FusionGDB Logo

Home

Download

Statistics

Examples

Help

Contact

Center for Computational Systems Medicine
leaf

FusionGeneSummary

leaf

FusionProtFeature

leaf

FusionGeneSequence

leaf

FusionGenePPI

leaf

RelatedDrugs

leaf

RelatedDiseases

Fusion gene ID: 1015

FusionGeneSummary for AFF3_HDAC5

check button Fusion gene summary
Fusion gene informationFusion gene name: AFF3_HDAC5
Fusion gene ID: 1015
HgeneTgene
Gene symbol

AFF3

HDAC5

Gene ID

3899

10014

Gene nameAF4/FMR2 family member 3histone deacetylase 5
SynonymsLAF4|MLLT2-likeHD5|NY-CO-9
Cytomap

2q11.2

17q21.31

Type of geneprotein-codingprotein-coding
DescriptionAF4/FMR2 family member 3MLLT2-related proteinlymphoid nuclear protein 4lymphoid nuclear protein related to AF4protein LAF-4histone deacetylase 5antigen NY-CO-9
Modification date2018052320180522
UniProtAcc

P51826

Q9UQL6

Ensembl transtripts involved in fusion geneENST00000409236, ENST00000356421, 
ENST00000317233, ENST00000409579, 
ENST00000483600, 
ENST00000225983, 
ENST00000393622, ENST00000336057, 
ENST00000586802, 
Fusion gene scores* DoF score12 X 9 X 5=5408 X 5 X 7=280
# samples 128
** MAII scorelog2(12/540*10)=-2.16992500144231
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
log2(8/280*10)=-1.8073549220576
possibly effective Gene in Pan-Cancer Fusion Genes (peGinPCFGs).
DoF>8 and MAII<0
Context

PubMed: AFF3 [Title/Abstract] AND HDAC5 [Title/Abstract] AND fusion [Title/Abstract]

Functional or gene categories assigned by FusionGDB annotationOncogene involved fusion gene, in-frame and retained their domain.
* DoF score (Degree of Frequency) = # partners X # break points X # cancer types
** MAII score (Major Active Isofusion Index) = log2(# samples/DoF score*10)

check button Gene ontology of each fusion partner gene with evidence of Inferred from Direct Assay (IDA) from Entrez
PartnerGeneGO IDGO termPubMed ID
TgeneHDAC5

GO:0000122

negative regulation of transcription by RNA polymerase II

16236793

TgeneHDAC5

GO:0016575

histone deacetylation

10869435


check button Fusion gene information from three resources
(ChiTars (NAR, 2018), tumorfusions (NAR, 2018), Gao et al. (Cell, 2018))
* All genome coordinats were lifted-over on hg19.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
Data typeSourceCancer typeSampleHgeneHchrHbpHstrandTgeneTchrTbpTstrand
TCGARVPRADTCGA-YL-A8HO-01AAFF3chr2

100623094

-HDAC5chr17

42171202

-
TCGALDPRADTCGA-YL-A8HO-01AAFF3chr2

100623094

-HDAC5chr17

42195072

-
* LD: Li Ding group's fusion gene list
  RV: Roel Verhaak group's fusion gene list
  ChiTaRs fusion database

check button Open reading frame (ORF) analsis of fusion genes based on Ensembl gene isoform structure.
* Click on the break point to see the gene structure around the break point region using the UCSC Genome Browser.
ORFHenstTenstHgeneHchrHbpHstrandTgeneTchrTbpTstrand
In-frameENST00000409236ENST00000225983AFF3chr2

100623094

-HDAC5chr17

42171202

-
In-frameENST00000409236ENST00000393622AFF3chr2

100623094

-HDAC5chr17

42171202

-
In-frameENST00000409236ENST00000336057AFF3chr2

100623094

-HDAC5chr17

42171202

-
In-frameENST00000409236ENST00000586802AFF3chr2

100623094

-HDAC5chr17

42171202

-
Frame-shitENST00000356421ENST00000225983AFF3chr2

100623094

-HDAC5chr17

42171202

-
Frame-shitENST00000356421ENST00000393622AFF3chr2

100623094

-HDAC5chr17

42171202

-
Frame-shitENST00000356421ENST00000336057AFF3chr2

100623094

-HDAC5chr17

42171202

-
Frame-shitENST00000356421ENST00000586802AFF3chr2

100623094

-HDAC5chr17

42171202

-
Frame-shitENST00000317233ENST00000225983AFF3chr2

100623094

-HDAC5chr17

42171202

-
Frame-shitENST00000317233ENST00000393622AFF3chr2

100623094

-HDAC5chr17

42171202

-
Frame-shitENST00000317233ENST00000336057AFF3chr2

100623094

-HDAC5chr17

42171202

-
Frame-shitENST00000317233ENST00000586802AFF3chr2

100623094

-HDAC5chr17

42171202

-
Frame-shitENST00000409579ENST00000225983AFF3chr2

100623094

-HDAC5chr17

42171202

-
Frame-shitENST00000409579ENST00000393622AFF3chr2

100623094

-HDAC5chr17

42171202

-
Frame-shitENST00000409579ENST00000336057AFF3chr2

100623094

-HDAC5chr17

42171202

-
Frame-shitENST00000409579ENST00000586802AFF3chr2

100623094

-HDAC5chr17

42171202

-
intron-3CDSENST00000483600ENST00000225983AFF3chr2

100623094

-HDAC5chr17

42171202

-
intron-3CDSENST00000483600ENST00000393622AFF3chr2

100623094

-HDAC5chr17

42171202

-
intron-3CDSENST00000483600ENST00000336057AFF3chr2

100623094

-HDAC5chr17

42171202

-
intron-3CDSENST00000483600ENST00000586802AFF3chr2

100623094

-HDAC5chr17

42171202

-
5CDS-5UTRENST00000409236ENST00000225983AFF3chr2

100623094

-HDAC5chr17

42195072

-
5CDS-5UTRENST00000409236ENST00000393622AFF3chr2

100623094

-HDAC5chr17

42195072

-
5CDS-5UTRENST00000409236ENST00000336057AFF3chr2

100623094

-HDAC5chr17

42195072

-
5CDS-5UTRENST00000409236ENST00000586802AFF3chr2

100623094

-HDAC5chr17

42195072

-
5CDS-5UTRENST00000356421ENST00000225983AFF3chr2

100623094

-HDAC5chr17

42195072

-
5CDS-5UTRENST00000356421ENST00000393622AFF3chr2

100623094

-HDAC5chr17

42195072

-
5CDS-5UTRENST00000356421ENST00000336057AFF3chr2

100623094

-HDAC5chr17

42195072

-
5CDS-5UTRENST00000356421ENST00000586802AFF3chr2

100623094

-HDAC5chr17

42195072

-
5CDS-5UTRENST00000317233ENST00000225983AFF3chr2

100623094

-HDAC5chr17

42195072

-
5CDS-5UTRENST00000317233ENST00000393622AFF3chr2

100623094

-HDAC5chr17

42195072

-
5CDS-5UTRENST00000317233ENST00000336057AFF3chr2

100623094

-HDAC5chr17

42195072

-
5CDS-5UTRENST00000317233ENST00000586802AFF3chr2

100623094

-HDAC5chr17

42195072

-
5CDS-5UTRENST00000409579ENST00000225983AFF3chr2

100623094

-HDAC5chr17

42195072

-
5CDS-5UTRENST00000409579ENST00000393622AFF3chr2

100623094

-HDAC5chr17

42195072

-
5CDS-5UTRENST00000409579ENST00000336057AFF3chr2

100623094

-HDAC5chr17

42195072

-
5CDS-5UTRENST00000409579ENST00000586802AFF3chr2

100623094

-HDAC5chr17

42195072

-
intron-5UTRENST00000483600ENST00000225983AFF3chr2

100623094

-HDAC5chr17

42195072

-
intron-5UTRENST00000483600ENST00000393622AFF3chr2

100623094

-HDAC5chr17

42195072

-
intron-5UTRENST00000483600ENST00000336057AFF3chr2

100623094

-HDAC5chr17

42195072

-
intron-5UTRENST00000483600ENST00000586802AFF3chr2

100623094

-HDAC5chr17

42195072

-

Top

FusionProtFeatures for AFF3_HDAC5


check buttonMain function of each fusion partner protein. (from UniProt)
HgeneTgene
AFF3

P51826

HDAC5

Q9UQL6

Responsible for the deacetylation of lysine residues onthe N-terminal part of the core histones (H2A, H2B, H3 and H4).Histone deacetylation gives a tag for epigenetic repression andplays an important role in transcriptional regulation, cell cycleprogression and developmental events. Histone deacetylases act viathe formation of large multiprotein complexes. Involved in musclematuration by repressing transcription of myocyte enhancer MEF2C.During muscle differentiation, it shuttles into the cytoplasm,allowing the expression of myocyte enhancer factors. Involved inthe MTA1-mediated epigenetic regulation of ESR1 expression inbreast cancer. {ECO:0000269|PubMed:24413532}.

check buttonRetention analysis result of each fusion partner protein across 39 protein features of UniProt such as six molecule processing features, 13 region features, four site features, six amino acid modification features, two natural variation features, five experimental info features, and 3 secondary structure features. Here, because of limited space for viewing, we only show the protein feature retention information belong to the 13 regional features. All retention annotation result can be downloaded at

download page

.

* Minus value of BPloci means that the break pointn is located before the CDS.
- In-frame and retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
TgeneHDAC5chr2:100623094chr17:42171202ENST00000225983-2271099_1104321124Compositional biasNote=Poly-Ala
TgeneHDAC5chr2:100623094chr17:42171202ENST00000225983-22747_52321124Compositional biasNote=Poly-Gly
TgeneHDAC5chr2:100623094chr17:42171202ENST00000225983-227596_599321124Compositional biasNote=Poly-Glu
TgeneHDAC5chr2:100623094chr17:42171202ENST00000225983-22785_92321124Compositional biasNote=Poly-Gln
TgeneHDAC5chr2:100623094chr17:42171202ENST00000336057-2251099_1104311038Compositional biasNote=Poly-Ala
TgeneHDAC5chr2:100623094chr17:42171202ENST00000336057-22547_52311038Compositional biasNote=Poly-Gly
TgeneHDAC5chr2:100623094chr17:42171202ENST00000336057-225596_599311038Compositional biasNote=Poly-Glu
TgeneHDAC5chr2:100623094chr17:42171202ENST00000336057-22585_92311038Compositional biasNote=Poly-Gln
TgeneHDAC5chr2:100623094chr17:42171202ENST00000393622-2271099_1104311123Compositional biasNote=Poly-Ala
TgeneHDAC5chr2:100623094chr17:42171202ENST00000393622-22747_52311123Compositional biasNote=Poly-Gly
TgeneHDAC5chr2:100623094chr17:42171202ENST00000393622-227596_599311123Compositional biasNote=Poly-Glu
TgeneHDAC5chr2:100623094chr17:42171202ENST00000393622-22785_92311123Compositional biasNote=Poly-Gln
TgeneHDAC5chr2:100623094chr17:42171202ENST00000586802-2271099_1104311123Compositional biasNote=Poly-Ala
TgeneHDAC5chr2:100623094chr17:42171202ENST00000586802-22747_52311123Compositional biasNote=Poly-Gly
TgeneHDAC5chr2:100623094chr17:42171202ENST00000586802-227596_599311123Compositional biasNote=Poly-Glu
TgeneHDAC5chr2:100623094chr17:42171202ENST00000586802-22785_92311123Compositional biasNote=Poly-Gln
TgeneHDAC5chr2:100623094chr17:42171202ENST00000225983-2271081_1122321124MotifNote=Nuclear export signal
TgeneHDAC5chr2:100623094chr17:42171202ENST00000336057-2251081_1122311038MotifNote=Nuclear export signal
TgeneHDAC5chr2:100623094chr17:42171202ENST00000393622-2271081_1122311123MotifNote=Nuclear export signal
TgeneHDAC5chr2:100623094chr17:42171202ENST00000586802-2271081_1122311123MotifNote=Nuclear export signal
TgeneHDAC5chr2:100623094chr17:42171202ENST00000225983-227684_1028321124RegionNote=Histone deacetylase
TgeneHDAC5chr2:100623094chr17:42171202ENST00000336057-225684_1028311038RegionNote=Histone deacetylase
TgeneHDAC5chr2:100623094chr17:42171202ENST00000393622-227684_1028311123RegionNote=Histone deacetylase
TgeneHDAC5chr2:100623094chr17:42171202ENST00000586802-227684_1028311123RegionNote=Histone deacetylase

- In-frame and not-retained protein feature among the 13 regional features.
>>>>>>>>>>>>>>>>
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenProtein featureProtein feature note
HgeneAFF3chr2:100623094chr17:42171202ENST00000317233-624413_4192911227Compositional biasNote=Poly-Ser
HgeneAFF3chr2:100623094chr17:42171202ENST00000317233-624422_4322911227Compositional biasNote=Poly-Ser
HgeneAFF3chr2:100623094chr17:42171202ENST00000317233-624440_4452911227Compositional biasNote=Poly-Ser
HgeneAFF3chr2:100623094chr17:42171202ENST00000317233-624670_6792911227Compositional biasNote=Poly-Ser
HgeneAFF3chr2:100623094chr17:42171202ENST00000356421-624413_4193161252Compositional biasNote=Poly-Ser
HgeneAFF3chr2:100623094chr17:42171202ENST00000356421-624422_4323161252Compositional biasNote=Poly-Ser
HgeneAFF3chr2:100623094chr17:42171202ENST00000356421-624440_4453161252Compositional biasNote=Poly-Ser
HgeneAFF3chr2:100623094chr17:42171202ENST00000356421-624670_6793161252Compositional biasNote=Poly-Ser
HgeneAFF3chr2:100623094chr17:42171202ENST00000409236-523413_4192911227Compositional biasNote=Poly-Ser
HgeneAFF3chr2:100623094chr17:42171202ENST00000409236-523422_4322911227Compositional biasNote=Poly-Ser
HgeneAFF3chr2:100623094chr17:42171202ENST00000409236-523440_4452911227Compositional biasNote=Poly-Ser
HgeneAFF3chr2:100623094chr17:42171202ENST00000409236-523670_6792911227Compositional biasNote=Poly-Ser
HgeneAFF3chr2:100623094chr17:42171202ENST00000409579-725413_4193161252Compositional biasNote=Poly-Ser
HgeneAFF3chr2:100623094chr17:42171202ENST00000409579-725422_4323161252Compositional biasNote=Poly-Ser
HgeneAFF3chr2:100623094chr17:42171202ENST00000409579-725440_4453161252Compositional biasNote=Poly-Ser
HgeneAFF3chr2:100623094chr17:42171202ENST00000409579-725670_6793161252Compositional biasNote=Poly-Ser


Top

FusionGeneSequence for AFF3_HDAC5


check button For in-frame fusion transcripts, we provide the fusion transcript sequences and fusion amino acid sequences.
(nt: nucleotides, aa: amino acids)

* Fusion amino acid sequences.
>In-frame_AFF3_ENST00000409236_chr2_100623094_-_HDAC5_ENST00000225983_chr17_42171202_-_1382aa
MDSFDLALLQEWDLESLCVTEPDRNALRRKERERRNQETQQDDGTFNSSYSLFSEPYKTNKGDELSNRIQNTLGNTDEMKDFLTDRSNQS
HLVGVPKPGVPQTPVNKIDEHFVADSRAQNQPSSICSTTTSTPAAVPVQQSKRGTMGWQKAGHPPSDGQQRATQQGSLRTLLGDGVGRQQ
PRAKQVCNVEVGLQTQERPPAMAAKHSSSGHCVQNFPPSLASKPSLVQQKPTATVRPMDGQDQAPDESPKLKSSSETSVHCTSYRGVPAS
KPEPARAKAKLSKFSIPKQGEWR_SRCCQEPCPVPWGVGVEAAPALWSYGGLWWALWTPHCGSSNCSRSSWRSSSSSSCRSSSCSLSSRN
SMTT_QGSMRSSCRSTSSSSRRCWQPSSSRRCWQPSGSRSWSSSGSGSSSGRKSWRSSGWSSSCSSCGTRRRAKRVPLPALR_S_GSRNS
SCRSQRSPHQAASTIPSHSTPNAGEPTMLLWTRVPLPRAAPLGRLPPTNCLCLGPTTVETTSPSAKQPLNPT_KCVQG_NRRWLSGEAVP
SCVARMGLLLAPLRRELLRSQVPGLGRRPCVTAHPAPAPALPTAPTAPSLRMALLAQSPTSPLRCSLSTEPSLWTAPPTSSASTRLLLCP
TSP_GCRPRSLSPTHTSLPPRSCRHSRRPRGRPSSPCGRVAR_PASS_AHPLFLAACWAWHWRATGAPTGMPPCCSMCCCWSRPGSRAPS
LLCHSTGSPH__RVNVWPPACGR_ASSRGIGP_AALSPHRCRRVPRPCSSWSCNNSTSSSWRSRSSSSYSWARSSPRQGSCPGSPPPTLR
RQRRS_RSSRRSCWGREP_PCPGRAPQRVRAHRKTWRRRTRKTMGRRRRIASRLRTRRARVVLRRGPTWRSLVLDTKNCSQMPSRCSLCR
CTRRPSAWPLCPTRPWAVPSPPLLPLGA_RAPQTSPSSTSSPQVWSTTRSC_STSACAGTHTCTLSMLAGSRASGPGCRRQACLASASGS
EVAKPR_MRSRQCTLNTTPCSMGPVPSTGRS_TARSCSAPSARRCMLCCLVGASGWTVTPCGMRCTPPVLCAWQWAACWSWPSRWLQESS
RMDLPSSGPQDTTPRNPQPWDSASSTL_PSPQNSYSRS_TWARSSSWTGTFTMAMAPSRRSTMTPLCSTSLCIAMTTGTSFQALGLLKRL
VEDQAWGTM_TWHGQEVWTPPLETWSTLQPSGQW_CPLPTSSHLMWS_SPPGLMLLKDICLLWVATLSPPDVLAT_PGS__PWQGAGWCW
PWREAMT_PPSVMPLRLVSRLCSV_SCSPWMRQSCSKSPTSTQWPR_RKSSRSRANTGAVCRSSPLVWAGPCERPKQVRPRRPRL_APWP

>In-frame_AFF3_ENST00000409236_chr2_100623094_-_HDAC5_ENST00000393622_chr17_42171202_-_1382aa
MDSFDLALLQEWDLESLCVTEPDRNALRRKERERRNQETQQDDGTFNSSYSLFSEPYKTNKGDELSNRIQNTLGNTDEMKDFLTDRSNQS
HLVGVPKPGVPQTPVNKIDEHFVADSRAQNQPSSICSTTTSTPAAVPVQQSKRGTMGWQKAGHPPSDGQQRATQQGSLRTLLGDGVGRQQ
PRAKQVCNVEVGLQTQERPPAMAAKHSSSGHCVQNFPPSLASKPSLVQQKPTATVRPMDGQDQAPDESPKLKSSSETSVHCTSYRGVPAS
KPEPARAKAKLSKFSIPKQGEWR_SRCCQEPCPVPWGVGVEAAPALWSYGGLWWALWTPHCGSSNCSRSSWRSSSSSSCRSSSCSLSSRN
SMTT_QGSMRSSCRSTSSSSRRCWQPSSSRRCWQPSGSRSWSSSGSGSSSGRKSWRSSGWSSSCSSCGTRRRAKRVPLPALR_S_GSRNS
SCRSQRSPHQAASTIPSHSTPNAGEPTMLLWTRVPLPRAAPLGRLPPTNCLCLGPTTVETTSPSAKQPLNPT_KCVQG_NRRWLSGEAVP
SCVARMGLLLAPLRRELLRSQVPGLGRRPCVTAHPAPAPALPTAPTAPSLRMALLAQSPTSPLRCSLSTEPSLWTAPPTSSASTRLLLCP
TSP_GCRPRSLSPTHTSLPPRSCRHSRRPRGRPSSPCGRVAR_PASS_AHPLFLAACWAWHWRATGAPTGMPPCCSMCCCWSRPGSRAPS
LLCHSTGSPH__RVNVWPPACGR_ASSRGIGP_AALSPHRCRRVPRPCSSWSCNNSTSSSWRSRSSSSYSWARSSPRQGSCPGSPPPTLR
RQRRS_RSSRRSCWGREP_PCPGRAPQRVRAHRKTWRRRTRKTMGRRRRIASRLRTRRARVVLRRGPTWRSLVLDTKNCSQMPSRCSLCR
CTRRPSAWPLCPTRPWAVPSPPLLPLGA_RAPQTSPSSTSSPQVWSTTRSC_STSACAGTHTCTLSMLAGSRASGPGCRRQACLASASGS
EVAKPR_MRSRQCTLNTTPCSMGPVPSTGRS_TARSCSAPSARRCMLCCLVGASGWTVTPCGMRCTPPVLCAWQWAACWSWPSRWLQESS
RMDLPSSGPQDTTPRNPQPWDSASSTL_PSPQNSYSRS_TWARSSSWTGTFTMAMAPSRRSTMTPLCSTSLCIAMTTGTSFQALGLLKRL
VEDQAWGTM_TWHGQEVWTPPLETWSTLQPSGQW_CPLPTSSHLMWS_SPPGLMLLKDICLLWVATLSPPDVLAT_PGS__PWQGAGWCW
PWREAMT_PPSVMPLRLVSRLCSV_SCSPWMRQSCSKSPTSTQWPR_RKSSRSRANTGAVCRSSPLVWAGPCERPKQVRPRRPRL_APWP

>In-frame_AFF3_ENST00000409236_chr2_100623094_-_HDAC5_ENST00000336057_chr17_42171202_-_1297aa
MDSFDLALLQEWDLESLCVTEPDRNALRRKERERRNQETQQDDGTFNSSYSLFSEPYKTNKGDELSNRIQNTLGNTDEMKDFLTDRSNQS
HLVGVPKPGVPQTPVNKIDEHFVADSRAQNQPSSICSTTTSTPAAVPVQQSKRGTMGWQKAGHPPSDGQQRATQQGSLRTLLGDGVGRQQ
PRAKQVCNVEVGLQTQERPPAMAAKHSSSGHCVQNFPPSLASKPSLVQQKPTATVRPMDGQDQAPDESPKLKSSSETSVHCTSYRGVPAS
KPEPARAKAKLSKFSIPKQGEWR_SRCCQEPCPVPWGVGVEAAPALWSYGGLWWALWTPHCGSSNCSRSSWRSSSSSSCRSSSCSLSSRN
SMTT_QGSMRSSCRSTSSSSRRCWQPSSSRRCWQPSGSRSWSSSGSGSSSGRKSWRSSGWSSSCSSCGTRRRAKRVPLPALR_S_GSRNS
SCRSQRSPHQAASTIPSHSTPNAGEPTMLLWTRVPLPRAAPLGRLPPTNCLCLGPTTVETTSPSAKQPLNPT_KCVQG_NRRWLSGEAVP
SCVARMGLLLAPLRRELLRSQVPGLGRRPCVTAHPAPAPALPTAPTAPSLRMALLAQSPTSPLRCSLSTEPSLWTAPPTSSASTRLLLCP
TSP_GCRPRSLSPTHTSLPPRSCRHSRRPRGRPSSPCGRVAR_PASS_AHPLFLAACWAWHWRATGAPTGMPPCCSMCCCWSRPGSRAPS
LLCHSTGSPH__RVNVWPPACGR_ASSRGIGP_AALSPHRCRRVPRPCSSWSCNNSTSSSWRSRSSSSYSWARSSPRQGSCPGSPPPTLR
RQRRS_RSSRRSCWGREP_PCPGRAPQRVRAHRKTWRRRTRKTMGRRRRIASRLRTRRARVVLRRGPTWRSLVLDTKNCSQMPSRCSLCR
CTRRPSAWPLCPTRPWAVPSPPLLPLGA_RAPQTSPSSTSSPQAPSARRCMLCCLVGASGWTVTPCGMRCTPPVLCAWQWAACWSWPSRW
LQESSRMDLPSSGPQDTTPRNPQPWDSASSTL_PSPQNSYSRS_TWARSSSWTGTFTMAMAPSRRSTMTPLCSTSLCIAMTTGTSFQALG
LLKRLVEDQAWGTM_TWHGQEVWTPPLETWSTLQPSGQW_CPLPTSSHLMWS_SPPGLMLLKDICLLWVATLSPPDVLAT_PGS__PWQG
AGWCWPWREAMT_PPSVMPLRLVSRLCSV_SCSPWMRQSCSKSPTSTQWPR_RKSSRSRANTGAVCRSSPLVWAGPCERPKQVRPRRPRL

>In-frame_AFF3_ENST00000409236_chr2_100623094_-_HDAC5_ENST00000586802_chr17_42171202_-_1382aa
MDSFDLALLQEWDLESLCVTEPDRNALRRKERERRNQETQQDDGTFNSSYSLFSEPYKTNKGDELSNRIQNTLGNTDEMKDFLTDRSNQS
HLVGVPKPGVPQTPVNKIDEHFVADSRAQNQPSSICSTTTSTPAAVPVQQSKRGTMGWQKAGHPPSDGQQRATQQGSLRTLLGDGVGRQQ
PRAKQVCNVEVGLQTQERPPAMAAKHSSSGHCVQNFPPSLASKPSLVQQKPTATVRPMDGQDQAPDESPKLKSSSETSVHCTSYRGVPAS
KPEPARAKAKLSKFSIPKQGEWR_SRCCQEPCPVPWGVGVEAAPALWSYGGLWWALWTPHCGSSNCSRSSWRSSSSSSCRSSSCSLSSRN
SMTT_QGSMRSSCRSTSSSSRRCWQPSSSRRCWQPSGSRSWSSSGSGSSSGRKSWRSSGWSSSCSSCGTRRRAKRVPLPALR_S_GSRNS
SCRSQRSPHQAASTIPSHSTPNAGEPTMLLWTRVPLPRAAPLGRLPPTNCLCLGPTTVETTSPSAKQPLNPT_KCVQG_NRRWLSGEAVP
SCVARMGLLLAPLRRELLRSQVPGLGRRPCVTAHPAPAPALPTAPTAPSLRMALLAQSPTSPLRCSLSTEPSLWTAPPTSSASTRLLLCP
TSP_GCRPRSLSPTHTSLPPRSCRHSRRPRGRPSSPCGRVAR_PASS_AHPLFLAACWAWHWRATGAPTGMPPCCSMCCCWSRPGSRAPS
LLCHSTGSPH__RVNVWPPACGR_ASSRGIGP_AALSPHRCRRVPRPCSSWSCNNSTSSSWRSRSSSSYSWARSSPRQGSCPGSPPPTLR
RQRRS_RSSRRSCWGREP_PCPGRAPQRVRAHRKTWRRRTRKTMGRRRRIASRLRTRRARVVLRRGPTWRSLVLDTKNCSQMPSRCSLCR
CTRRPSAWPLCPTRPWAVPSPPLLPLGA_RAPQTSPSSTSSPQVWSTTRSC_STSACAGTHTCTLSMLAGSRASGPGCRRQACLASASGS
EVAKPR_MRSRQCTLNTTPCSMGPVPSTGRS_TARSCSAPSARRCMLCCLVGASGWTVTPCGMRCTPPVLCAWQWAACWSWPSRWLQESS
RMDLPSSGPQDTTPRNPQPWDSASSTL_PSPQNSYSRS_TWARSSSWTGTFTMAMAPSRRSTMTPLCSTSLCIAMTTGTSFQALGLLKRL
VEDQAWGTM_TWHGQEVWTPPLETWSTLQPSGQW_CPLPTSSHLMWS_SPPGLMLLKDICLLWVATLSPPDVLAT_PGS__PWQGAGWCW
PWREAMT_PPSVMPLRLVSRLCSV_SCSPWMRQSCSKSPTSTQWPR_RKSSRSRANTGAVCRSSPLVWAGPCERPKQVRPRRPRL_APWP


* Fusion transcript sequences (only coding sequence (CDS) region).
>In-frame_AFF3_ENST00000409236_chr2_100623094_-_HDAC5_ENST00000225983_chr17_42171202_-_4148nt
ATGGACAGCTTCGACTTAGCCCTGCTCCAGGAATGGGACCTCGAGTCACTGTGTGTCTATGAACCAGATAGAAATGCATTACGGAGGAAA
GAACGAGAAAGAAGAAATCAAGAAACTCAACAGGATGATGGCACGTTTAATTCTAGTTACTCTCTCTTCAGTGAGCCCTACAAGACTAAC
AAGGGGGATGAACTCTCCAACCGGATCCAGAACACTTTAGGCAATTATGATGAAATGAAAGACTTTTTAACTGATAGATCCAATCAGAGT
CATCTCGTTGGAGTTCCCAAACCTGGGGTTCCTCAGACTCCTGTGAACAAGATCGATGAACATTTTGTTGCAGATTCAAGAGCCCAGAAC
CAGCCCTCGTCTATCTGTAGCACTACAACTTCCACACCAGCAGCTGTCCCCGTGCAGCAGAGTAAGAGAGGCACTATGGGCTGGCAGAAG
GCTGGGCACCCACCCTCTGACGGCCAACAGAGAGCAACACAACAGGGCTCTCTCAGGACCTTGCTTGGAGATGGTGTTGGCAGACAGCAG
CCTCGGGCCAAACAAGTGTGCAATGTGGAGGTGGGCCTTCAGACCCAGGAGAGGCCACCTGCCATGGCGGCCAAGCACAGCAGCAGCGGA
CACTGTGTTCAGAACTTTCCTCCATCCCTAGCTTCAAAACCCAGCCTGGTCCAGCAGAAACCGACCGCGTATGTGAGGCCAATGGACGGC
CAAGATCAGGCCCCTGATGAGTCTCCTAAGCTGAAGTCGTCTTCGGAAACCAGCGTGCACTGCACATCATACAGGGGAGTCCCTGCCAGC
AAGCCGGAGCCTGCCAGAGCCAAGGCCAAGCTCTCCAAGTTCAGCATCCCCAAGCAGGGGGAGTGGAGGTGAAGCCGGTGCTGCCAAGAG
CCATGCCCAGTTCCATGGGGGGTGGGGGTGGAGGCAGCCCCAGCCCTGTGGAGCTACGGGGGGCTCTGGTGGGCTCTGTGGACCCCACAC
TGCGGGAGCAGCAACTGCAGCAGGAGCTCCTGGCGCTCAAGCAGCAGCAGCAGCTGCAGAAGCAGCTCCTGTTCGCTGAGTTCCAGAAAC
AGCATGACCACCTGACAAGGCAGCATGAGGTCCAGCTGCAGAAGCACCTCAAGCAGCAGCAGGAGATGCTGGCAGCCAAGCAGCAGCAGG
AGATGCTGGCAGCCAAGCGGCAGCAGGAGCTGGAGCAGCAGCGGCAGCGGGAGCAGCAGCGGCAGGAAGAGCTGGAGAAGCAGCGGCTGG
AGCAGCAGCTGCTCATCCTGCGGAACAAGGAGAAGAGCAAAGAGAGTGCCATTGCCAGCACTGAGGTAAAGCTGAGGCTCCAGGAATTCC
TCTTGTCGAAGTCAAAGGAGCCCACACCAGGCGGCCTCAACCATTCCCTCCCACAGCACCCCAAATGCTGGGGAGCCCACCATGCTTCTT
TGGACCAGAGTTCCCCTCCCCAGAGCGGCCCCCCTGGGACGCCTCCCTCCTACAAACTGCCTTTGCCTGGGCCCTACGACAGTCGAGACG
ACTTCCCCCTCCGCAAAACAGCCTCTGAACCCAACTTGAAAGTGCGTTCAAGGCTAAAACAGAAGGTGGCTGAGCGGAGAAGCAGTCCCC
TCCTGCGTCGCAAGGATGGGACTGTTATTAGCACCTTTAAGAAGAGAGCTGTTGAGATCACAGGTGCCGGGCCTGGGGCGTCGTCCGTGT
GTAACAGCGCACCCGGCTCCGGCCCCAGCTCTCCCAACAGCTCCCACAGCACCATCGCTGAGAATGGCTTTACTGGCTCAGTCCCCAACA
TCCCCACTGAGATGCTCCCTCAGCACCGAGCCCTCCCTCTGGACAGCTCCCCCAACCAGTTCAGCCTCTACACGTCTCCTTCTCTGCCCA
ACATCTCCCTAGGGCTGCAGGCCACGGTCACTGTCACCAACTCACACCTCACTGCCTCCCCGAAGCTGTCGACACAGCAGGAGGCCGAGA
GGCAGGCCCTCCAGTCCCTGCGGCAGGGTGGCACGCTGACCGGCAAGTTCATGAGCACATCCTCTATTCCTGGCTGCCTGCTGGGCGTGG
CACTGGAGGGCGACGGGAGCCCCCACGGGCATGCCTCCCTGCTGCAGCATGTGCTGTTGCTGGAGCAGGCCCGGCAGCAGAGCACCCTCA
TTGCTGTGCCACTCCACGGGCAGTCCCCACTAGTGACGGGTGAACGTGTGGCCACCAGCATGCGGACGGTAGGCAAGCTCCCGCGGCATC
GGCCCCTGAGCCGCACTCAGTCCTCACCGCTGCCGCAGAGTCCCCAGGCCCTGCAGCAGCTGGTCATGCAACAACAGCACCAGCAGTTCC
TGGAGAAGCAGAAGCAGCAGCAGCTACAGCTGGGCAAGATCCTCACCAAGACAGGGGAGCTGCCCAGGCAGCCCACCACCCACCCTGAGG
AGACAGAGGAGGAGCTGACGGAGCAGCAGGAGGTCTTGCTGGGGGAGGGAGCCCTGACCATGCCCCGGGAGGGCTCCACAGAGAGTGAGA
GCACACAGGAAGACCTGGAGGAGGAGGACGAGGAAGACGATGGGGAGGAGGAGGAGGATTGCATCCAGGTTAAGGACGAGGAGGGCGAGA
GTGGTGCTGAGGAGGGGCCCGACTTGGAGGAGCCTGGTGCTGGATACAAAAAACTGTTCTCAGATGCCCAGCCGCTGCAGCCTTTGCAGG
TGTACCAGGCGCCCCTCAGCCTGGCCACTGTGCCCCACCAGGCCCTGGGCCGTACCCAGTCCTCCCCTGCTGCCCCTGGGGGCATGAAGA
GCCCCCCAGACCAGCCCGTCAAGCACCTCTTCACCACAGGTGTGGTCTACGACACGTTCATGCTAAAGCACCAGTGCATGTGCGGGAACA
CACACGTGCACCCTGAGCATGCTGGCCGGATCCAGAGCATCTGGTCCCGGCTGCAGGAGACAGGCCTGCTTAGCAAGTGCGAGCGGATCC
GAGGTCGCAAAGCCACGCTAGATGAGATCCAGACAGTGCACTCTGAATACCACACCCTGCTCTATGGGACCAGTCCCCTCAACCGGCAGA
AGCTAGACAGCAAGAAGTTGCTCGGCCCCATCAGCCAGAAGATGTATGCTGTGCTGCCTTGTGGGGGCATCGGGGTGGACAGTGACACCG
TGTGGAATGAGATGCACTCCTCCAGTGCTGTGCGCATGGCAGTGGGCTGCCTGCTGGAGCTGGCCTTCAAGGTGGCTGCAGGAGAGCTCA
AGAATGGATTTGCCATCATCCGGCCCCCAGGACACCACGCCGAGGAATCCACAGCCATGGGATTCTGCTTCTTCAACTCTGTAGCCATCA
CCGCAAAACTCCTACAGCAGAAGTTGAACGTGGGCAAGGTCCTCATCGTGGACTGGGACATTCACCATGGCAATGGCACCCAGCAGGCGT
TCTACAATGACCCCTCTGTGCTCTACATCTCTCTGCATCGCTATGACAACGGGAACTTCTTTCCAGGCTCTGGGGCTCCTGAAGAGGTTG
GTGGAGGACCAGGCGTGGGGTACAATGTGAACGTGGCATGGACAGGAGGTGTGGACCCCCCCATTGGAGACGTGGAGTACCTTACAGCCT
TCAGGACAGTGGTGATGCCCATTGCCCACGAGTTCTCACCTGATGTGGTCCTAGTCTCCGCCGGGTTTGATGCTGTTGAAGGACATCTGT
CTCCTCTGGGTGGCTACTCTGTCACCGCCAGATGTTTTGGCCACTTGACCAGGCAGCTGATGACCCTGGCAGGGGGCCGGGTGGTGCTGG
CCCTGGAGGGAGGCCATGACTTGACCGCCATCTGTGATGCCTCTGAGGCTTGTGTCTCGGCTCTGCTCAGTGTAGAGCTGCAGCCCTTGG
ATGAGGCAGTCTTGCAGCAAAAGCCCAACATCAACGCAGTGGCCACGCTAGAGAAAGTCATCGAGATCCAGAGCAAACACTGGAGCTGTG
TGCAGAAGTTCGCCGCTGGTCTGGGCCGGTCCCTGCGAGAGGCCCAAGCAGGTGAGACCGAGGAGGCCGAGACTGTGAGCGCCATGGCCT
TGCTGTCGGTGGGGGCCGAGCAGGCCCAGGCTGCGGCAGCCCGGGAACACAGCCCCAGGCCGGCAGAGGAGCCCATGGAGCAGGAGCCTG

>In-frame_AFF3_ENST00000409236_chr2_100623094_-_HDAC5_ENST00000393622_chr17_42171202_-_4148nt
ATGGACAGCTTCGACTTAGCCCTGCTCCAGGAATGGGACCTCGAGTCACTGTGTGTCTATGAACCAGATAGAAATGCATTACGGAGGAAA
GAACGAGAAAGAAGAAATCAAGAAACTCAACAGGATGATGGCACGTTTAATTCTAGTTACTCTCTCTTCAGTGAGCCCTACAAGACTAAC
AAGGGGGATGAACTCTCCAACCGGATCCAGAACACTTTAGGCAATTATGATGAAATGAAAGACTTTTTAACTGATAGATCCAATCAGAGT
CATCTCGTTGGAGTTCCCAAACCTGGGGTTCCTCAGACTCCTGTGAACAAGATCGATGAACATTTTGTTGCAGATTCAAGAGCCCAGAAC
CAGCCCTCGTCTATCTGTAGCACTACAACTTCCACACCAGCAGCTGTCCCCGTGCAGCAGAGTAAGAGAGGCACTATGGGCTGGCAGAAG
GCTGGGCACCCACCCTCTGACGGCCAACAGAGAGCAACACAACAGGGCTCTCTCAGGACCTTGCTTGGAGATGGTGTTGGCAGACAGCAG
CCTCGGGCCAAACAAGTGTGCAATGTGGAGGTGGGCCTTCAGACCCAGGAGAGGCCACCTGCCATGGCGGCCAAGCACAGCAGCAGCGGA
CACTGTGTTCAGAACTTTCCTCCATCCCTAGCTTCAAAACCCAGCCTGGTCCAGCAGAAACCGACCGCGTATGTGAGGCCAATGGACGGC
CAAGATCAGGCCCCTGATGAGTCTCCTAAGCTGAAGTCGTCTTCGGAAACCAGCGTGCACTGCACATCATACAGGGGAGTCCCTGCCAGC
AAGCCGGAGCCTGCCAGAGCCAAGGCCAAGCTCTCCAAGTTCAGCATCCCCAAGCAGGGGGAGTGGAGGTGAAGCCGGTGCTGCCAAGAG
CCATGCCCAGTTCCATGGGGGGTGGGGGTGGAGGCAGCCCCAGCCCTGTGGAGCTACGGGGGGCTCTGGTGGGCTCTGTGGACCCCACAC
TGCGGGAGCAGCAACTGCAGCAGGAGCTCCTGGCGCTCAAGCAGCAGCAGCAGCTGCAGAAGCAGCTCCTGTTCGCTGAGTTCCAGAAAC
AGCATGACCACCTGACAAGGCAGCATGAGGTCCAGCTGCAGAAGCACCTCAAGCAGCAGCAGGAGATGCTGGCAGCCAAGCAGCAGCAGG
AGATGCTGGCAGCCAAGCGGCAGCAGGAGCTGGAGCAGCAGCGGCAGCGGGAGCAGCAGCGGCAGGAAGAGCTGGAGAAGCAGCGGCTGG
AGCAGCAGCTGCTCATCCTGCGGAACAAGGAGAAGAGCAAAGAGAGTGCCATTGCCAGCACTGAGGTAAAGCTGAGGCTCCAGGAATTCC
TCTTGTCGAAGTCAAAGGAGCCCACACCAGGCGGCCTCAACCATTCCCTCCCACAGCACCCCAAATGCTGGGGAGCCCACCATGCTTCTT
TGGACCAGAGTTCCCCTCCCCAGAGCGGCCCCCCTGGGACGCCTCCCTCCTACAAACTGCCTTTGCCTGGGCCCTACGACAGTCGAGACG
ACTTCCCCCTCCGCAAAACAGCCTCTGAACCCAACTTGAAAGTGCGTTCAAGGCTAAAACAGAAGGTGGCTGAGCGGAGAAGCAGTCCCC
TCCTGCGTCGCAAGGATGGGACTGTTATTAGCACCTTTAAGAAGAGAGCTGTTGAGATCACAGGTGCCGGGCCTGGGGCGTCGTCCGTGT
GTAACAGCGCACCCGGCTCCGGCCCCAGCTCTCCCAACAGCTCCCACAGCACCATCGCTGAGAATGGCTTTACTGGCTCAGTCCCCAACA
TCCCCACTGAGATGCTCCCTCAGCACCGAGCCCTCCCTCTGGACAGCTCCCCCAACCAGTTCAGCCTCTACACGTCTCCTTCTCTGCCCA
ACATCTCCCTAGGGCTGCAGGCCACGGTCACTGTCACCAACTCACACCTCACTGCCTCCCCGAAGCTGTCGACACAGCAGGAGGCCGAGA
GGCAGGCCCTCCAGTCCCTGCGGCAGGGTGGCACGCTGACCGGCAAGTTCATGAGCACATCCTCTATTCCTGGCTGCCTGCTGGGCGTGG
CACTGGAGGGCGACGGGAGCCCCCACGGGCATGCCTCCCTGCTGCAGCATGTGCTGTTGCTGGAGCAGGCCCGGCAGCAGAGCACCCTCA
TTGCTGTGCCACTCCACGGGCAGTCCCCACTAGTGACGGGTGAACGTGTGGCCACCAGCATGCGGACGGTAGGCAAGCTCCCGCGGCATC
GGCCCCTGAGCCGCACTCAGTCCTCACCGCTGCCGCAGAGTCCCCAGGCCCTGCAGCAGCTGGTCATGCAACAACAGCACCAGCAGTTCC
TGGAGAAGCAGAAGCAGCAGCAGCTACAGCTGGGCAAGATCCTCACCAAGACAGGGGAGCTGCCCAGGCAGCCCACCACCCACCCTGAGG
AGACAGAGGAGGAGCTGACGGAGCAGCAGGAGGTCTTGCTGGGGGAGGGAGCCCTGACCATGCCCCGGGAGGGCTCCACAGAGAGTGAGA
GCACACAGGAAGACCTGGAGGAGGAGGACGAGGAAGACGATGGGGAGGAGGAGGAGGATTGCATCCAGGTTAAGGACGAGGAGGGCGAGA
GTGGTGCTGAGGAGGGGCCCGACTTGGAGGAGCCTGGTGCTGGATACAAAAAACTGTTCTCAGATGCCCAGCCGCTGCAGCCTTTGCAGG
TGTACCAGGCGCCCCTCAGCCTGGCCACTGTGCCCCACCAGGCCCTGGGCCGTACCCAGTCCTCCCCTGCTGCCCCTGGGGGCATGAAGA
GCCCCCCAGACCAGCCCGTCAAGCACCTCTTCACCACAGGTGTGGTCTACGACACGTTCATGCTAAAGCACCAGTGCATGTGCGGGAACA
CACACGTGCACCCTGAGCATGCTGGCCGGATCCAGAGCATCTGGTCCCGGCTGCAGGAGACAGGCCTGCTTAGCAAGTGCGAGCGGATCC
GAGGTCGCAAAGCCACGCTAGATGAGATCCAGACAGTGCACTCTGAATACCACACCCTGCTCTATGGGACCAGTCCCCTCAACCGGCAGA
AGCTAGACAGCAAGAAGTTGCTCGGCCCCATCAGCCAGAAGATGTATGCTGTGCTGCCTTGTGGGGGCATCGGGGTGGACAGTGACACCG
TGTGGAATGAGATGCACTCCTCCAGTGCTGTGCGCATGGCAGTGGGCTGCCTGCTGGAGCTGGCCTTCAAGGTGGCTGCAGGAGAGCTCA
AGAATGGATTTGCCATCATCCGGCCCCCAGGACACCACGCCGAGGAATCCACAGCCATGGGATTCTGCTTCTTCAACTCTGTAGCCATCA
CCGCAAAACTCCTACAGCAGAAGTTGAACGTGGGCAAGGTCCTCATCGTGGACTGGGACATTCACCATGGCAATGGCACCCAGCAGGCGT
TCTACAATGACCCCTCTGTGCTCTACATCTCTCTGCATCGCTATGACAACGGGAACTTCTTTCCAGGCTCTGGGGCTCCTGAAGAGGTTG
GTGGAGGACCAGGCGTGGGGTACAATGTGAACGTGGCATGGACAGGAGGTGTGGACCCCCCCATTGGAGACGTGGAGTACCTTACAGCCT
TCAGGACAGTGGTGATGCCCATTGCCCACGAGTTCTCACCTGATGTGGTCCTAGTCTCCGCCGGGTTTGATGCTGTTGAAGGACATCTGT
CTCCTCTGGGTGGCTACTCTGTCACCGCCAGATGTTTTGGCCACTTGACCAGGCAGCTGATGACCCTGGCAGGGGGCCGGGTGGTGCTGG
CCCTGGAGGGAGGCCATGACTTGACCGCCATCTGTGATGCCTCTGAGGCTTGTGTCTCGGCTCTGCTCAGTGTAGAGCTGCAGCCCTTGG
ATGAGGCAGTCTTGCAGCAAAAGCCCAACATCAACGCAGTGGCCACGCTAGAGAAAGTCATCGAGATCCAGAGCAAACACTGGAGCTGTG
TGCAGAAGTTCGCCGCTGGTCTGGGCCGGTCCCTGCGAGAGGCCCAAGCAGGTGAGACCGAGGAGGCCGAGACTGTGAGCGCCATGGCCT
TGCTGTCGGTGGGGGCCGAGCAGGCCCAGGCTGCGGCAGCCCGGGAACACAGCCCCAGGCCGGCAGAGGAGCCCATGGAGCAGGAGCCTG

>In-frame_AFF3_ENST00000409236_chr2_100623094_-_HDAC5_ENST00000336057_chr17_42171202_-_3893nt
ATGGACAGCTTCGACTTAGCCCTGCTCCAGGAATGGGACCTCGAGTCACTGTGTGTCTATGAACCAGATAGAAATGCATTACGGAGGAAA
GAACGAGAAAGAAGAAATCAAGAAACTCAACAGGATGATGGCACGTTTAATTCTAGTTACTCTCTCTTCAGTGAGCCCTACAAGACTAAC
AAGGGGGATGAACTCTCCAACCGGATCCAGAACACTTTAGGCAATTATGATGAAATGAAAGACTTTTTAACTGATAGATCCAATCAGAGT
CATCTCGTTGGAGTTCCCAAACCTGGGGTTCCTCAGACTCCTGTGAACAAGATCGATGAACATTTTGTTGCAGATTCAAGAGCCCAGAAC
CAGCCCTCGTCTATCTGTAGCACTACAACTTCCACACCAGCAGCTGTCCCCGTGCAGCAGAGTAAGAGAGGCACTATGGGCTGGCAGAAG
GCTGGGCACCCACCCTCTGACGGCCAACAGAGAGCAACACAACAGGGCTCTCTCAGGACCTTGCTTGGAGATGGTGTTGGCAGACAGCAG
CCTCGGGCCAAACAAGTGTGCAATGTGGAGGTGGGCCTTCAGACCCAGGAGAGGCCACCTGCCATGGCGGCCAAGCACAGCAGCAGCGGA
CACTGTGTTCAGAACTTTCCTCCATCCCTAGCTTCAAAACCCAGCCTGGTCCAGCAGAAACCGACCGCGTATGTGAGGCCAATGGACGGC
CAAGATCAGGCCCCTGATGAGTCTCCTAAGCTGAAGTCGTCTTCGGAAACCAGCGTGCACTGCACATCATACAGGGGAGTCCCTGCCAGC
AAGCCGGAGCCTGCCAGAGCCAAGGCCAAGCTCTCCAAGTTCAGCATCCCCAAGCAGGGGGAGTGGAGGTGAAGCCGGTGCTGCCAAGAG
CCATGCCCAGTTCCATGGGGGGTGGGGGTGGAGGCAGCCCCAGCCCTGTGGAGCTACGGGGGGCTCTGGTGGGCTCTGTGGACCCCACAC
TGCGGGAGCAGCAACTGCAGCAGGAGCTCCTGGCGCTCAAGCAGCAGCAGCAGCTGCAGAAGCAGCTCCTGTTCGCTGAGTTCCAGAAAC
AGCATGACCACCTGACAAGGCAGCATGAGGTCCAGCTGCAGAAGCACCTCAAGCAGCAGCAGGAGATGCTGGCAGCCAAGCAGCAGCAGG
AGATGCTGGCAGCCAAGCGGCAGCAGGAGCTGGAGCAGCAGCGGCAGCGGGAGCAGCAGCGGCAGGAAGAGCTGGAGAAGCAGCGGCTGG
AGCAGCAGCTGCTCATCCTGCGGAACAAGGAGAAGAGCAAAGAGAGTGCCATTGCCAGCACTGAGGTAAAGCTGAGGCTCCAGGAATTCC
TCTTGTCGAAGTCAAAGGAGCCCACACCAGGCGGCCTCAACCATTCCCTCCCACAGCACCCCAAATGCTGGGGAGCCCACCATGCTTCTT
TGGACCAGAGTTCCCCTCCCCAGAGCGGCCCCCCTGGGACGCCTCCCTCCTACAAACTGCCTTTGCCTGGGCCCTACGACAGTCGAGACG
ACTTCCCCCTCCGCAAAACAGCCTCTGAACCCAACTTGAAAGTGCGTTCAAGGCTAAAACAGAAGGTGGCTGAGCGGAGAAGCAGTCCCC
TCCTGCGTCGCAAGGATGGGACTGTTATTAGCACCTTTAAGAAGAGAGCTGTTGAGATCACAGGTGCCGGGCCTGGGGCGTCGTCCGTGT
GTAACAGCGCACCCGGCTCCGGCCCCAGCTCTCCCAACAGCTCCCACAGCACCATCGCTGAGAATGGCTTTACTGGCTCAGTCCCCAACA
TCCCCACTGAGATGCTCCCTCAGCACCGAGCCCTCCCTCTGGACAGCTCCCCCAACCAGTTCAGCCTCTACACGTCTCCTTCTCTGCCCA
ACATCTCCCTAGGGCTGCAGGCCACGGTCACTGTCACCAACTCACACCTCACTGCCTCCCCGAAGCTGTCGACACAGCAGGAGGCCGAGA
GGCAGGCCCTCCAGTCCCTGCGGCAGGGTGGCACGCTGACCGGCAAGTTCATGAGCACATCCTCTATTCCTGGCTGCCTGCTGGGCGTGG
CACTGGAGGGCGACGGGAGCCCCCACGGGCATGCCTCCCTGCTGCAGCATGTGCTGTTGCTGGAGCAGGCCCGGCAGCAGAGCACCCTCA
TTGCTGTGCCACTCCACGGGCAGTCCCCACTAGTGACGGGTGAACGTGTGGCCACCAGCATGCGGACGGTAGGCAAGCTCCCGCGGCATC
GGCCCCTGAGCCGCACTCAGTCCTCACCGCTGCCGCAGAGTCCCCAGGCCCTGCAGCAGCTGGTCATGCAACAACAGCACCAGCAGTTCC
TGGAGAAGCAGAAGCAGCAGCAGCTACAGCTGGGCAAGATCCTCACCAAGACAGGGGAGCTGCCCAGGCAGCCCACCACCCACCCTGAGG
AGACAGAGGAGGAGCTGACGGAGCAGCAGGAGGTCTTGCTGGGGGAGGGAGCCCTGACCATGCCCCGGGAGGGCTCCACAGAGAGTGAGA
GCACACAGGAAGACCTGGAGGAGGAGGACGAGGAAGACGATGGGGAGGAGGAGGAGGATTGCATCCAGGTTAAGGACGAGGAGGGCGAGA
GTGGTGCTGAGGAGGGGCCCGACTTGGAGGAGCCTGGTGCTGGATACAAAAAACTGTTCTCAGATGCCCAGCCGCTGCAGCCTTTGCAGG
TGTACCAGGCGCCCCTCAGCCTGGCCACTGTGCCCCACCAGGCCCTGGGCCGTACCCAGTCCTCCCCTGCTGCCCCTGGGGGCATGAAGA
GCCCCCCAGACCAGCCCGTCAAGCACCTCTTCACCACAGGCCCCATCAGCCAGAAGATGTATGCTGTGCTGCCTTGTGGGGGCATCGGGG
TGGACAGTGACACCGTGTGGAATGAGATGCACTCCTCCAGTGCTGTGCGCATGGCAGTGGGCTGCCTGCTGGAGCTGGCCTTCAAGGTGG
CTGCAGGAGAGCTCAAGAATGGATTTGCCATCATCCGGCCCCCAGGACACCACGCCGAGGAATCCACAGCCATGGGATTCTGCTTCTTCA
ACTCTGTAGCCATCACCGCAAAACTCCTACAGCAGAAGTTGAACGTGGGCAAGGTCCTCATCGTGGACTGGGACATTCACCATGGCAATG
GCACCCAGCAGGCGTTCTACAATGACCCCTCTGTGCTCTACATCTCTCTGCATCGCTATGACAACGGGAACTTCTTTCCAGGCTCTGGGG
CTCCTGAAGAGGTTGGTGGAGGACCAGGCGTGGGGTACAATGTGAACGTGGCATGGACAGGAGGTGTGGACCCCCCCATTGGAGACGTGG
AGTACCTTACAGCCTTCAGGACAGTGGTGATGCCCATTGCCCACGAGTTCTCACCTGATGTGGTCCTAGTCTCCGCCGGGTTTGATGCTG
TTGAAGGACATCTGTCTCCTCTGGGTGGCTACTCTGTCACCGCCAGATGTTTTGGCCACTTGACCAGGCAGCTGATGACCCTGGCAGGGG
GCCGGGTGGTGCTGGCCCTGGAGGGAGGCCATGACTTGACCGCCATCTGTGATGCCTCTGAGGCTTGTGTCTCGGCTCTGCTCAGTGTAG
AGCTGCAGCCCTTGGATGAGGCAGTCTTGCAGCAAAAGCCCAACATCAACGCAGTGGCCACGCTAGAGAAAGTCATCGAGATCCAGAGCA
AACACTGGAGCTGTGTGCAGAAGTTCGCCGCTGGTCTGGGCCGGTCCCTGCGAGAGGCCCAAGCAGGTGAGACCGAGGAGGCCGAGACTG
TGAGCGCCATGGCCTTGCTGTCGGTGGGGGCCGAGCAGGCCCAGGCTGCGGCAGCCCGGGAACACAGCCCCAGGCCGGCAGAGGAGCCCA

>In-frame_AFF3_ENST00000409236_chr2_100623094_-_HDAC5_ENST00000586802_chr17_42171202_-_4148nt
ATGGACAGCTTCGACTTAGCCCTGCTCCAGGAATGGGACCTCGAGTCACTGTGTGTCTATGAACCAGATAGAAATGCATTACGGAGGAAA
GAACGAGAAAGAAGAAATCAAGAAACTCAACAGGATGATGGCACGTTTAATTCTAGTTACTCTCTCTTCAGTGAGCCCTACAAGACTAAC
AAGGGGGATGAACTCTCCAACCGGATCCAGAACACTTTAGGCAATTATGATGAAATGAAAGACTTTTTAACTGATAGATCCAATCAGAGT
CATCTCGTTGGAGTTCCCAAACCTGGGGTTCCTCAGACTCCTGTGAACAAGATCGATGAACATTTTGTTGCAGATTCAAGAGCCCAGAAC
CAGCCCTCGTCTATCTGTAGCACTACAACTTCCACACCAGCAGCTGTCCCCGTGCAGCAGAGTAAGAGAGGCACTATGGGCTGGCAGAAG
GCTGGGCACCCACCCTCTGACGGCCAACAGAGAGCAACACAACAGGGCTCTCTCAGGACCTTGCTTGGAGATGGTGTTGGCAGACAGCAG
CCTCGGGCCAAACAAGTGTGCAATGTGGAGGTGGGCCTTCAGACCCAGGAGAGGCCACCTGCCATGGCGGCCAAGCACAGCAGCAGCGGA
CACTGTGTTCAGAACTTTCCTCCATCCCTAGCTTCAAAACCCAGCCTGGTCCAGCAGAAACCGACCGCGTATGTGAGGCCAATGGACGGC
CAAGATCAGGCCCCTGATGAGTCTCCTAAGCTGAAGTCGTCTTCGGAAACCAGCGTGCACTGCACATCATACAGGGGAGTCCCTGCCAGC
AAGCCGGAGCCTGCCAGAGCCAAGGCCAAGCTCTCCAAGTTCAGCATCCCCAAGCAGGGGGAGTGGAGGTGAAGCCGGTGCTGCCAAGAG
CCATGCCCAGTTCCATGGGGGGTGGGGGTGGAGGCAGCCCCAGCCCTGTGGAGCTACGGGGGGCTCTGGTGGGCTCTGTGGACCCCACAC
TGCGGGAGCAGCAACTGCAGCAGGAGCTCCTGGCGCTCAAGCAGCAGCAGCAGCTGCAGAAGCAGCTCCTGTTCGCTGAGTTCCAGAAAC
AGCATGACCACCTGACAAGGCAGCATGAGGTCCAGCTGCAGAAGCACCTCAAGCAGCAGCAGGAGATGCTGGCAGCCAAGCAGCAGCAGG
AGATGCTGGCAGCCAAGCGGCAGCAGGAGCTGGAGCAGCAGCGGCAGCGGGAGCAGCAGCGGCAGGAAGAGCTGGAGAAGCAGCGGCTGG
AGCAGCAGCTGCTCATCCTGCGGAACAAGGAGAAGAGCAAAGAGAGTGCCATTGCCAGCACTGAGGTAAAGCTGAGGCTCCAGGAATTCC
TCTTGTCGAAGTCAAAGGAGCCCACACCAGGCGGCCTCAACCATTCCCTCCCACAGCACCCCAAATGCTGGGGAGCCCACCATGCTTCTT
TGGACCAGAGTTCCCCTCCCCAGAGCGGCCCCCCTGGGACGCCTCCCTCCTACAAACTGCCTTTGCCTGGGCCCTACGACAGTCGAGACG
ACTTCCCCCTCCGCAAAACAGCCTCTGAACCCAACTTGAAAGTGCGTTCAAGGCTAAAACAGAAGGTGGCTGAGCGGAGAAGCAGTCCCC
TCCTGCGTCGCAAGGATGGGACTGTTATTAGCACCTTTAAGAAGAGAGCTGTTGAGATCACAGGTGCCGGGCCTGGGGCGTCGTCCGTGT
GTAACAGCGCACCCGGCTCCGGCCCCAGCTCTCCCAACAGCTCCCACAGCACCATCGCTGAGAATGGCTTTACTGGCTCAGTCCCCAACA
TCCCCACTGAGATGCTCCCTCAGCACCGAGCCCTCCCTCTGGACAGCTCCCCCAACCAGTTCAGCCTCTACACGTCTCCTTCTCTGCCCA
ACATCTCCCTAGGGCTGCAGGCCACGGTCACTGTCACCAACTCACACCTCACTGCCTCCCCGAAGCTGTCGACACAGCAGGAGGCCGAGA
GGCAGGCCCTCCAGTCCCTGCGGCAGGGTGGCACGCTGACCGGCAAGTTCATGAGCACATCCTCTATTCCTGGCTGCCTGCTGGGCGTGG
CACTGGAGGGCGACGGGAGCCCCCACGGGCATGCCTCCCTGCTGCAGCATGTGCTGTTGCTGGAGCAGGCCCGGCAGCAGAGCACCCTCA
TTGCTGTGCCACTCCACGGGCAGTCCCCACTAGTGACGGGTGAACGTGTGGCCACCAGCATGCGGACGGTAGGCAAGCTCCCGCGGCATC
GGCCCCTGAGCCGCACTCAGTCCTCACCGCTGCCGCAGAGTCCCCAGGCCCTGCAGCAGCTGGTCATGCAACAACAGCACCAGCAGTTCC
TGGAGAAGCAGAAGCAGCAGCAGCTACAGCTGGGCAAGATCCTCACCAAGACAGGGGAGCTGCCCAGGCAGCCCACCACCCACCCTGAGG
AGACAGAGGAGGAGCTGACGGAGCAGCAGGAGGTCTTGCTGGGGGAGGGAGCCCTGACCATGCCCCGGGAGGGCTCCACAGAGAGTGAGA
GCACACAGGAAGACCTGGAGGAGGAGGACGAGGAAGACGATGGGGAGGAGGAGGAGGATTGCATCCAGGTTAAGGACGAGGAGGGCGAGA
GTGGTGCTGAGGAGGGGCCCGACTTGGAGGAGCCTGGTGCTGGATACAAAAAACTGTTCTCAGATGCCCAGCCGCTGCAGCCTTTGCAGG
TGTACCAGGCGCCCCTCAGCCTGGCCACTGTGCCCCACCAGGCCCTGGGCCGTACCCAGTCCTCCCCTGCTGCCCCTGGGGGCATGAAGA
GCCCCCCAGACCAGCCCGTCAAGCACCTCTTCACCACAGGTGTGGTCTACGACACGTTCATGCTAAAGCACCAGTGCATGTGCGGGAACA
CACACGTGCACCCTGAGCATGCTGGCCGGATCCAGAGCATCTGGTCCCGGCTGCAGGAGACAGGCCTGCTTAGCAAGTGCGAGCGGATCC
GAGGTCGCAAAGCCACGCTAGATGAGATCCAGACAGTGCACTCTGAATACCACACCCTGCTCTATGGGACCAGTCCCCTCAACCGGCAGA
AGCTAGACAGCAAGAAGTTGCTCGGCCCCATCAGCCAGAAGATGTATGCTGTGCTGCCTTGTGGGGGCATCGGGGTGGACAGTGACACCG
TGTGGAATGAGATGCACTCCTCCAGTGCTGTGCGCATGGCAGTGGGCTGCCTGCTGGAGCTGGCCTTCAAGGTGGCTGCAGGAGAGCTCA
AGAATGGATTTGCCATCATCCGGCCCCCAGGACACCACGCCGAGGAATCCACAGCCATGGGATTCTGCTTCTTCAACTCTGTAGCCATCA
CCGCAAAACTCCTACAGCAGAAGTTGAACGTGGGCAAGGTCCTCATCGTGGACTGGGACATTCACCATGGCAATGGCACCCAGCAGGCGT
TCTACAATGACCCCTCTGTGCTCTACATCTCTCTGCATCGCTATGACAACGGGAACTTCTTTCCAGGCTCTGGGGCTCCTGAAGAGGTTG
GTGGAGGACCAGGCGTGGGGTACAATGTGAACGTGGCATGGACAGGAGGTGTGGACCCCCCCATTGGAGACGTGGAGTACCTTACAGCCT
TCAGGACAGTGGTGATGCCCATTGCCCACGAGTTCTCACCTGATGTGGTCCTAGTCTCCGCCGGGTTTGATGCTGTTGAAGGACATCTGT
CTCCTCTGGGTGGCTACTCTGTCACCGCCAGATGTTTTGGCCACTTGACCAGGCAGCTGATGACCCTGGCAGGGGGCCGGGTGGTGCTGG
CCCTGGAGGGAGGCCATGACTTGACCGCCATCTGTGATGCCTCTGAGGCTTGTGTCTCGGCTCTGCTCAGTGTAGAGCTGCAGCCCTTGG
ATGAGGCAGTCTTGCAGCAAAAGCCCAACATCAACGCAGTGGCCACGCTAGAGAAAGTCATCGAGATCCAGAGCAAACACTGGAGCTGTG
TGCAGAAGTTCGCCGCTGGTCTGGGCCGGTCCCTGCGAGAGGCCCAAGCAGGTGAGACCGAGGAGGCCGAGACTGTGAGCGCCATGGCCT
TGCTGTCGGTGGGGGCCGAGCAGGCCCAGGCTGCGGCAGCCCGGGAACACAGCCCCAGGCCGGCAGAGGAGCCCATGGAGCAGGAGCCTG


* Fusion transcript sequences (Full-length transcript).
>In-frame_AFF3_ENST00000409236_chr2_100623094_-_HDAC5_ENST00000225983_chr17_42171202_-_5891nt
GAGCTCGCTGCTCTCTCTTGAGTGTGCCTGCGCGCAAGCCGGGGAGCGGCGCGCGGGCGGCCCGAGCCTCGGCGGCGGCGGTAGCGGCGG
CGGCGACGCTGACACCTCCCACCATGGACAGCTTCGACTTAGCCCTGCTCCAGGAATGGGACCTCGAGTCACTGTGTGTCTATGAACCAG
ATAGAAATGCATTACGGAGGAAAGAACGAGAAAGAAGAAATCAAGAAACTCAACAGGATGATGGCACGTTTAATTCTAGTTACTCTCTCT
TCAGTGAGCCCTACAAGACTAACAAGGGGGATGAACTCTCCAACCGGATCCAGAACACTTTAGGCAATTATGATGAAATGAAAGACTTTT
TAACTGATAGATCCAATCAGAGTCATCTCGTTGGAGTTCCCAAACCTGGGGTTCCTCAGACTCCTGTGAACAAGATCGATGAACATTTTG
TTGCAGATTCAAGAGCCCAGAACCAGCCCTCGTCTATCTGTAGCACTACAACTTCCACACCAGCAGCTGTCCCCGTGCAGCAGAGTAAGA
GAGGCACTATGGGCTGGCAGAAGGCTGGGCACCCACCCTCTGACGGCCAACAGAGAGCAACACAACAGGGCTCTCTCAGGACCTTGCTTG
GAGATGGTGTTGGCAGACAGCAGCCTCGGGCCAAACAAGTGTGCAATGTGGAGGTGGGCCTTCAGACCCAGGAGAGGCCACCTGCCATGG
CGGCCAAGCACAGCAGCAGCGGACACTGTGTTCAGAACTTTCCTCCATCCCTAGCTTCAAAACCCAGCCTGGTCCAGCAGAAACCGACCG
CGTATGTGAGGCCAATGGACGGCCAAGATCAGGCCCCTGATGAGTCTCCTAAGCTGAAGTCGTCTTCGGAAACCAGCGTGCACTGCACAT
CATACAGGGGAGTCCCTGCCAGCAAGCCGGAGCCTGCCAGAGCCAAGGCCAAGCTCTCCAAGTTCAGCATCCCCAAGCAGGGGGAGTGGA
GGTGAAGCCGGTGCTGCCAAGAGCCATGCCCAGTTCCATGGGGGGTGGGGGTGGAGGCAGCCCCAGCCCTGTGGAGCTACGGGGGGCTCT
GGTGGGCTCTGTGGACCCCACACTGCGGGAGCAGCAACTGCAGCAGGAGCTCCTGGCGCTCAAGCAGCAGCAGCAGCTGCAGAAGCAGCT
CCTGTTCGCTGAGTTCCAGAAACAGCATGACCACCTGACAAGGCAGCATGAGGTCCAGCTGCAGAAGCACCTCAAGCAGCAGCAGGAGAT
GCTGGCAGCCAAGCAGCAGCAGGAGATGCTGGCAGCCAAGCGGCAGCAGGAGCTGGAGCAGCAGCGGCAGCGGGAGCAGCAGCGGCAGGA
AGAGCTGGAGAAGCAGCGGCTGGAGCAGCAGCTGCTCATCCTGCGGAACAAGGAGAAGAGCAAAGAGAGTGCCATTGCCAGCACTGAGGT
AAAGCTGAGGCTCCAGGAATTCCTCTTGTCGAAGTCAAAGGAGCCCACACCAGGCGGCCTCAACCATTCCCTCCCACAGCACCCCAAATG
CTGGGGAGCCCACCATGCTTCTTTGGACCAGAGTTCCCCTCCCCAGAGCGGCCCCCCTGGGACGCCTCCCTCCTACAAACTGCCTTTGCC
TGGGCCCTACGACAGTCGAGACGACTTCCCCCTCCGCAAAACAGCCTCTGAACCCAACTTGAAAGTGCGTTCAAGGCTAAAACAGAAGGT
GGCTGAGCGGAGAAGCAGTCCCCTCCTGCGTCGCAAGGATGGGACTGTTATTAGCACCTTTAAGAAGAGAGCTGTTGAGATCACAGGTGC
CGGGCCTGGGGCGTCGTCCGTGTGTAACAGCGCACCCGGCTCCGGCCCCAGCTCTCCCAACAGCTCCCACAGCACCATCGCTGAGAATGG
CTTTACTGGCTCAGTCCCCAACATCCCCACTGAGATGCTCCCTCAGCACCGAGCCCTCCCTCTGGACAGCTCCCCCAACCAGTTCAGCCT
CTACACGTCTCCTTCTCTGCCCAACATCTCCCTAGGGCTGCAGGCCACGGTCACTGTCACCAACTCACACCTCACTGCCTCCCCGAAGCT
GTCGACACAGCAGGAGGCCGAGAGGCAGGCCCTCCAGTCCCTGCGGCAGGGTGGCACGCTGACCGGCAAGTTCATGAGCACATCCTCTAT
TCCTGGCTGCCTGCTGGGCGTGGCACTGGAGGGCGACGGGAGCCCCCACGGGCATGCCTCCCTGCTGCAGCATGTGCTGTTGCTGGAGCA
GGCCCGGCAGCAGAGCACCCTCATTGCTGTGCCACTCCACGGGCAGTCCCCACTAGTGACGGGTGAACGTGTGGCCACCAGCATGCGGAC
GGTAGGCAAGCTCCCGCGGCATCGGCCCCTGAGCCGCACTCAGTCCTCACCGCTGCCGCAGAGTCCCCAGGCCCTGCAGCAGCTGGTCAT
GCAACAACAGCACCAGCAGTTCCTGGAGAAGCAGAAGCAGCAGCAGCTACAGCTGGGCAAGATCCTCACCAAGACAGGGGAGCTGCCCAG
GCAGCCCACCACCCACCCTGAGGAGACAGAGGAGGAGCTGACGGAGCAGCAGGAGGTCTTGCTGGGGGAGGGAGCCCTGACCATGCCCCG
GGAGGGCTCCACAGAGAGTGAGAGCACACAGGAAGACCTGGAGGAGGAGGACGAGGAAGACGATGGGGAGGAGGAGGAGGATTGCATCCA
GGTTAAGGACGAGGAGGGCGAGAGTGGTGCTGAGGAGGGGCCCGACTTGGAGGAGCCTGGTGCTGGATACAAAAAACTGTTCTCAGATGC
CCAGCCGCTGCAGCCTTTGCAGGTGTACCAGGCGCCCCTCAGCCTGGCCACTGTGCCCCACCAGGCCCTGGGCCGTACCCAGTCCTCCCC
TGCTGCCCCTGGGGGCATGAAGAGCCCCCCAGACCAGCCCGTCAAGCACCTCTTCACCACAGGTGTGGTCTACGACACGTTCATGCTAAA
GCACCAGTGCATGTGCGGGAACACACACGTGCACCCTGAGCATGCTGGCCGGATCCAGAGCATCTGGTCCCGGCTGCAGGAGACAGGCCT
GCTTAGCAAGTGCGAGCGGATCCGAGGTCGCAAAGCCACGCTAGATGAGATCCAGACAGTGCACTCTGAATACCACACCCTGCTCTATGG
GACCAGTCCCCTCAACCGGCAGAAGCTAGACAGCAAGAAGTTGCTCGGCCCCATCAGCCAGAAGATGTATGCTGTGCTGCCTTGTGGGGG
CATCGGGGTGGACAGTGACACCGTGTGGAATGAGATGCACTCCTCCAGTGCTGTGCGCATGGCAGTGGGCTGCCTGCTGGAGCTGGCCTT
CAAGGTGGCTGCAGGAGAGCTCAAGAATGGATTTGCCATCATCCGGCCCCCAGGACACCACGCCGAGGAATCCACAGCCATGGGATTCTG
CTTCTTCAACTCTGTAGCCATCACCGCAAAACTCCTACAGCAGAAGTTGAACGTGGGCAAGGTCCTCATCGTGGACTGGGACATTCACCA
TGGCAATGGCACCCAGCAGGCGTTCTACAATGACCCCTCTGTGCTCTACATCTCTCTGCATCGCTATGACAACGGGAACTTCTTTCCAGG
CTCTGGGGCTCCTGAAGAGGTTGGTGGAGGACCAGGCGTGGGGTACAATGTGAACGTGGCATGGACAGGAGGTGTGGACCCCCCCATTGG
AGACGTGGAGTACCTTACAGCCTTCAGGACAGTGGTGATGCCCATTGCCCACGAGTTCTCACCTGATGTGGTCCTAGTCTCCGCCGGGTT
TGATGCTGTTGAAGGACATCTGTCTCCTCTGGGTGGCTACTCTGTCACCGCCAGATGTTTTGGCCACTTGACCAGGCAGCTGATGACCCT
GGCAGGGGGCCGGGTGGTGCTGGCCCTGGAGGGAGGCCATGACTTGACCGCCATCTGTGATGCCTCTGAGGCTTGTGTCTCGGCTCTGCT
CAGTGTAGAGCTGCAGCCCTTGGATGAGGCAGTCTTGCAGCAAAAGCCCAACATCAACGCAGTGGCCACGCTAGAGAAAGTCATCGAGAT
CCAGAGCAAACACTGGAGCTGTGTGCAGAAGTTCGCCGCTGGTCTGGGCCGGTCCCTGCGAGAGGCCCAAGCAGGTGAGACCGAGGAGGC
CGAGACTGTGAGCGCCATGGCCTTGCTGTCGGTGGGGGCCGAGCAGGCCCAGGCTGCGGCAGCCCGGGAACACAGCCCCAGGCCGGCAGA
GGAGCCCATGGAGCAGGAGCCTGCCCTGTGACGCCCCGGCCCCCATCCCTCTGGGCTTCACCATTGTGATTTTGTTTATTTTTTCTATTA
AAAACAAAAAGTCACACATTCAACAAGGTGTGCCGTGTGGGTCTCTCAGCCTTGCCCCTCCTGCTCCTCTACGCTGCCTCAGGCCCCCAG
CCCTGTGGCTTCCACCTCAGCTCTAGAAGCCTGCTCCCTCTGCAGGGGGTGGTGGTGTCTTCCCAGCCCTGTCCCATGTGTCCCTCCCCC
CATTTTCCTGCATTCTGTCTGTCCTTTTCCTCCTTGGAGCCTGGGCCAGCTCAAGGTGGGCACGGGGGCCCAGACAGTACTCTCCAGTTC
TGGGGCCCCCCGAGTGAGGAGGGAACGGGAAGTCGGTGCCTTGGTTTCAGCTGATTTGGGGGGAAATGCCTTAATTTCACTCTCCTCCCT
TCTCCAGCCTCAGGGGAGGATCTGGAGGATCCACTACTGTCTTTAAGATGCAGAGTGGAGGGGAGGTGGGCACCCACCCTGCGATTCTCC
ACCCTTTCCCCTTCTTTCGTCCTCACCATCTCTGCAGACCCCTCTCCTCCTCCTTCCTCTTGGTCTCAGCACTGATGGGAGGCTGGTGCC
CAAGCTGTGGCCTGCAGTCTGTGAGGAGGGCTGTCTTGCCTCACACTCCTCACAGCCTACTTCCCCTTCCCCGGGGCTGAGAGGGTGAAA
GTGTGTGGGGAAGGAGAGGACTGGTTTCCTGGGTTCTCAGGGGCCAGGAGGAGTAACAGAACCAGGTCTGCTCCCCACCTTACTCGGATG
GCCTCCCTGCCCCTCTGCTGGCACAGCCTGGGCAAGGGGAGAAGGTGGTCCCTGCAGAGGGGCTCCAGGCTGGTGAGAGCCCCCCTGCTG
TCAGGACCAGATTTTCCCAGCCATCCAGCATGCTGCGGGGAGAAGGGGCAGAGGCTCACCTCCCTCCTGGGGCCTTTTGTTTTGGATCCT
GGGGATGGTGAGAATGGAGGTTCTAGAAGGGGTAAGGCCAGAACCCAGGGATCCAGGAGTCGGCTCTCAGCTGGAGCTTCCATACCTTCT
GGGCTCCCTTTGCTGACCACCAGCCCAAGGGAGCTAAGACCAGGAGGGGGCTGGGCGCTGTCCCTTCTCTTTCCCAGGAGCCCTGCCAGG
GGCTGTGGGCCTACAAGGCTTCCAGGGGATGCCATCCAGCCTGTAGGAAACCAAAGATGGGAAGTGGCTCCTAGGGGGCTGACTCTTCCT
TCCTCCTCCTCCCCAGTACCACATATACTTTCTCTCCTTCTATCTCCAGGGCCCCACCAATCTGTTTACATATTTATTATCCTATGGGGG
CCTGAGCAGGATTGAGGGAGCCAGGGGAGGGGCAGGAGTCCCAGCACCATCGGTTCATAGTGTGCTTGTGTGTTTGTTTTAGATCCTCCT
GGGGGATGGGGATGGGGCCAGGCTCAGTGTACTAGGCCTCTCTGTGCTGAGCCCCAGGCTCCCGGCCCCTTACCCACTCTCTCCCTGTGG
CTGGTCTGGTTCTCATGTAAACCCACTCCTTGCTTTGTCTCCCTGGATATGGATTTCAGTTAAGTATTTTGTAACCCGTTACACTGTGTG

>In-frame_AFF3_ENST00000409236_chr2_100623094_-_HDAC5_ENST00000393622_chr17_42171202_-_5884nt
GAGCTCGCTGCTCTCTCTTGAGTGTGCCTGCGCGCAAGCCGGGGAGCGGCGCGCGGGCGGCCCGAGCCTCGGCGGCGGCGGTAGCGGCGG
CGGCGACGCTGACACCTCCCACCATGGACAGCTTCGACTTAGCCCTGCTCCAGGAATGGGACCTCGAGTCACTGTGTGTCTATGAACCAG
ATAGAAATGCATTACGGAGGAAAGAACGAGAAAGAAGAAATCAAGAAACTCAACAGGATGATGGCACGTTTAATTCTAGTTACTCTCTCT
TCAGTGAGCCCTACAAGACTAACAAGGGGGATGAACTCTCCAACCGGATCCAGAACACTTTAGGCAATTATGATGAAATGAAAGACTTTT
TAACTGATAGATCCAATCAGAGTCATCTCGTTGGAGTTCCCAAACCTGGGGTTCCTCAGACTCCTGTGAACAAGATCGATGAACATTTTG
TTGCAGATTCAAGAGCCCAGAACCAGCCCTCGTCTATCTGTAGCACTACAACTTCCACACCAGCAGCTGTCCCCGTGCAGCAGAGTAAGA
GAGGCACTATGGGCTGGCAGAAGGCTGGGCACCCACCCTCTGACGGCCAACAGAGAGCAACACAACAGGGCTCTCTCAGGACCTTGCTTG
GAGATGGTGTTGGCAGACAGCAGCCTCGGGCCAAACAAGTGTGCAATGTGGAGGTGGGCCTTCAGACCCAGGAGAGGCCACCTGCCATGG
CGGCCAAGCACAGCAGCAGCGGACACTGTGTTCAGAACTTTCCTCCATCCCTAGCTTCAAAACCCAGCCTGGTCCAGCAGAAACCGACCG
CGTATGTGAGGCCAATGGACGGCCAAGATCAGGCCCCTGATGAGTCTCCTAAGCTGAAGTCGTCTTCGGAAACCAGCGTGCACTGCACAT
CATACAGGGGAGTCCCTGCCAGCAAGCCGGAGCCTGCCAGAGCCAAGGCCAAGCTCTCCAAGTTCAGCATCCCCAAGCAGGGGGAGTGGA
GGTGAAGCCGGTGCTGCCAAGAGCCATGCCCAGTTCCATGGGGGGTGGGGGTGGAGGCAGCCCCAGCCCTGTGGAGCTACGGGGGGCTCT
GGTGGGCTCTGTGGACCCCACACTGCGGGAGCAGCAACTGCAGCAGGAGCTCCTGGCGCTCAAGCAGCAGCAGCAGCTGCAGAAGCAGCT
CCTGTTCGCTGAGTTCCAGAAACAGCATGACCACCTGACAAGGCAGCATGAGGTCCAGCTGCAGAAGCACCTCAAGCAGCAGCAGGAGAT
GCTGGCAGCCAAGCAGCAGCAGGAGATGCTGGCAGCCAAGCGGCAGCAGGAGCTGGAGCAGCAGCGGCAGCGGGAGCAGCAGCGGCAGGA
AGAGCTGGAGAAGCAGCGGCTGGAGCAGCAGCTGCTCATCCTGCGGAACAAGGAGAAGAGCAAAGAGAGTGCCATTGCCAGCACTGAGGT
AAAGCTGAGGCTCCAGGAATTCCTCTTGTCGAAGTCAAAGGAGCCCACACCAGGCGGCCTCAACCATTCCCTCCCACAGCACCCCAAATG
CTGGGGAGCCCACCATGCTTCTTTGGACCAGAGTTCCCCTCCCCAGAGCGGCCCCCCTGGGACGCCTCCCTCCTACAAACTGCCTTTGCC
TGGGCCCTACGACAGTCGAGACGACTTCCCCCTCCGCAAAACAGCCTCTGAACCCAACTTGAAAGTGCGTTCAAGGCTAAAACAGAAGGT
GGCTGAGCGGAGAAGCAGTCCCCTCCTGCGTCGCAAGGATGGGACTGTTATTAGCACCTTTAAGAAGAGAGCTGTTGAGATCACAGGTGC
CGGGCCTGGGGCGTCGTCCGTGTGTAACAGCGCACCCGGCTCCGGCCCCAGCTCTCCCAACAGCTCCCACAGCACCATCGCTGAGAATGG
CTTTACTGGCTCAGTCCCCAACATCCCCACTGAGATGCTCCCTCAGCACCGAGCCCTCCCTCTGGACAGCTCCCCCAACCAGTTCAGCCT
CTACACGTCTCCTTCTCTGCCCAACATCTCCCTAGGGCTGCAGGCCACGGTCACTGTCACCAACTCACACCTCACTGCCTCCCCGAAGCT
GTCGACACAGCAGGAGGCCGAGAGGCAGGCCCTCCAGTCCCTGCGGCAGGGTGGCACGCTGACCGGCAAGTTCATGAGCACATCCTCTAT
TCCTGGCTGCCTGCTGGGCGTGGCACTGGAGGGCGACGGGAGCCCCCACGGGCATGCCTCCCTGCTGCAGCATGTGCTGTTGCTGGAGCA
GGCCCGGCAGCAGAGCACCCTCATTGCTGTGCCACTCCACGGGCAGTCCCCACTAGTGACGGGTGAACGTGTGGCCACCAGCATGCGGAC
GGTAGGCAAGCTCCCGCGGCATCGGCCCCTGAGCCGCACTCAGTCCTCACCGCTGCCGCAGAGTCCCCAGGCCCTGCAGCAGCTGGTCAT
GCAACAACAGCACCAGCAGTTCCTGGAGAAGCAGAAGCAGCAGCAGCTACAGCTGGGCAAGATCCTCACCAAGACAGGGGAGCTGCCCAG
GCAGCCCACCACCCACCCTGAGGAGACAGAGGAGGAGCTGACGGAGCAGCAGGAGGTCTTGCTGGGGGAGGGAGCCCTGACCATGCCCCG
GGAGGGCTCCACAGAGAGTGAGAGCACACAGGAAGACCTGGAGGAGGAGGACGAGGAAGACGATGGGGAGGAGGAGGAGGATTGCATCCA
GGTTAAGGACGAGGAGGGCGAGAGTGGTGCTGAGGAGGGGCCCGACTTGGAGGAGCCTGGTGCTGGATACAAAAAACTGTTCTCAGATGC
CCAGCCGCTGCAGCCTTTGCAGGTGTACCAGGCGCCCCTCAGCCTGGCCACTGTGCCCCACCAGGCCCTGGGCCGTACCCAGTCCTCCCC
TGCTGCCCCTGGGGGCATGAAGAGCCCCCCAGACCAGCCCGTCAAGCACCTCTTCACCACAGGTGTGGTCTACGACACGTTCATGCTAAA
GCACCAGTGCATGTGCGGGAACACACACGTGCACCCTGAGCATGCTGGCCGGATCCAGAGCATCTGGTCCCGGCTGCAGGAGACAGGCCT
GCTTAGCAAGTGCGAGCGGATCCGAGGTCGCAAAGCCACGCTAGATGAGATCCAGACAGTGCACTCTGAATACCACACCCTGCTCTATGG
GACCAGTCCCCTCAACCGGCAGAAGCTAGACAGCAAGAAGTTGCTCGGCCCCATCAGCCAGAAGATGTATGCTGTGCTGCCTTGTGGGGG
CATCGGGGTGGACAGTGACACCGTGTGGAATGAGATGCACTCCTCCAGTGCTGTGCGCATGGCAGTGGGCTGCCTGCTGGAGCTGGCCTT
CAAGGTGGCTGCAGGAGAGCTCAAGAATGGATTTGCCATCATCCGGCCCCCAGGACACCACGCCGAGGAATCCACAGCCATGGGATTCTG
CTTCTTCAACTCTGTAGCCATCACCGCAAAACTCCTACAGCAGAAGTTGAACGTGGGCAAGGTCCTCATCGTGGACTGGGACATTCACCA
TGGCAATGGCACCCAGCAGGCGTTCTACAATGACCCCTCTGTGCTCTACATCTCTCTGCATCGCTATGACAACGGGAACTTCTTTCCAGG
CTCTGGGGCTCCTGAAGAGGTTGGTGGAGGACCAGGCGTGGGGTACAATGTGAACGTGGCATGGACAGGAGGTGTGGACCCCCCCATTGG
AGACGTGGAGTACCTTACAGCCTTCAGGACAGTGGTGATGCCCATTGCCCACGAGTTCTCACCTGATGTGGTCCTAGTCTCCGCCGGGTT
TGATGCTGTTGAAGGACATCTGTCTCCTCTGGGTGGCTACTCTGTCACCGCCAGATGTTTTGGCCACTTGACCAGGCAGCTGATGACCCT
GGCAGGGGGCCGGGTGGTGCTGGCCCTGGAGGGAGGCCATGACTTGACCGCCATCTGTGATGCCTCTGAGGCTTGTGTCTCGGCTCTGCT
CAGTGTAGAGCTGCAGCCCTTGGATGAGGCAGTCTTGCAGCAAAAGCCCAACATCAACGCAGTGGCCACGCTAGAGAAAGTCATCGAGAT
CCAGAGCAAACACTGGAGCTGTGTGCAGAAGTTCGCCGCTGGTCTGGGCCGGTCCCTGCGAGAGGCCCAAGCAGGTGAGACCGAGGAGGC
CGAGACTGTGAGCGCCATGGCCTTGCTGTCGGTGGGGGCCGAGCAGGCCCAGGCTGCGGCAGCCCGGGAACACAGCCCCAGGCCGGCAGA
GGAGCCCATGGAGCAGGAGCCTGCCCTGTGACGCCCCGGCCCCCATCCCTCTGGGCTTCACCATTGTGATTTTGTTTATTTTTTCTATTA
AAAACAAAAAGTCACACATTCAACAAGGTGTGCCGTGTGGGTCTCTCAGCCTTGCCCCTCCTGCTCCTCTACGCTGCCTCAGGCCCCCAG
CCCTGTGGCTTCCACCTCAGCTCTAGAAGCCTGCTCCCTCTGCAGGGGGTGGTGGTGTCTTCCCAGCCCTGTCCCATGTGTCCCTCCCCC
CATTTTCCTGCATTCTGTCTGTCCTTTTCCTCCTTGGAGCCTGGGCCAGCTCAAGGTGGGCACGGGGGCCCAGACAGTACTCTCCAGTTC
TGGGGCCCCCCGAGTGAGGAGGGAACGGGAAGTCGGTGCCTTGGTTTCAGCTGATTTGGGGGGAAATGCCTTAATTTCACTCTCCTCCCT
TCTCCAGCCTCAGGGGAGGATCTGGAGGATCCACTACTGTCTTTAAGATGCAGAGTGGAGGGGAGGTGGGCACCCACCCTGCGATTCTCC
ACCCTTTCCCCTTCTTTCGTCCTCACCATCTCTGCAGACCCCTCTCCTCCTCCTTCCTCTTGGTCTCAGCACTGATGGGAGGCTGGTGCC
CAAGCTGTGGCCTGCAGTCTGTGAGGAGGGCTGTCTTGCCTCACACTCCTCACAGCCTACTTCCCCTTCCCCGGGGCTGAGAGGGTGAAA
GTGTGTGGGGAAGGAGAGGACTGGTTTCCTGGGTTCTCAGGGGCCAGGAGGAGTAACAGAACCAGGTCTGCTCCCCACCTTACTCGGATG
GCCTCCCTGCCCCTCTGCTGGCACAGCCTGGGCAAGGGGAGAAGGTGGTCCCTGCAGAGGGGCTCCAGGCTGGTGAGAGCCCCCCTGCTG
TCAGGACCAGATTTTCCCAGCCATCCAGCATGCTGCGGGGAGAAGGGGCAGAGGCTCACCTCCCTCCTGGGGCCTTTTGTTTTGGATCCT
GGGGATGGTGAGAATGGAGGTTCTAGAAGGGGTAAGGCCAGAACCCAGGGATCCAGGAGTCGGCTCTCAGCTGGAGCTTCCATACCTTCT
GGGCTCCCTTTGCTGACCACCAGCCCAAGGGAGCTAAGACCAGGAGGGGGCTGGGCGCTGTCCCTTCTCTTTCCCAGGAGCCCTGCCAGG
GGCTGTGGGCCTACAAGGCTTCCAGGGGATGCCATCCAGCCTGTAGGAAACCAAAGATGGGAAGTGGCTCCTAGGGGGCTGACTCTTCCT
TCCTCCTCCTCCCCAGTACCACATATACTTTCTCTCCTTCTATCTCCAGGGCCCCACCAATCTGTTTACATATTTATTATCCTATGGGGG
CCTGAGCAGGATTGAGGGAGCCAGGGGAGGGGCAGGAGTCCCAGCACCATCGGTTCATAGTGTGCTTGTGTGTTTGTTTTAGATCCTCCT
GGGGGATGGGGATGGGGCCAGGCTCAGTGTACTAGGCCTCTCTGTGCTGAGCCCCAGGCTCCCGGCCCCTTACCCACTCTCTCCCTGTGG
CTGGTCTGGTTCTCATGTAAACCCACTCCTTGCTTTGTCTCCCTGGATATGGATTTCAGTTAAGTATTTTGTAACCCGTTACACTGTGTG

>In-frame_AFF3_ENST00000409236_chr2_100623094_-_HDAC5_ENST00000336057_chr17_42171202_-_5628nt
GAGCTCGCTGCTCTCTCTTGAGTGTGCCTGCGCGCAAGCCGGGGAGCGGCGCGCGGGCGGCCCGAGCCTCGGCGGCGGCGGTAGCGGCGG
CGGCGACGCTGACACCTCCCACCATGGACAGCTTCGACTTAGCCCTGCTCCAGGAATGGGACCTCGAGTCACTGTGTGTCTATGAACCAG
ATAGAAATGCATTACGGAGGAAAGAACGAGAAAGAAGAAATCAAGAAACTCAACAGGATGATGGCACGTTTAATTCTAGTTACTCTCTCT
TCAGTGAGCCCTACAAGACTAACAAGGGGGATGAACTCTCCAACCGGATCCAGAACACTTTAGGCAATTATGATGAAATGAAAGACTTTT
TAACTGATAGATCCAATCAGAGTCATCTCGTTGGAGTTCCCAAACCTGGGGTTCCTCAGACTCCTGTGAACAAGATCGATGAACATTTTG
TTGCAGATTCAAGAGCCCAGAACCAGCCCTCGTCTATCTGTAGCACTACAACTTCCACACCAGCAGCTGTCCCCGTGCAGCAGAGTAAGA
GAGGCACTATGGGCTGGCAGAAGGCTGGGCACCCACCCTCTGACGGCCAACAGAGAGCAACACAACAGGGCTCTCTCAGGACCTTGCTTG
GAGATGGTGTTGGCAGACAGCAGCCTCGGGCCAAACAAGTGTGCAATGTGGAGGTGGGCCTTCAGACCCAGGAGAGGCCACCTGCCATGG
CGGCCAAGCACAGCAGCAGCGGACACTGTGTTCAGAACTTTCCTCCATCCCTAGCTTCAAAACCCAGCCTGGTCCAGCAGAAACCGACCG
CGTATGTGAGGCCAATGGACGGCCAAGATCAGGCCCCTGATGAGTCTCCTAAGCTGAAGTCGTCTTCGGAAACCAGCGTGCACTGCACAT
CATACAGGGGAGTCCCTGCCAGCAAGCCGGAGCCTGCCAGAGCCAAGGCCAAGCTCTCCAAGTTCAGCATCCCCAAGCAGGGGGAGTGGA
GGTGAAGCCGGTGCTGCCAAGAGCCATGCCCAGTTCCATGGGGGGTGGGGGTGGAGGCAGCCCCAGCCCTGTGGAGCTACGGGGGGCTCT
GGTGGGCTCTGTGGACCCCACACTGCGGGAGCAGCAACTGCAGCAGGAGCTCCTGGCGCTCAAGCAGCAGCAGCAGCTGCAGAAGCAGCT
CCTGTTCGCTGAGTTCCAGAAACAGCATGACCACCTGACAAGGCAGCATGAGGTCCAGCTGCAGAAGCACCTCAAGCAGCAGCAGGAGAT
GCTGGCAGCCAAGCAGCAGCAGGAGATGCTGGCAGCCAAGCGGCAGCAGGAGCTGGAGCAGCAGCGGCAGCGGGAGCAGCAGCGGCAGGA
AGAGCTGGAGAAGCAGCGGCTGGAGCAGCAGCTGCTCATCCTGCGGAACAAGGAGAAGAGCAAAGAGAGTGCCATTGCCAGCACTGAGGT
AAAGCTGAGGCTCCAGGAATTCCTCTTGTCGAAGTCAAAGGAGCCCACACCAGGCGGCCTCAACCATTCCCTCCCACAGCACCCCAAATG
CTGGGGAGCCCACCATGCTTCTTTGGACCAGAGTTCCCCTCCCCAGAGCGGCCCCCCTGGGACGCCTCCCTCCTACAAACTGCCTTTGCC
TGGGCCCTACGACAGTCGAGACGACTTCCCCCTCCGCAAAACAGCCTCTGAACCCAACTTGAAAGTGCGTTCAAGGCTAAAACAGAAGGT
GGCTGAGCGGAGAAGCAGTCCCCTCCTGCGTCGCAAGGATGGGACTGTTATTAGCACCTTTAAGAAGAGAGCTGTTGAGATCACAGGTGC
CGGGCCTGGGGCGTCGTCCGTGTGTAACAGCGCACCCGGCTCCGGCCCCAGCTCTCCCAACAGCTCCCACAGCACCATCGCTGAGAATGG
CTTTACTGGCTCAGTCCCCAACATCCCCACTGAGATGCTCCCTCAGCACCGAGCCCTCCCTCTGGACAGCTCCCCCAACCAGTTCAGCCT
CTACACGTCTCCTTCTCTGCCCAACATCTCCCTAGGGCTGCAGGCCACGGTCACTGTCACCAACTCACACCTCACTGCCTCCCCGAAGCT
GTCGACACAGCAGGAGGCCGAGAGGCAGGCCCTCCAGTCCCTGCGGCAGGGTGGCACGCTGACCGGCAAGTTCATGAGCACATCCTCTAT
TCCTGGCTGCCTGCTGGGCGTGGCACTGGAGGGCGACGGGAGCCCCCACGGGCATGCCTCCCTGCTGCAGCATGTGCTGTTGCTGGAGCA
GGCCCGGCAGCAGAGCACCCTCATTGCTGTGCCACTCCACGGGCAGTCCCCACTAGTGACGGGTGAACGTGTGGCCACCAGCATGCGGAC
GGTAGGCAAGCTCCCGCGGCATCGGCCCCTGAGCCGCACTCAGTCCTCACCGCTGCCGCAGAGTCCCCAGGCCCTGCAGCAGCTGGTCAT
GCAACAACAGCACCAGCAGTTCCTGGAGAAGCAGAAGCAGCAGCAGCTACAGCTGGGCAAGATCCTCACCAAGACAGGGGAGCTGCCCAG
GCAGCCCACCACCCACCCTGAGGAGACAGAGGAGGAGCTGACGGAGCAGCAGGAGGTCTTGCTGGGGGAGGGAGCCCTGACCATGCCCCG
GGAGGGCTCCACAGAGAGTGAGAGCACACAGGAAGACCTGGAGGAGGAGGACGAGGAAGACGATGGGGAGGAGGAGGAGGATTGCATCCA
GGTTAAGGACGAGGAGGGCGAGAGTGGTGCTGAGGAGGGGCCCGACTTGGAGGAGCCTGGTGCTGGATACAAAAAACTGTTCTCAGATGC
CCAGCCGCTGCAGCCTTTGCAGGTGTACCAGGCGCCCCTCAGCCTGGCCACTGTGCCCCACCAGGCCCTGGGCCGTACCCAGTCCTCCCC
TGCTGCCCCTGGGGGCATGAAGAGCCCCCCAGACCAGCCCGTCAAGCACCTCTTCACCACAGGCCCCATCAGCCAGAAGATGTATGCTGT
GCTGCCTTGTGGGGGCATCGGGGTGGACAGTGACACCGTGTGGAATGAGATGCACTCCTCCAGTGCTGTGCGCATGGCAGTGGGCTGCCT
GCTGGAGCTGGCCTTCAAGGTGGCTGCAGGAGAGCTCAAGAATGGATTTGCCATCATCCGGCCCCCAGGACACCACGCCGAGGAATCCAC
AGCCATGGGATTCTGCTTCTTCAACTCTGTAGCCATCACCGCAAAACTCCTACAGCAGAAGTTGAACGTGGGCAAGGTCCTCATCGTGGA
CTGGGACATTCACCATGGCAATGGCACCCAGCAGGCGTTCTACAATGACCCCTCTGTGCTCTACATCTCTCTGCATCGCTATGACAACGG
GAACTTCTTTCCAGGCTCTGGGGCTCCTGAAGAGGTTGGTGGAGGACCAGGCGTGGGGTACAATGTGAACGTGGCATGGACAGGAGGTGT
GGACCCCCCCATTGGAGACGTGGAGTACCTTACAGCCTTCAGGACAGTGGTGATGCCCATTGCCCACGAGTTCTCACCTGATGTGGTCCT
AGTCTCCGCCGGGTTTGATGCTGTTGAAGGACATCTGTCTCCTCTGGGTGGCTACTCTGTCACCGCCAGATGTTTTGGCCACTTGACCAG
GCAGCTGATGACCCTGGCAGGGGGCCGGGTGGTGCTGGCCCTGGAGGGAGGCCATGACTTGACCGCCATCTGTGATGCCTCTGAGGCTTG
TGTCTCGGCTCTGCTCAGTGTAGAGCTGCAGCCCTTGGATGAGGCAGTCTTGCAGCAAAAGCCCAACATCAACGCAGTGGCCACGCTAGA
GAAAGTCATCGAGATCCAGAGCAAACACTGGAGCTGTGTGCAGAAGTTCGCCGCTGGTCTGGGCCGGTCCCTGCGAGAGGCCCAAGCAGG
TGAGACCGAGGAGGCCGAGACTGTGAGCGCCATGGCCTTGCTGTCGGTGGGGGCCGAGCAGGCCCAGGCTGCGGCAGCCCGGGAACACAG
CCCCAGGCCGGCAGAGGAGCCCATGGAGCAGGAGCCTGCCCTGTGACGCCCCGGCCCCCATCCCTCTGGGCTTCACCATTGTGATTTTGT
TTATTTTTTCTATTAAAAACAAAAAGTCACACATTCAACAAGGTGTGCCGTGTGGGTCTCTCAGCCTTGCCCCTCCTGCTCCTCTACGCT
GCCTCAGGCCCCCAGCCCTGTGGCTTCCACCTCAGCTCTAGAAGCCTGCTCCCTCTGCAGGGGGTGGTGGTGTCTTCCCAGCCCTGTCCC
ATGTGTCCCTCCCCCCATTTTCCTGCATTCTGTCTGTCCTTTTCCTCCTTGGAGCCTGGGCCAGCTCAAGGTGGGCACGGGGGCCCAGAC
AGTACTCTCCAGTTCTGGGGCCCCCCGAGTGAGGAGGGAACGGGAAGTCGGTGCCTTGGTTTCAGCTGATTTGGGGGGAAATGCCTTAAT
TTCACTCTCCTCCCTTCTCCAGCCTCAGGGGAGGATCTGGAGGATCCACTACTGTCTTTAAGATGCAGAGTGGAGGGGAGGTGGGCACCC
ACCCTGCGATTCTCCACCCTTTCCCCTTCTTTCGTCCTCACCATCTCTGCAGACCCCTCTCCTCCTCCTTCCTCTTGGTCTCAGCACTGA
TGGGAGGCTGGTGCCCAAGCTGTGGCCTGCAGTCTGTGAGGAGGGCTGTCTTGCCTCACACTCCTCACAGCCTACTTCCCCTTCCCCGGG
GCTGAGAGGGTGAAAGTGTGTGGGGAAGGAGAGGACTGGTTTCCTGGGTTCTCAGGGGCCAGGAGGAGTAACAGAACCAGGTCTGCTCCC
CACCTTACTCGGATGGCCTCCCTGCCCCTCTGCTGGCACAGCCTGGGCAAGGGGAGAAGGTGGTCCCTGCAGAGGGGCTCCAGGCTGGTG
AGAGCCCCCCTGCTGTCAGGACCAGATTTTCCCAGCCATCCAGCATGCTGCGGGGAGAAGGGGCAGAGGCTCACCTCCCTCCTGGGGCCT
TTTGTTTTGGATCCTGGGGATGGTGAGAATGGAGGTTCTAGAAGGGGTAAGGCCAGAACCCAGGGATCCAGGAGTCGGCTCTCAGCTGGA
GCTTCCATACCTTCTGGGCTCCCTTTGCTGACCACCAGCCCAAGGGAGCTAAGACCAGGAGGGGGCTGGGCGCTGTCCCTTCTCTTTCCC
AGGAGCCCTGCCAGGGGCTGTGGGCCTACAAGGCTTCCAGGGGATGCCATCCAGCCTGTAGGAAACCAAAGATGGGAAGTGGCTCCTAGG
GGGCTGACTCTTCCTTCCTCCTCCTCCCCAGTACCACATATACTTTCTCTCCTTCTATCTCCAGGGCCCCACCAATCTGTTTACATATTT
ATTATCCTATGGGGGCCTGAGCAGGATTGAGGGAGCCAGGGGAGGGGCAGGAGTCCCAGCACCATCGGTTCATAGTGTGCTTGTGTGTTT
GTTTTAGATCCTCCTGGGGGATGGGGATGGGGCCAGGCTCAGTGTACTAGGCCTCTCTGTGCTGAGCCCCAGGCTCCCGGCCCCTTACCC
ACTCTCTCCCTGTGGCTGGTCTGGTTCTCATGTAAACCCACTCCTTGCTTTGTCTCCCTGGATATGGATTTCAGTTAAGTATTTTGTAAC

>In-frame_AFF3_ENST00000409236_chr2_100623094_-_HDAC5_ENST00000586802_chr17_42171202_-_4343nt
GAGCTCGCTGCTCTCTCTTGAGTGTGCCTGCGCGCAAGCCGGGGAGCGGCGCGCGGGCGGCCCGAGCCTCGGCGGCGGCGGTAGCGGCGG
CGGCGACGCTGACACCTCCCACCATGGACAGCTTCGACTTAGCCCTGCTCCAGGAATGGGACCTCGAGTCACTGTGTGTCTATGAACCAG
ATAGAAATGCATTACGGAGGAAAGAACGAGAAAGAAGAAATCAAGAAACTCAACAGGATGATGGCACGTTTAATTCTAGTTACTCTCTCT
TCAGTGAGCCCTACAAGACTAACAAGGGGGATGAACTCTCCAACCGGATCCAGAACACTTTAGGCAATTATGATGAAATGAAAGACTTTT
TAACTGATAGATCCAATCAGAGTCATCTCGTTGGAGTTCCCAAACCTGGGGTTCCTCAGACTCCTGTGAACAAGATCGATGAACATTTTG
TTGCAGATTCAAGAGCCCAGAACCAGCCCTCGTCTATCTGTAGCACTACAACTTCCACACCAGCAGCTGTCCCCGTGCAGCAGAGTAAGA
GAGGCACTATGGGCTGGCAGAAGGCTGGGCACCCACCCTCTGACGGCCAACAGAGAGCAACACAACAGGGCTCTCTCAGGACCTTGCTTG
GAGATGGTGTTGGCAGACAGCAGCCTCGGGCCAAACAAGTGTGCAATGTGGAGGTGGGCCTTCAGACCCAGGAGAGGCCACCTGCCATGG
CGGCCAAGCACAGCAGCAGCGGACACTGTGTTCAGAACTTTCCTCCATCCCTAGCTTCAAAACCCAGCCTGGTCCAGCAGAAACCGACCG
CGTATGTGAGGCCAATGGACGGCCAAGATCAGGCCCCTGATGAGTCTCCTAAGCTGAAGTCGTCTTCGGAAACCAGCGTGCACTGCACAT
CATACAGGGGAGTCCCTGCCAGCAAGCCGGAGCCTGCCAGAGCCAAGGCCAAGCTCTCCAAGTTCAGCATCCCCAAGCAGGGGGAGTGGA
GGTGAAGCCGGTGCTGCCAAGAGCCATGCCCAGTTCCATGGGGGGTGGGGGTGGAGGCAGCCCCAGCCCTGTGGAGCTACGGGGGGCTCT
GGTGGGCTCTGTGGACCCCACACTGCGGGAGCAGCAACTGCAGCAGGAGCTCCTGGCGCTCAAGCAGCAGCAGCAGCTGCAGAAGCAGCT
CCTGTTCGCTGAGTTCCAGAAACAGCATGACCACCTGACAAGGCAGCATGAGGTCCAGCTGCAGAAGCACCTCAAGCAGCAGCAGGAGAT
GCTGGCAGCCAAGCAGCAGCAGGAGATGCTGGCAGCCAAGCGGCAGCAGGAGCTGGAGCAGCAGCGGCAGCGGGAGCAGCAGCGGCAGGA
AGAGCTGGAGAAGCAGCGGCTGGAGCAGCAGCTGCTCATCCTGCGGAACAAGGAGAAGAGCAAAGAGAGTGCCATTGCCAGCACTGAGGT
AAAGCTGAGGCTCCAGGAATTCCTCTTGTCGAAGTCAAAGGAGCCCACACCAGGCGGCCTCAACCATTCCCTCCCACAGCACCCCAAATG
CTGGGGAGCCCACCATGCTTCTTTGGACCAGAGTTCCCCTCCCCAGAGCGGCCCCCCTGGGACGCCTCCCTCCTACAAACTGCCTTTGCC
TGGGCCCTACGACAGTCGAGACGACTTCCCCCTCCGCAAAACAGCCTCTGAACCCAACTTGAAAGTGCGTTCAAGGCTAAAACAGAAGGT
GGCTGAGCGGAGAAGCAGTCCCCTCCTGCGTCGCAAGGATGGGACTGTTATTAGCACCTTTAAGAAGAGAGCTGTTGAGATCACAGGTGC
CGGGCCTGGGGCGTCGTCCGTGTGTAACAGCGCACCCGGCTCCGGCCCCAGCTCTCCCAACAGCTCCCACAGCACCATCGCTGAGAATGG
CTTTACTGGCTCAGTCCCCAACATCCCCACTGAGATGCTCCCTCAGCACCGAGCCCTCCCTCTGGACAGCTCCCCCAACCAGTTCAGCCT
CTACACGTCTCCTTCTCTGCCCAACATCTCCCTAGGGCTGCAGGCCACGGTCACTGTCACCAACTCACACCTCACTGCCTCCCCGAAGCT
GTCGACACAGCAGGAGGCCGAGAGGCAGGCCCTCCAGTCCCTGCGGCAGGGTGGCACGCTGACCGGCAAGTTCATGAGCACATCCTCTAT
TCCTGGCTGCCTGCTGGGCGTGGCACTGGAGGGCGACGGGAGCCCCCACGGGCATGCCTCCCTGCTGCAGCATGTGCTGTTGCTGGAGCA
GGCCCGGCAGCAGAGCACCCTCATTGCTGTGCCACTCCACGGGCAGTCCCCACTAGTGACGGGTGAACGTGTGGCCACCAGCATGCGGAC
GGTAGGCAAGCTCCCGCGGCATCGGCCCCTGAGCCGCACTCAGTCCTCACCGCTGCCGCAGAGTCCCCAGGCCCTGCAGCAGCTGGTCAT
GCAACAACAGCACCAGCAGTTCCTGGAGAAGCAGAAGCAGCAGCAGCTACAGCTGGGCAAGATCCTCACCAAGACAGGGGAGCTGCCCAG
GCAGCCCACCACCCACCCTGAGGAGACAGAGGAGGAGCTGACGGAGCAGCAGGAGGTCTTGCTGGGGGAGGGAGCCCTGACCATGCCCCG
GGAGGGCTCCACAGAGAGTGAGAGCACACAGGAAGACCTGGAGGAGGAGGACGAGGAAGACGATGGGGAGGAGGAGGAGGATTGCATCCA
GGTTAAGGACGAGGAGGGCGAGAGTGGTGCTGAGGAGGGGCCCGACTTGGAGGAGCCTGGTGCTGGATACAAAAAACTGTTCTCAGATGC
CCAGCCGCTGCAGCCTTTGCAGGTGTACCAGGCGCCCCTCAGCCTGGCCACTGTGCCCCACCAGGCCCTGGGCCGTACCCAGTCCTCCCC
TGCTGCCCCTGGGGGCATGAAGAGCCCCCCAGACCAGCCCGTCAAGCACCTCTTCACCACAGGTGTGGTCTACGACACGTTCATGCTAAA
GCACCAGTGCATGTGCGGGAACACACACGTGCACCCTGAGCATGCTGGCCGGATCCAGAGCATCTGGTCCCGGCTGCAGGAGACAGGCCT
GCTTAGCAAGTGCGAGCGGATCCGAGGTCGCAAAGCCACGCTAGATGAGATCCAGACAGTGCACTCTGAATACCACACCCTGCTCTATGG
GACCAGTCCCCTCAACCGGCAGAAGCTAGACAGCAAGAAGTTGCTCGGCCCCATCAGCCAGAAGATGTATGCTGTGCTGCCTTGTGGGGG
CATCGGGGTGGACAGTGACACCGTGTGGAATGAGATGCACTCCTCCAGTGCTGTGCGCATGGCAGTGGGCTGCCTGCTGGAGCTGGCCTT
CAAGGTGGCTGCAGGAGAGCTCAAGAATGGATTTGCCATCATCCGGCCCCCAGGACACCACGCCGAGGAATCCACAGCCATGGGATTCTG
CTTCTTCAACTCTGTAGCCATCACCGCAAAACTCCTACAGCAGAAGTTGAACGTGGGCAAGGTCCTCATCGTGGACTGGGACATTCACCA
TGGCAATGGCACCCAGCAGGCGTTCTACAATGACCCCTCTGTGCTCTACATCTCTCTGCATCGCTATGACAACGGGAACTTCTTTCCAGG
CTCTGGGGCTCCTGAAGAGGTTGGTGGAGGACCAGGCGTGGGGTACAATGTGAACGTGGCATGGACAGGAGGTGTGGACCCCCCCATTGG
AGACGTGGAGTACCTTACAGCCTTCAGGACAGTGGTGATGCCCATTGCCCACGAGTTCTCACCTGATGTGGTCCTAGTCTCCGCCGGGTT
TGATGCTGTTGAAGGACATCTGTCTCCTCTGGGTGGCTACTCTGTCACCGCCAGATGTTTTGGCCACTTGACCAGGCAGCTGATGACCCT
GGCAGGGGGCCGGGTGGTGCTGGCCCTGGAGGGAGGCCATGACTTGACCGCCATCTGTGATGCCTCTGAGGCTTGTGTCTCGGCTCTGCT
CAGTGTAGAGCTGCAGCCCTTGGATGAGGCAGTCTTGCAGCAAAAGCCCAACATCAACGCAGTGGCCACGCTAGAGAAAGTCATCGAGAT
CCAGAGCAAACACTGGAGCTGTGTGCAGAAGTTCGCCGCTGGTCTGGGCCGGTCCCTGCGAGAGGCCCAAGCAGGTGAGACCGAGGAGGC
CGAGACTGTGAGCGCCATGGCCTTGCTGTCGGTGGGGGCCGAGCAGGCCCAGGCTGCGGCAGCCCGGGAACACAGCCCCAGGCCGGCAGA
GGAGCCCATGGAGCAGGAGCCTGCCCTGTGACGCCCCGGCCCCCATCCCTCTGGGCTTCACCATTGTGATTTTGTTTATTTTTTCTATTA


Top

FusionGenePPI for AFF3_HDAC5


check button Go to ChiPPI (Chimeric Protein-Protein interactions) to see the chimeric PPI interaction in

ChiPPI page

.

check button Protein-protein interactors with each fusion partner protein in wild-type (BIOGRID-3.4.160)
HgeneHgene's interactorsTgeneTgene's interactors
AFF3MLLT3, CDK9, PIP4K2AHDAC5ZBTB16, YWHAQ, PRKD1, CTBP1, NRIP1, GATA1, MEF2D, GATA2, TAB2, HDAC3, NCOR1, TBL1X, GPS2, BCL6, IKZF1, IKZF3, IKZF2, IKZF4, NCOR2, MEF2A, YWHAB, YWHAE, SUV39H1, EEF1G, GABARAP, HR, PKN2, PKN1, RUNX2, HIF1A, ESR1, GATA3, SMAD7, HOXC11, MAFF, YWHAG, REST, SIN3A, MARK3, KLF4, YY1, CAMK1, CAMTA2, GCM1, NUP214, GNB1, UBE2I, SMAD3, RFXANK, ANKRA2, CIITA, PPP2CA, DYRK1B, NFKBIA, NFKBIE, HDAC5, HDAC4, CAMK2A, TBX3, SLC2A4RG, MEF2C, HDAC7, PRKAB1, PHB2, MYEF2, AHRR, H3F3A, NR2E1, BCORL1, NFATC1, PRKCD, RBM25, TBL1XR1, HDAC1, RBBP7, RBBP4, MTA2, PRKD2, PPP2R1A, PPP2R2A, YWHAH, YWHAZ, PRKDC, TP53, TUBB, TUBA1A, HSP90AB1, RBM39, HSPA1A, HNRNPA2B1, NUMA1, HIST4H4, HIST2H2AC, HIST1H2BK, HIST3H3, PRKD3, RAD50, MAP1B, USP9X, USP7, IARS, PSMA5, PRPF39, HCFC1, RUVBL1, BAG2, CCAR2, UPF1, PSMC5, NUDC, GCN1L1, PSMD11, NEU1, CDK1, SF3A1, PSMC6, LTA4H, ETFA, COPB2, PCMT1, TNPO1, CSNK2A1, OGT, PGAM5, SF3B1, PSMD1, WDR5, GOT2, XPOT, RPL9, PRMT1, EIF3L, CAND1, DDX20, AHCY, HSD17B10, PPP2CB, LGALS3BP, SMC1A, STRAP, RPN2, DDOST, PSMD2, PSMC4, SF3B2, ECH1, TPI1, PSMD6, TUFM, PSMD3, PCNA, CS, SLC25A11, RAN, HSP90B1, RPL7, UQCRC2, SF3B3, RPL13, PRMT5, PHB, SMC3, RPL10A, LDHA, MDH2, PSMB5, HSPD1, HNRNPF, DDB1, SFXN1, ATP5A1, FLNA, OAT, VDAC1, HSPA4, TRAP1, ATP5B, PPP2R2D, RPN1, MTHFD1, PDIA6, PHGDH, CCT2, NME1, LARS, PCBP2, ALDOA, TRIM28, GANAB, ACTN4, HSP90AA1, DARS, ATP1A1, CANX, PGK1, P4HB, RPS8, RPLP0, CCT6A, PRPF19, HNRNPH2, PA2G4, FXR1, LRPPRC, VDAC2, CSE1L, PKM, RPL3, PRDX3, ACAT1, COPB1, DNAJB11, EIF4A3, PPIA, C1QBP, MCM3, TCP1, MCM4, IMPDH2, RPSA, EIF4A1, CCT7, DDX39B, ATP2A2, MCM2, IRS4, SLC25A1, EPRS, SLC25A3, PRDX4, EIF3F, EIF3C, XRCC5, RUVBL2, NFS1, HNRNPLL, PRPF8, CLTC, CCT4, EFTUD2, CCT5, GLUD1, XRCC6, MARS, XPO1, UBA1, TARS, RPS3A, FASN, KPNB1, MCM6, ACLY, SRSF1, HNRNPD, SLC25A6, CCT8, CAD, NPEPPS, CCT3, TUBB4B, EIF3B, PRDX6, ILF2, CDC5L, SHMT2, DNAJA1, PTBP1, HSPA9, RPS11, APLP2, DHX15, RPL5, RPS3, RARS, CKB, ALDH18A1, PPP1CA, NONO, SNRNP200, DDX1, VCP, HSPA5, DDX17, RPL7A, TKT, PABPC1, MCM5, TFRC, EMD, QARS, MCM7, RPS4X, RPL4, CKMT1B, NUP93, HNRNPL, SFPQ, RBM14, PARP1, ADAR, ILF3, NPM1, DHX9, HIST1H1C, IGF2BP1, DDX3X, MYH9, HNRNPA1, HADHA, HNRNPA3, DDX47, HNRNPR, NOP2, RBMX, TOP1, NFKB1, SF1, KDM5B, BRMS1, SIK2, PRKAA1, JDP2, ATF3, ZBTB7B, SIK1, SFN, APPL1, MYCN, SIK3, AURKB, CEP250, HAUS2, GNB2, DDIT3, HIST1H3A, LTBR, CUL7, RUNX3, TFEB, KCTD3, KIF13B, CGN, ZBTB21, KSR1, CBY1


check button - Retained PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenStill interaction with


check button - Lost PPIs in in-frame fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


check button - Retained PPIs, but lost function due to frame-shift fusion.
PartnerGeneHbpTbpENSTStrandBPexonTotalExonProtein feature loci*BPlociTotalLenInteraction lost with


Top

RelatedDrugs for AFF3_HDAC5


check button Drugs targeting genes involved in this fusion gene.
(DrugBank Version 5.1.0 2018-04-02)
PartnerGeneUniProtAccDrugBank IDDrug nameDrug activityDrug typeDrug status

Top

RelatedDiseases for AFF3_HDAC5


check button Diseases associated with fusion partners.
(DisGeNet 4.0)
PartnerGeneDisease IDDisease name# pubmedsSource
HgeneAFF3C0003873Rheumatoid Arthritis2CTD_human
HgeneAFF3C0236969Substance-Related Disorders1CTD_human
TgeneHDAC5C0011570Mental Depression2PSYGENET
TgeneHDAC5C0011581Depressive disorder2PSYGENET
TgeneHDAC5C0001546Adjustment Disorders1CTD_human
TgeneHDAC5C0041696Unipolar Depression1PSYGENET
TgeneHDAC5C0236736Cocaine-Related Disorders1CTD_human
TgeneHDAC5C0340543Familial primary pulmonary hypertension1CTD_human
TgeneHDAC5C1269683Major Depressive Disorder1PSYGENET