|
||||||
|
 | |
| |
| |
| |
| Open reading frame (ORF) annotation in the exon skipping event |
| |
| |
| Splicing Quantitative Trait Loci (sQTLs) in the skipped exons |
| Splicing Quantitative Trait Methylation (sQTM) in the skipped exon |
| |
|
Gene summary for RAB11A |
 Gene summary |
| Gene information | Gene symbol | RAB11A | Gene ID | 8766 |
| Gene name | RAB11A, member RAS oncogene family | |
| Synonyms | YL8 | |
| Cytomap | 15q22.31 | |
| Type of gene | protein-coding | |
| Description | ras-related protein Rab-11ARAB 11A, member oncogene familyrab-11 | |
| Modification date | 20180523 | |
| UniProtAcc | P62491 | |
| Context | PubMed: RAB11A [Title/Abstract] AND exon [Title/Abstract] AND skip [Title/Abstract] - Title (PMID) |
| Gene ontology of each this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Gene | GO ID | GO term | PubMed ID |
| RAB11A | GO:0016192 | vesicle-mediated transport | 17462998|19542231 |
| RAB11A | GO:0072659 | protein localization to plasma membrane | 17082457 |
Top |
Exon skipping events across known transcript of Ensembl for RAB11A from UCSC genome browser |
| Skipped exons in TCGA and GTEx based on Ensembl gene isoform structure. * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Gene isoform structures and expression levels for RAB11A |
| Expression levels of gene isoforms across TCGA. |
 |
| Expression levels of gene isoforms across GTEx. |
 |
Top |
Exon skipping events with PSIs in TCGA for RAB11A |
| Information of exkip skipping event in TCGA. |
| Exon skip ID | chr | Exons involved in exon skipping | Skipped exon | ENSG | ENSTs |
| exon_skip_122875 | 15 | 66169669:66169865:66170099:66170293:66172008:66172017 | 66170099:66170293 | ENSG00000103769.5 | ENST00000569896.1,ENST00000567671.1,ENST00000261890.2 |
| exon_skip_122876 | 15 | 66169669:66169865:66170099:66170293:66180038:66180074 | 66170099:66170293 | ENSG00000103769.5 | ENST00000566233.1 |
| exon_skip_122881 | 15 | 66170149:66170293:66172008:66172089:66180038:66180074 | 66172008:66172089 | ENSG00000103769.5 | ENST00000564910.1,ENST00000567671.1,ENST00000261890.2 |
| exon_skip_122883 | 15 | 66170099:66170293:66172062:66172089:66180038:66180074 | 66172062:66172089 | ENSG00000103769.5 | ENST00000565075.1 |
| PSI values of skipped exons in TCGA. |
 |
Top |
Exon skipping events with PSIs in GTEx for RAB11A |
| Information of exkip skipping event in GTEx |
| Exon skip ID | chr | Exons involved in exon skipping | Skipped exon | ENSG | ENSTs |
| exon_skip_122875 | 15 | 66169669:66169865:66170099:66170293:66172008:66172017 | 66170099:66170293 | ENSG00000103769.5 | ENST00000261890.2,ENST00000569896.1,ENST00000567671.1 |
| exon_skip_122876 | 15 | 66169669:66169865:66170099:66170293:66180038:66180074 | 66170099:66170293 | ENSG00000103769.5 | ENST00000566233.1 |
| exon_skip_122881 | 15 | 66170149:66170293:66172008:66172089:66180038:66180074 | 66172008:66172089 | ENSG00000103769.5 | ENST00000564910.1,ENST00000261890.2,ENST00000567671.1 |
| exon_skip_122883 | 15 | 66170099:66170293:66172062:66172089:66180038:66180074 | 66172062:66172089 | ENSG00000103769.5 | ENST00000565075.1 |
| PSI values of skipped exons in GTEx. |
 |
| * Skipped exon sequences. |
Top |
Open reading frame (ORF) annotation in the exon skipping event for RAB11A |
| Open reading frame (ORF) of individual exon skipping events in TCGA based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000261890 | 66170099 | 66170293 | Frame-shift |
| ENST00000261890 | 66172008 | 66172089 | In-frame |
| Open reading frame (ORF) of individual exon skipping events in GTEx based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000261890 | 66170099 | 66170293 | Frame-shift |
| ENST00000261890 | 66172008 | 66172089 | In-frame |
Top |
Infer the effects of exon skipping event on protein functional features for RAB11A |
| Exon skipping at the protein sequence level and followed lost functional features. * Click on the image to enlarge it in a new window. |
 |
| Loci of skipped exons in TCGA across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000261890 | 4947 | 216 | 66172008 | 66172089 | 559 | 639 | 143 | 170 |
| Loci of skipped exons in GTEx across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000261890 | 4947 | 216 | 66172008 | 66172089 | 559 | 639 | 143 | 170 |
| Lost protein functional features of individual exon skipping events in TCGA. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| P62491 | 143 | 170 | 147 | 216 | Alternative sequence | ID=VSP_046755;Note=In isoform 2. GLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQCCQNI->EANVRQTRK;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| P62491 | 143 | 170 | 149 | 152 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:1OIX |
| P62491 | 143 | 170 | 2 | 213 | Chain | ID=PRO_0000121151;Note=Ras-related protein Rab-11A |
| P62491 | 143 | 170 | 136 | 145 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:1OIX |
| P62491 | 143 | 170 | 161 | 172 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:1OIX |
| P62491 | 143 | 170 | 154 | 156 | Nucleotide binding | Note=GTP;Ontology_term=ECO:0000269,ECO:0000269,ECO:0000269;evidence=ECO:0000269|PubMed:16905101,ECO:0000269|PubMed:17007872,ECO:0000269|PubMed:17030804;Dbxref=PMID:16905101,PMID:17007872,PMID:17030804 |
| P62491 | 143 | 170 | 155 | 157 | Turn | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:1OIX |
| Lost protein functional features of individual exon skipping events in GTEx. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| P62491 | 143 | 170 | 147 | 216 | Alternative sequence | ID=VSP_046755;Note=In isoform 2. GLSFIETSALDSTNVEAAFQTILTEIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQCCQNI->EANVRQTRK;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| P62491 | 143 | 170 | 149 | 152 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:1OIX |
| P62491 | 143 | 170 | 2 | 213 | Chain | ID=PRO_0000121151;Note=Ras-related protein Rab-11A |
| P62491 | 143 | 170 | 136 | 145 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:1OIX |
| P62491 | 143 | 170 | 161 | 172 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:1OIX |
| P62491 | 143 | 170 | 154 | 156 | Nucleotide binding | Note=GTP;Ontology_term=ECO:0000269,ECO:0000269,ECO:0000269;evidence=ECO:0000269|PubMed:16905101,ECO:0000269|PubMed:17007872,ECO:0000269|PubMed:17030804;Dbxref=PMID:16905101,PMID:17007872,PMID:17030804 |
| P62491 | 143 | 170 | 155 | 157 | Turn | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:1OIX |
Top |
SNVs in the skipped exons for RAB11A |
| - Lollipop plot for presenting exon skipping associated SNVs. * Click on the image to enlarge it in a new window. |
 |
| - Differential PSIs between mutated versus non-mutated samples. |
| - Non-synonymous mutations located in the skipped exons in TCGA. |
| Cancer type | Sample | ESID | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
| LIHC | TCGA-BC-A3KG-01 | 66170100 | 66170293 | 66170258 | 66170258 | Frame_Shift_Del | G | - | p.R132fs | |
| BLCA | TCGA-BT-A3PK-01 | exon_skip_122883 exon_skip_122881 | 66172009 | 66172089 | 66172008 | 66172008 | Splice_Site | G | A | p.E144_splice |
| - Depth of coverage in the three exons composing exon skipping event |
| Depth of coverage in three exons | Mutation description |
| - Non-synonymous mutations located in the skipped exons in CCLE. |
| Sample | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
| HT115_LARGE_INTESTINE | 66172009 | 66172089 | 66172013 | 66172013 | Missense_Mutation | G | T | p.K145N |
| BICR18_UPPER_AERODIGESTIVE_TRACT | 66172009 | 66172089 | 66172010 | 66172010 | Splice_Site | A | G | p.E144E |
Top |
Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for RAB11A |
| sQTL information located at the skipped exons. |
| Exon skip ID | Chromosome | Three exons | Skippped exon | ENST | Cancer type | SNP id | Location | DNA change (ref/var) | P-value |
Top |
Splicing Quantitative Trait Methylation (sQTM) in the skipped exon for RAB11A |
Top |
Survival analysis of Splicing Quantitative Trait Methylation (sQTM) in the skipped exon for RAB11A |
Top |
RelatedDrugs for RAB11A |
| Approved drugs targeting this gene. (DrugBank Version 5.1.0 2018-04-02) |
| Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
RelatedDiseases for RAB11A |
| Diseases associated with this gene. (DisGeNet 4.0) |
| Gene | Disease ID | Disease name | # pubmeds | Source |
| RAB11A | C0263454 | Chloracne | 1 | CTD_human |
Copyright 2018-Present -The University of Texas Health Science Center at Houston (UTHealth)
|