|
||||||
|
 | |
| |
| |
| |
| Open reading frame (ORF) annotation in the exon skipping event |
| |
| |
| Splicing Quantitative Trait Loci (sQTLs) in the skipped exons |
| Splicing Quantitative Trait Methylation (sQTM) in the skipped exon |
| |
|
Gene summary for CSPP1 |
 Gene summary |
| Gene information | Gene symbol | CSPP1 | Gene ID | 79848 |
| Gene name | centrosome and spindle pole associated protein 1 | |
| Synonyms | CSPP|JBTS21 | |
| Cytomap | 8q13.1-q13.2 | |
| Type of gene | protein-coding | |
| Description | centrosome and spindle pole-associated protein 1 | |
| Modification date | 20180523 | |
| UniProtAcc | Q1MSJ5 | |
| Context | PubMed: CSPP1 [Title/Abstract] AND exon [Title/Abstract] AND skip [Title/Abstract] - Title (PMID) |
| Gene ontology of each this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Gene | GO ID | GO term | PubMed ID |
Top |
Exon skipping events across known transcript of Ensembl for CSPP1 from UCSC genome browser |
| Skipped exons in TCGA and GTEx based on Ensembl gene isoform structure. * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Gene isoform structures and expression levels for CSPP1 |
| Expression levels of gene isoforms across TCGA. |
 |
| Expression levels of gene isoforms across GTEx. |
 |
Top |
Exon skipping events with PSIs in TCGA for CSPP1 |
| Information of exkip skipping event in TCGA. |
| Exon skip ID | chr | Exons involved in exon skipping | Skipped exon | ENSG | ENSTs |
| exon_skip_483858 | 8 | 67986477:67986586:67987040:67987158:67988716:67988816 | 67987040:67987158 | ENSG00000104218.9 | ENST00000519701.1 |
| exon_skip_483860 | 8 | 67986477:67986586:67988716:67988816:67998241:67998345 | 67988716:67988816 | ENSG00000104218.9 | ENST00000262210.5,ENST00000521919.1,ENST00000519163.1,ENST00000412460.1 |
| exon_skip_483862 | 8 | 67998241:67998345:67999057:67999081:68004037:68004104 | 67999057:67999081 | ENSG00000104218.9 | ENST00000519163.1,ENST00000412460.1 |
| exon_skip_483863 | 8 | 67998241:67998345:68004037:68004118:68005777:68005855 | 68004037:68004118 | ENSG00000104218.9 | ENST00000521919.1 |
| exon_skip_483866 | 8 | 67998241:67998345:68005777:68005876:68007527:68007967 | 68005777:68005876 | ENSG00000104218.9 | ENST00000262210.5,ENST00000519668.1 |
| exon_skip_483867 | 8 | 68004037:68004118:68005777:68005876:68007527:68007967 | 68005777:68005876 | ENSG00000104218.9 | ENST00000519163.1,ENST00000412460.1 |
| exon_skip_483868 | 8 | 68007527:68007967:68015271:68015370:68018139:68018210 | 68015271:68015370 | ENSG00000104218.9 | ENST00000262210.5,ENST00000519163.1,ENST00000519668.1,ENST00000412460.1 |
| exon_skip_483877 | 8 | 68030482:68030604:68030977:68031056:68044185:68044315 | 68030977:68031056 | ENSG00000104218.9 | ENST00000262210.5,ENST00000519163.1,ENST00000519668.1,ENST00000412460.1 |
| exon_skip_483879 | 8 | 68044185:68044315:68049690:68049838:68062017:68062170 | 68049690:68049838 | ENSG00000104218.9 | ENST00000262210.5,ENST00000519163.1 |
| exon_skip_483880 | 8 | 68049690:68049838:68062017:68062170:68066258:68066371 | 68062017:68062170 | ENSG00000104218.9 | ENST00000262210.5,ENST00000519163.1 |
| exon_skip_483882 | 8 | 68049690:68049838:68066258:68066371:68070681:68070831 | 68066258:68066371 | ENSG00000104218.9 | ENST00000519668.1,ENST00000412460.1 |
| exon_skip_483883 | 8 | 68062017:68062170:68066258:68066371:68070681:68070831 | 68066258:68066371 | ENSG00000104218.9 | ENST00000262210.5,ENST00000519163.1 |
| exon_skip_483886 | 8 | 68076625:68076743:68084650:68084790:68087530:68087671 | 68084650:68084790 | ENSG00000104218.9 | ENST00000521168.1,ENST00000262210.5,ENST00000519668.1,ENST00000412460.1 |
| exon_skip_483888 | 8 | 68084746:68084790:68085003:68085208:68087530:68087671 | 68085003:68085208 | ENSG00000104218.9 | ENST00000521324.1 |
| exon_skip_483894 | 8 | 68089914:68089961:68092097:68092161:68102884:68102994 | 68092097:68092161 | ENSG00000104218.9 | ENST00000521324.1,ENST00000521168.1,ENST00000262210.5,ENST00000519668.1,ENST00000412460.1 |
| exon_skip_483899 | 8 | 68092097:68092161:68102884:68102994:68105698:68105812 | 68102884:68102994 | ENSG00000104218.9 | ENST00000521324.1,ENST00000262210.5,ENST00000519668.1,ENST00000412460.1 |
| exon_skip_483900 | 8 | 68092097:68092161:68102884:68102994:68107616:68107753 | 68102884:68102994 | ENSG00000104218.9 | ENST00000521168.1 |
| exon_skip_483906 | 8 | 68102884:68102994:68105698:68105837:68107616:68107753 | 68105698:68105837 | ENSG00000104218.9 | ENST00000262210.5,ENST00000519668.1,ENST00000412460.1 |
| PSI values of skipped exons in TCGA. |
 |
Top |
Exon skipping events with PSIs in GTEx for CSPP1 |
| Information of exkip skipping event in GTEx |
| Exon skip ID | chr | Exons involved in exon skipping | Skipped exon | ENSG | ENSTs |
| exon_skip_483858 | 8 | 67986477:67986586:67987040:67987158:67988716:67988816 | 67987040:67987158 | ENSG00000104218.9 | ENST00000519701.1 |
| exon_skip_483860 | 8 | 67986477:67986586:67988716:67988816:67998241:67998345 | 67988716:67988816 | ENSG00000104218.9 | ENST00000521919.1,ENST00000262210.5,ENST00000412460.1,ENST00000519163.1 |
| exon_skip_483862 | 8 | 67998241:67998345:67999057:67999081:68004037:68004104 | 67999057:67999081 | ENSG00000104218.9 | ENST00000412460.1,ENST00000519163.1 |
| exon_skip_483863 | 8 | 67998241:67998345:68004037:68004118:68005777:68005855 | 68004037:68004118 | ENSG00000104218.9 | ENST00000521919.1 |
| exon_skip_483866 | 8 | 67998241:67998345:68005777:68005876:68007527:68007967 | 68005777:68005876 | ENSG00000104218.9 | ENST00000262210.5,ENST00000519668.1 |
| exon_skip_483867 | 8 | 68004037:68004118:68005777:68005876:68007527:68007967 | 68005777:68005876 | ENSG00000104218.9 | ENST00000412460.1,ENST00000519163.1 |
| exon_skip_483868 | 8 | 68007527:68007967:68015271:68015370:68018139:68018210 | 68015271:68015370 | ENSG00000104218.9 | ENST00000262210.5,ENST00000412460.1,ENST00000519163.1,ENST00000519668.1 |
| exon_skip_483877 | 8 | 68030482:68030604:68030977:68031056:68044185:68044315 | 68030977:68031056 | ENSG00000104218.9 | ENST00000262210.5,ENST00000412460.1,ENST00000519163.1,ENST00000519668.1 |
| exon_skip_483879 | 8 | 68044185:68044315:68049690:68049838:68062017:68062170 | 68049690:68049838 | ENSG00000104218.9 | ENST00000262210.5,ENST00000519163.1 |
| exon_skip_483880 | 8 | 68049690:68049838:68062017:68062170:68066258:68066371 | 68062017:68062170 | ENSG00000104218.9 | ENST00000262210.5,ENST00000519163.1 |
| exon_skip_483882 | 8 | 68049690:68049838:68066258:68066371:68070681:68070831 | 68066258:68066371 | ENSG00000104218.9 | ENST00000412460.1,ENST00000519668.1 |
| exon_skip_483883 | 8 | 68062017:68062170:68066258:68066371:68070681:68070831 | 68066258:68066371 | ENSG00000104218.9 | ENST00000262210.5,ENST00000519163.1 |
| exon_skip_483886 | 8 | 68076625:68076743:68084650:68084790:68087530:68087671 | 68084650:68084790 | ENSG00000104218.9 | ENST00000262210.5,ENST00000412460.1,ENST00000519668.1,ENST00000521168.1 |
| exon_skip_483888 | 8 | 68084746:68084790:68085003:68085208:68087530:68087671 | 68085003:68085208 | ENSG00000104218.9 | ENST00000521324.1 |
| exon_skip_483894 | 8 | 68089914:68089961:68092097:68092161:68102884:68102994 | 68092097:68092161 | ENSG00000104218.9 | ENST00000262210.5,ENST00000412460.1,ENST00000519668.1,ENST00000521168.1,ENST00000521324.1 |
| exon_skip_483899 | 8 | 68092097:68092161:68102884:68102994:68105698:68105812 | 68102884:68102994 | ENSG00000104218.9 | ENST00000262210.5,ENST00000412460.1,ENST00000519668.1,ENST00000521324.1 |
| exon_skip_483900 | 8 | 68092097:68092161:68102884:68102994:68107616:68107753 | 68102884:68102994 | ENSG00000104218.9 | ENST00000521168.1 |
| exon_skip_483906 | 8 | 68102884:68102994:68105698:68105837:68107616:68107753 | 68105698:68105837 | ENSG00000104218.9 | ENST00000262210.5,ENST00000412460.1,ENST00000519668.1 |
| PSI values of skipped exons in GTEx. |
 |
| * Skipped exon sequences. |
Top |
Open reading frame (ORF) annotation in the exon skipping event for CSPP1 |
| Open reading frame (ORF) of individual exon skipping events in TCGA based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000262210 | 67988716 | 67988816 | Frame-shift |
| ENST00000262210 | 68030977 | 68031056 | Frame-shift |
| ENST00000262210 | 68049690 | 68049838 | Frame-shift |
| ENST00000262210 | 68066258 | 68066371 | Frame-shift |
| ENST00000262210 | 68084650 | 68084790 | Frame-shift |
| ENST00000262210 | 68092097 | 68092161 | Frame-shift |
| ENST00000262210 | 68102884 | 68102994 | Frame-shift |
| ENST00000262210 | 68105698 | 68105837 | Frame-shift |
| ENST00000262210 | 68005777 | 68005876 | In-frame |
| ENST00000262210 | 68015271 | 68015370 | In-frame |
| ENST00000262210 | 68062017 | 68062170 | In-frame |
| Open reading frame (ORF) of individual exon skipping events in GTEx based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000262210 | 67988716 | 67988816 | Frame-shift |
| ENST00000262210 | 68030977 | 68031056 | Frame-shift |
| ENST00000262210 | 68049690 | 68049838 | Frame-shift |
| ENST00000262210 | 68066258 | 68066371 | Frame-shift |
| ENST00000262210 | 68084650 | 68084790 | Frame-shift |
| ENST00000262210 | 68092097 | 68092161 | Frame-shift |
| ENST00000262210 | 68102884 | 68102994 | Frame-shift |
| ENST00000262210 | 68105698 | 68105837 | Frame-shift |
| ENST00000262210 | 68005777 | 68005876 | In-frame |
| ENST00000262210 | 68015271 | 68015370 | In-frame |
| ENST00000262210 | 68062017 | 68062170 | In-frame |
Top |
Infer the effects of exon skipping event on protein functional features for CSPP1 |
| Exon skipping at the protein sequence level and followed lost functional features. * Click on the image to enlarge it in a new window. |
 |
| Loci of skipped exons in TCGA across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000262210 | 4384 | 1256 | 68005777 | 68005876 | 443 | 541 | 137 | 170 |
| ENST00000262210 | 4384 | 1256 | 68015271 | 68015370 | 982 | 1080 | 317 | 349 |
| ENST00000262210 | 4384 | 1256 | 68062017 | 68062170 | 1992 | 2144 | 653 | 704 |
| Loci of skipped exons in GTEx across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000262210 | 4384 | 1256 | 68005777 | 68005876 | 443 | 541 | 137 | 170 |
| ENST00000262210 | 4384 | 1256 | 68015271 | 68015370 | 982 | 1080 | 317 | 349 |
| ENST00000262210 | 4384 | 1256 | 68062017 | 68062170 | 1992 | 2144 | 653 | 704 |
| Lost protein functional features of individual exon skipping events in TCGA. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| Q1MSJ5 | 137 | 170 | 1 | 329 | Alternative sequence | ID=VSP_026475;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15580290;Dbxref=PMID:15580290 |
| Q1MSJ5 | 137 | 170 | 138 | 172 | Alternative sequence | ID=VSP_040072;Note=In isoform 1. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:16826565;Dbxref=PMID:16826565 |
| Q1MSJ5 | 137 | 170 | 1 | 1256 | Chain | ID=PRO_0000293464;Note=Centrosome and spindle pole-associated protein 1 |
| Q1MSJ5 | 317 | 349 | 1 | 329 | Alternative sequence | ID=VSP_026475;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15580290;Dbxref=PMID:15580290 |
| Q1MSJ5 | 317 | 349 | 1 | 1256 | Chain | ID=PRO_0000293464;Note=Centrosome and spindle pole-associated protein 1 |
| Q1MSJ5 | 653 | 704 | 689 | 740 | Alternative sequence | ID=VSP_026476;Note=In isoform 2. TDLNRMHRQNIDAYHNPDARTYEDKRAVVSLDPNLATSNAENLEDAANKSSG->S;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15580290;Dbxref=PMID:15580290 |
| Q1MSJ5 | 653 | 704 | 1 | 1256 | Chain | ID=PRO_0000293464;Note=Centrosome and spindle pole-associated protein 1 |
| Q1MSJ5 | 653 | 704 | 625 | 669 | Coiled coil | Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Q1MSJ5 | 653 | 704 | 672 | 677 | Compositional bias | Note=Poly-Gly |
| Lost protein functional features of individual exon skipping events in GTEx. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| Q1MSJ5 | 137 | 170 | 1 | 329 | Alternative sequence | ID=VSP_026475;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15580290;Dbxref=PMID:15580290 |
| Q1MSJ5 | 137 | 170 | 138 | 172 | Alternative sequence | ID=VSP_040072;Note=In isoform 1. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:16826565;Dbxref=PMID:16826565 |
| Q1MSJ5 | 137 | 170 | 1 | 1256 | Chain | ID=PRO_0000293464;Note=Centrosome and spindle pole-associated protein 1 |
| Q1MSJ5 | 317 | 349 | 1 | 329 | Alternative sequence | ID=VSP_026475;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15580290;Dbxref=PMID:15580290 |
| Q1MSJ5 | 317 | 349 | 1 | 1256 | Chain | ID=PRO_0000293464;Note=Centrosome and spindle pole-associated protein 1 |
| Q1MSJ5 | 653 | 704 | 689 | 740 | Alternative sequence | ID=VSP_026476;Note=In isoform 2. TDLNRMHRQNIDAYHNPDARTYEDKRAVVSLDPNLATSNAENLEDAANKSSG->S;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15580290;Dbxref=PMID:15580290 |
| Q1MSJ5 | 653 | 704 | 1 | 1256 | Chain | ID=PRO_0000293464;Note=Centrosome and spindle pole-associated protein 1 |
| Q1MSJ5 | 653 | 704 | 625 | 669 | Coiled coil | Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| Q1MSJ5 | 653 | 704 | 672 | 677 | Compositional bias | Note=Poly-Gly |
Top |
SNVs in the skipped exons for CSPP1 |
| - Lollipop plot for presenting exon skipping associated SNVs. * Click on the image to enlarge it in a new window. |
 |
| - Differential PSIs between mutated versus non-mutated samples. |
CSPP1_ESCA_exon_skip_483894_psi_boxplot.png |
CSPP1_HNSC_exon_skip_483894_psi_boxplot.png |
CSPP1_KIRC_exon_skip_483894_psi_boxplot.png |
CSPP1_LIHC_exon_skip_483894_psi_boxplot.png |
| - Non-synonymous mutations located in the skipped exons in TCGA. |
| Cancer type | Sample | ESID | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
| LIHC | TCGA-DD-A3A0-01 | exon_skip_483879 | 68049691 | 68049838 | 68049789 | 68049789 | Frame_Shift_Del | A | - | p.G637fs |
| LIHC | TCGA-DD-A3A0-01 | exon_skip_483880 | 68062018 | 68062170 | 68062130 | 68062130 | Frame_Shift_Del | A | - | p.S691fs |
| LIHC | TCGA-DD-A39Y-01 | exon_skip_483894 | 68092098 | 68092161 | 68092125 | 68092125 | Frame_Shift_Del | A | - | p.K1057fs |
| LIHC | TCGA-G3-A3CJ-01 | exon_skip_483900 exon_skip_483899 | 68102885 | 68102994 | 68102928 | 68102928 | Frame_Shift_Del | C | - | p.L1083fs |
| LIHC | TCGA-DD-A1EG-01 | exon_skip_483906 | 68105699 | 68105837 | 68105740 | 68105740 | Frame_Shift_Del | A | - | p.L1119fs |
| LIHC | TCGA-G3-A3CJ-01 | exon_skip_483906 | 68105699 | 68105837 | 68105740 | 68105740 | Frame_Shift_Del | A | - | p.L1119fs |
| STAD | TCGA-CG-5724-01 | exon_skip_483906 | 68105699 | 68105837 | 68105772 | 68105773 | Frame_Shift_Del | TT | - | p.L1165fs |
| KIRC | TCGA-B8-A54H-01 | exon_skip_483894 | 68092098 | 68092161 | 68092158 | 68092159 | Frame_Shift_Ins | - | T | p.I1068fs |
| HNSC | TCGA-CV-5440-01 | exon_skip_483894 | 68092098 | 68092161 | 68092140 | 68092140 | Nonsense_Mutation | G | T | p.E1062* |
| HNSC | TCGA-CV-5440-01 | exon_skip_483894 | 68092098 | 68092161 | 68092140 | 68092140 | Nonsense_Mutation | G | T | p.E1097* |
| UCEC | TCGA-AP-A0LM-01 | exon_skip_483906 | 68105699 | 68105837 | 68105798 | 68105798 | Nonsense_Mutation | C | T | p.R1174* |
| UCEC | TCGA-BS-A0UF-01 | exon_skip_483879 | 68049691 | 68049838 | 68049689 | 68049689 | Splice_Site | A | G | e17-2 |
| ESCA | TCGA-LN-A8I0-01 | exon_skip_483894 | 68092098 | 68092161 | 68092096 | 68092096 | Splice_Site | A | G | . |
| ESCA | TCGA-LN-A8I0-01 | exon_skip_483894 | 68092098 | 68092161 | 68092096 | 68092096 | Splice_Site | A | G | e26-2 |
| - Depth of coverage in the three exons composing exon skipping event |
| Depth of coverage in three exons | Mutation description |
 | Sample: TCGA-B8-A54H-01 |
| Cancer type: KIRC | |
| ESID: exon_skip_483894 | |
| Skipped exon start: 68092098 | |
| Skipped exon end: 68092161 | |
| Mutation start: 68092158 | |
| Mutation end: 68092159 | |
| Mutation type: Frame_Shift_Ins | |
| Reference seq: - | |
| Mutation seq: T | |
| AAchange: p.I1068fs | |
exon_skip_111139_KIRC_TCGA-B8-A54H-01.png | |
exon_skip_111141_KIRC_TCGA-B8-A54H-01.png | |
exon_skip_483894_KIRC_TCGA-B8-A54H-01.png | |
| - Non-synonymous mutations located in the skipped exons in CCLE. |
| Sample | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
| SW13_ADRENAL_CORTEX | 67988717 | 67988816 | 67988810 | 67988810 | Missense_Mutation | T | G | p.S101A |
| BICR22_UPPER_AERODIGESTIVE_TRACT | 68030978 | 68031056 | 68031002 | 68031002 | Missense_Mutation | A | C | p.Q543P |
| KCL22_HAEMATOPOIETIC_AND_LYMPHOID_TISSUE | 68049691 | 68049838 | 68049695 | 68049695 | Missense_Mutation | G | A | p.R606Q |
| SARC9371_BONE | 68049691 | 68049838 | 68049781 | 68049781 | Missense_Mutation | C | T | p.P635S |
| HCC2450_LUNG | 68062018 | 68062170 | 68062107 | 68062107 | Missense_Mutation | C | G | p.L684V |
| BICR18_UPPER_AERODIGESTIVE_TRACT | 68062018 | 68062170 | 68062107 | 68062107 | Missense_Mutation | C | A | p.L684I |
| S117_SOFT_TISSUE | 68062018 | 68062170 | 68062107 | 68062107 | Missense_Mutation | C | A | p.L684I |
| DAUDI_HAEMATOPOIETIC_AND_LYMPHOID_TISSUE | 68062018 | 68062170 | 68062107 | 68062107 | Missense_Mutation | C | A | p.L684I |
| BICR18_UPPER_AERODIGESTIVE_TRACT | 68062018 | 68062170 | 68062114 | 68062114 | Missense_Mutation | C | A | p.P686Q |
| S117_SOFT_TISSUE | 68062018 | 68062170 | 68062114 | 68062114 | Missense_Mutation | C | A | p.P686Q |
| DAUDI_HAEMATOPOIETIC_AND_LYMPHOID_TISSUE | 68062018 | 68062170 | 68062114 | 68062114 | Missense_Mutation | C | A | p.P686Q |
| SNU1040_LARGE_INTESTINE | 68062018 | 68062170 | 68062156 | 68062156 | Missense_Mutation | C | T | p.A700V |
| VMRCRCZ_KIDNEY | 68066259 | 68066371 | 68066286 | 68066286 | Missense_Mutation | T | C | p.F714S |
| JURKAT_HAEMATOPOIETIC_AND_LYMPHOID_TISSUE | 68066259 | 68066371 | 68066297 | 68066297 | Missense_Mutation | A | G | p.N718D |
| NCIH1155_LUNG | 68066259 | 68066371 | 68066306 | 68066306 | Missense_Mutation | G | A | p.G721S |
| A704_KIDNEY | 68066259 | 68066371 | 68066313 | 68066313 | Missense_Mutation | C | G | p.P723R |
| MDAMB453_BREAST | 68084651 | 68084790 | 68084784 | 68084784 | Missense_Mutation | G | C | p.D983H |
| SNUC5_LARGE_INTESTINE | 68092098 | 68092161 | 68092151 | 68092151 | Missense_Mutation | T | G | p.S1065R |
| HCC1143_BREAST | 68102885 | 68102994 | 68102915 | 68102915 | Missense_Mutation | A | C | p.E1079A |
| PACADD137_PANCREAS | 68102885 | 68102994 | 68102926 | 68102926 | Missense_Mutation | C | A | p.L1083I |
| PRECLH_PROSTATE | 68102885 | 68102994 | 68102947 | 68102947 | Missense_Mutation | C | A | p.P1090T |
| LS180_LARGE_INTESTINE | 68102885 | 68102994 | 68102962 | 68102962 | Missense_Mutation | C | T | p.R1095C |
| CW2_LARGE_INTESTINE | 68102885 | 68102994 | 68102963 | 68102963 | Missense_Mutation | G | A | p.R1095H |
| NCIH2110_LUNG | 68084651 | 68084790 | 68084649 | 68084655 | Splice_Site | AGGAAAA | - | p.KEK938fs |
Top |
Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for CSPP1 |
| sQTL information located at the skipped exons. |
| Exon skip ID | Chromosome | Three exons | Skippped exon | ENST | Cancer type | SNP id | Location | DNA change (ref/var) | P-value |
Top |
Splicing Quantitative Trait Methylation (sQTM) in the skipped exon for CSPP1 |
Top |
Survival analysis of Splicing Quantitative Trait Methylation (sQTM) in the skipped exon for CSPP1 |
Top |
RelatedDrugs for CSPP1 |
| Approved drugs targeting this gene. (DrugBank Version 5.1.0 2018-04-02) |
| Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
RelatedDiseases for CSPP1 |
| Diseases associated with this gene. (DisGeNet 4.0) |
| Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2018-Present -The University of Texas Health Science Center at Houston (UTHealth)
|