGGAGTCCAGCCCCAGGAGGCAAAGTCACCAATGCAGGGAGGTAAATGCCTTTTG
GCAGGAAAACCAATAGAGTTGGTTGGGTGGGGAGTCAGGGGTGGGAGGAGAAGGAGGAAGAGGAGGAAGGCCAGACTGGCCTGCCCTTTC
TCCCATACTTCACCCCAGCAGAGGTTCATGGGACACAGTTGGAAAGCCACTGGGAGGAAATGCCTCACTACAGGGGGGCCTCCTGTAGCA
AGCCCAGCCGGTAATCCTCCTAATGAACCCACAAGGTCAATTCACAACTGATATCTTAGCTATTAAAGAAGTACTGACTTTACCAAAAGA


Top

FusionGenePPI for AFF4_FSTL4


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
AFF4TRAF2, SIAH1, CDK9, CCNT1, MLLT3, MLLT1, AFF1, KMT2A, ELL2, SPP1, GRK5, MED26, MED19, EAF1, ELL, EAF2, CCNT2, CDK15, HECW2, AP2B1, GOLGA2, MTUS2, FAM9A, HEXIM1, ELL3, EDA, DENND2D, RXRB, CTR9, CNOT1, PIP4K2A, CAMKV, MDK, PES1, ARRB2, RSBN1, EPB41L5, PBX2, TRIM25FSTL4KCMF1, UBR4, RPL23


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for AFF4_FSTL4


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for AFF4_FSTL4


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneAFF4C0005941Bone Diseases, Developmental1CTD_human
HgeneAFF4C0009241Cognition Disorders1CTD_human
HgeneAFF4C0018273Growth Disorders1CTD_human
HgeneAFF4C0018798Congenital Heart Defects1CTD_human
HgeneAFF4C0024115Lung diseases1CTD_human
HgeneAFF4C0028754Obesity1CTD_human;HPO
HgeneAFF4C0282631Facies1CTD_human
HgeneAFF4C4085597CHOPS SYNDROME1ORPHANET;UNIPROT