|
||||||
|
 | |
| |
| |
| |
| Open reading frame (ORF) annotation in the exon skipping event |
| |
| |
| Splicing Quantitative Trait Loci (sQTLs) in the skipped exons |
| Splicing Quantitative Trait Methylation (sQTM) in the skipped exon |
| |
|
Gene summary for PLAU |
 Gene summary |
| Gene information | Gene symbol | PLAU | Gene ID | 5328 |
| Gene name | plasminogen activator, urokinase | |
| Synonyms | ATF|BDPLT5|QPD|UPA|URK|u-PA | |
| Cytomap | 10q22.2 | |
| Type of gene | protein-coding | |
| Description | urokinase-type plasminogen activatorU-plasminogen activatorplasminogen activator, urinary | |
| Modification date | 20180527 | |
| UniProtAcc | P00749 | |
| Context | PubMed: PLAU [Title/Abstract] AND exon [Title/Abstract] AND skip [Title/Abstract] - Title (PMID) |
| Gene ontology of each this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Gene | GO ID | GO term | PubMed ID |
| PLAU | GO:0010469 | regulation of signaling receptor activity | 8837777 |
| PLAU | GO:0014910 | regulation of smooth muscle cell migration | 8837777 |
| PLAU | GO:0030335 | positive regulation of cell migration | 25168896 |
| PLAU | GO:0031639 | plasminogen activation | 25978044 |
| PLAU | GO:0033628 | regulation of cell adhesion mediated by integrin | 8837777 |
| PLAU | GO:2000097 | regulation of smooth muscle cell-matrix adhesion | 8837777 |
Top |
Exon skipping events across known transcript of Ensembl for PLAU from UCSC genome browser |
| Skipped exons in TCGA and GTEx based on Ensembl gene isoform structure. * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Gene isoform structures and expression levels for PLAU |
| Expression levels of gene isoforms across TCGA. |
 |
| Expression levels of gene isoforms across GTEx. |
 |
Top |
Exon skipping events with PSIs in TCGA for PLAU |
| Information of exkip skipping event in TCGA. |
| Exon skip ID | chr | Exons involved in exon skipping | Skipped exon | ENSG | ENSTs |
| exon_skip_42580 | 10 | 75671282:75671370:75671798:75671826:75671972:75672080 | 75671798:75671826 | ENSG00000122861.11 | ENST00000372764.3,ENST00000481390.1 |
| exon_skip_42583 | 10 | 75671798:75671826:75671972:75672080:75672681:75672856 | 75671972:75672080 | ENSG00000122861.11 | ENST00000372764.3,ENST00000481390.1 |
| exon_skip_42584 | 10 | 75673047:75673139:75673296:75673516:75673737:75673886 | 75673296:75673516 | ENSG00000122861.11 | ENST00000372762.4,ENST00000446342.1,ENST00000372764.3 |
| exon_skip_42586 | 10 | 75673737:75673886:75674533:75674674:75675008:75675157 | 75674533:75674674 | ENSG00000122861.11 | ENST00000372762.4,ENST00000446342.1,ENST00000372764.3 |
| PSI values of skipped exons in TCGA. |
 |
Top |
Exon skipping events with PSIs in GTEx for PLAU |
| Information of exkip skipping event in GTEx |
| Exon skip ID | chr | Exons involved in exon skipping | Skipped exon | ENSG | ENSTs |
| exon_skip_42580 | 10 | 75671282:75671370:75671798:75671826:75671972:75672080 | 75671798:75671826 | ENSG00000122861.11 | ENST00000481390.1,ENST00000372764.3 |
| exon_skip_42583 | 10 | 75671798:75671826:75671972:75672080:75672681:75672856 | 75671972:75672080 | ENSG00000122861.11 | ENST00000481390.1,ENST00000372764.3 |
| exon_skip_42584 | 10 | 75673047:75673139:75673296:75673516:75673737:75673886 | 75673296:75673516 | ENSG00000122861.11 | ENST00000446342.1,ENST00000372764.3,ENST00000372762.4 |
| exon_skip_42586 | 10 | 75673737:75673886:75674533:75674674:75675008:75675157 | 75674533:75674674 | ENSG00000122861.11 | ENST00000446342.1,ENST00000372764.3,ENST00000372762.4 |
| PSI values of skipped exons in GTEx. |
 |
| * Skipped exon sequences. |
Top |
Open reading frame (ORF) annotation in the exon skipping event for PLAU |
| Open reading frame (ORF) of individual exon skipping events in TCGA based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000372764 | 75671798 | 75671826 | Frame-shift |
| ENST00000372764 | 75673296 | 75673516 | Frame-shift |
| ENST00000372764 | 75671972 | 75672080 | In-frame |
| ENST00000372764 | 75674533 | 75674674 | In-frame |
| Open reading frame (ORF) of individual exon skipping events in GTEx based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000372764 | 75671798 | 75671826 | Frame-shift |
| ENST00000372764 | 75673296 | 75673516 | Frame-shift |
| ENST00000372764 | 75671972 | 75672080 | In-frame |
| ENST00000372764 | 75674533 | 75674674 | In-frame |
Top |
Infer the effects of exon skipping event on protein functional features for PLAU |
| Exon skipping at the protein sequence level and followed lost functional features. * Click on the image to enlarge it in a new window. |
 |
| Loci of skipped exons in TCGA across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000372764 | 2338 | 431 | 75671972 | 75672080 | 179 | 286 | 28 | 64 |
| ENST00000372764 | 2338 | 431 | 75674533 | 75674674 | 923 | 1063 | 276 | 323 |
| Loci of skipped exons in GTEx across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000372764 | 2338 | 431 | 75671972 | 75672080 | 179 | 286 | 28 | 64 |
| ENST00000372764 | 2338 | 431 | 75674533 | 75674674 | 923 | 1063 | 276 | 323 |
| Lost protein functional features of individual exon skipping events in TCGA. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| P00749 | 28 | 64 | 1 | 29 | Alternative sequence | ID=VSP_038368;Note=In isoform 2. MRALLARLLLCVLVVSDSKGSNELHQVPS->MVFHLRTRYEQA;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| P00749 | 28 | 64 | 34 | 36 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:1URK |
| P00749 | 28 | 64 | 38 | 41 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2FD6 |
| P00749 | 28 | 64 | 49 | 52 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2FD6 |
| P00749 | 28 | 64 | 57 | 59 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2FD6 |
| P00749 | 28 | 64 | 64 | 67 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2FD6 |
| P00749 | 28 | 64 | 21 | 431 | Chain | ID=PRO_0000028318;Note=Urokinase-type plasminogen activator |
| P00749 | 28 | 64 | 21 | 177 | Chain | ID=PRO_0000028319;Note=Urokinase-type plasminogen activator long chain A |
| P00749 | 28 | 64 | 31 | 39 | Disulfide bond | . |
| P00749 | 28 | 64 | 33 | 51 | Disulfide bond | . |
| P00749 | 28 | 64 | 53 | 62 | Disulfide bond | . |
| P00749 | 28 | 64 | 27 | 63 | Domain | Note=EGF-like;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00076 |
| P00749 | 28 | 64 | 38 | 38 | Glycosylation | Note=O-linked (Fuc) threonine;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:2023947;Dbxref=PMID:2023947 |
| P00749 | 28 | 64 | 34 | 57 | Region | Note=Binds urokinase plasminogen activator surface receptor;Ontology_term=ECO:0000250;evidence=ECO:0000250 |
| P00749 | 28 | 64 | 43 | 47 | Turn | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2FD6 |
| P00749 | 276 | 323 | 277 | 282 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:4JNI |
| P00749 | 276 | 323 | 293 | 295 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:1LMW |
| P00749 | 276 | 323 | 312 | 318 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:4JNI |
| P00749 | 276 | 323 | 21 | 431 | Chain | ID=PRO_0000028318;Note=Urokinase-type plasminogen activator |
| P00749 | 276 | 323 | 179 | 431 | Chain | ID=PRO_0000028321;Note=Urokinase-type plasminogen activator chain B |
| P00749 | 276 | 323 | 168 | 299 | Disulfide bond | Note=Interchain (between A and B chains) |
| P00749 | 276 | 323 | 217 | 288 | Disulfide bond | . |
| P00749 | 276 | 323 | 313 | 382 | Disulfide bond | . |
| P00749 | 276 | 323 | 179 | 424 | Domain | Note=Peptidase S1;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00274 |
| P00749 | 276 | 323 | 322 | 322 | Glycosylation | ID=CAR_000026;Note=N-linked (GlcNAc...) asparagine |
| P00749 | 276 | 323 | 323 | 323 | Modified residue | Note=Phosphoserine;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:9151681;Dbxref=PMID:9151681 |
| P00749 | 276 | 323 | 323 | 323 | Mutagenesis | Note=Abolishes phosphorylation%2C proadhesive function and ability to induce chemotactic response%3B when associated with E-158. S->E;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:9151681;Dbxref=PMID:9151681 |
| Lost protein functional features of individual exon skipping events in GTEx. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| P00749 | 28 | 64 | 1 | 29 | Alternative sequence | ID=VSP_038368;Note=In isoform 2. MRALLARLLLCVLVVSDSKGSNELHQVPS->MVFHLRTRYEQA;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| P00749 | 28 | 64 | 34 | 36 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:1URK |
| P00749 | 28 | 64 | 38 | 41 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2FD6 |
| P00749 | 28 | 64 | 49 | 52 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2FD6 |
| P00749 | 28 | 64 | 57 | 59 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2FD6 |
| P00749 | 28 | 64 | 64 | 67 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2FD6 |
| P00749 | 28 | 64 | 21 | 431 | Chain | ID=PRO_0000028318;Note=Urokinase-type plasminogen activator |
| P00749 | 28 | 64 | 21 | 177 | Chain | ID=PRO_0000028319;Note=Urokinase-type plasminogen activator long chain A |
| P00749 | 28 | 64 | 31 | 39 | Disulfide bond | . |
| P00749 | 28 | 64 | 33 | 51 | Disulfide bond | . |
| P00749 | 28 | 64 | 53 | 62 | Disulfide bond | . |
| P00749 | 28 | 64 | 27 | 63 | Domain | Note=EGF-like;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00076 |
| P00749 | 28 | 64 | 38 | 38 | Glycosylation | Note=O-linked (Fuc) threonine;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:2023947;Dbxref=PMID:2023947 |
| P00749 | 28 | 64 | 34 | 57 | Region | Note=Binds urokinase plasminogen activator surface receptor;Ontology_term=ECO:0000250;evidence=ECO:0000250 |
| P00749 | 28 | 64 | 43 | 47 | Turn | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2FD6 |
| P00749 | 276 | 323 | 277 | 282 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:4JNI |
| P00749 | 276 | 323 | 293 | 295 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:1LMW |
| P00749 | 276 | 323 | 312 | 318 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:4JNI |
| P00749 | 276 | 323 | 21 | 431 | Chain | ID=PRO_0000028318;Note=Urokinase-type plasminogen activator |
| P00749 | 276 | 323 | 179 | 431 | Chain | ID=PRO_0000028321;Note=Urokinase-type plasminogen activator chain B |
| P00749 | 276 | 323 | 168 | 299 | Disulfide bond | Note=Interchain (between A and B chains) |
| P00749 | 276 | 323 | 217 | 288 | Disulfide bond | . |
| P00749 | 276 | 323 | 313 | 382 | Disulfide bond | . |
| P00749 | 276 | 323 | 179 | 424 | Domain | Note=Peptidase S1;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00274 |
| P00749 | 276 | 323 | 322 | 322 | Glycosylation | ID=CAR_000026;Note=N-linked (GlcNAc...) asparagine |
| P00749 | 276 | 323 | 323 | 323 | Modified residue | Note=Phosphoserine;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:9151681;Dbxref=PMID:9151681 |
| P00749 | 276 | 323 | 323 | 323 | Mutagenesis | Note=Abolishes phosphorylation%2C proadhesive function and ability to induce chemotactic response%3B when associated with E-158. S->E;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:9151681;Dbxref=PMID:9151681 |
Top |
SNVs in the skipped exons for PLAU |
| - Lollipop plot for presenting exon skipping associated SNVs. * Click on the image to enlarge it in a new window. |
 |
| - Differential PSIs between mutated versus non-mutated samples. |
PLAU_ESCA_exon_skip_42584_psi_boxplot.png |
PLAU_HNSC_exon_skip_42584_psi_boxplot.png |
PLAU_KIRC_exon_skip_42584_psi_boxplot.png |
PLAU_LIHC_exon_skip_42584_psi_boxplot.png |
PLAU_STAD_exon_skip_42584_psi_boxplot.png |
| - Non-synonymous mutations located in the skipped exons in TCGA. |
| Cancer type | Sample | ESID | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
| ESCA | TCGA-LN-A7HV-01 | exon_skip_42584 | 75673297 | 75673516 | 75673298 | 75673298 | Frame_Shift_Del | A | - | p.K156fs |
| HNSC | TCGA-F7-A624-01 | exon_skip_42584 | 75673297 | 75673516 | 75673438 | 75673438 | Frame_Shift_Del | G | - | p.R184fs |
| LIHC | TCGA-DD-A1EG-01 | exon_skip_42584 | 75673297 | 75673516 | 75673438 | 75673438 | Frame_Shift_Del | G | - | p.R184fs |
| LIHC | TCGA-DD-A1EG-01 | exon_skip_42584 | 75673297 | 75673516 | 75673438 | 75673438 | Frame_Shift_Del | G | - | p.R201fs |
| LIHC | TCGA-DD-A39Y-01 | exon_skip_42584 | 75673297 | 75673516 | 75673438 | 75673438 | Frame_Shift_Del | G | - | p.R184fs |
| LIHC | TCGA-DD-A3A0-01 | exon_skip_42584 | 75673297 | 75673516 | 75673438 | 75673438 | Frame_Shift_Del | G | - | p.R184fs |
| LIHC | TCGA-DD-A3A0-01 | exon_skip_42584 | 75673297 | 75673516 | 75673438 | 75673438 | Frame_Shift_Del | G | - | p.R201fs |
| LIHC | TCGA-G3-A3CJ-01 | exon_skip_42584 | 75673297 | 75673516 | 75673438 | 75673438 | Frame_Shift_Del | G | - | p.R184fs |
| LIHC | TCGA-G3-A3CJ-01 | exon_skip_42584 | 75673297 | 75673516 | 75673438 | 75673438 | Frame_Shift_Del | G | - | p.R201fs |
| STAD | TCGA-CG-5723-01 | exon_skip_42584 | 75673297 | 75673516 | 75673438 | 75673438 | Frame_Shift_Del | G | - | p.R201fs |
| BLCA | TCGA-FD-A3B6-01 | exon_skip_42584 | 75673297 | 75673516 | 75673458 | 75673459 | Frame_Shift_Del | GT | - | p.V191fs |
| BLCA | TCGA-FD-A3B6-01 | exon_skip_42584 | 75673297 | 75673516 | 75673458 | 75673459 | Frame_Shift_Del | GT | - | p.V208fs |
| LIHC | TCGA-BC-A112-01 | exon_skip_42584 | 75673297 | 75673516 | 75673406 | 75673407 | Frame_Shift_Ins | - | C | p.L174fs |
| STAD | TCGA-BR-4370-01 | exon_skip_42584 | 75673297 | 75673516 | 75673438 | 75673439 | Frame_Shift_Ins | - | G | p.R201fs |
| STAD | TCGA-BR-8487-01 | exon_skip_42584 | 75673297 | 75673516 | 75673438 | 75673439 | Frame_Shift_Ins | - | G | p.R201fs |
| STAD | TCGA-F1-6874-01 | exon_skip_42584 | 75673297 | 75673516 | 75673438 | 75673439 | Frame_Shift_Ins | - | G | p.R201fs |
| STAD | TCGA-HU-A4GN-01 | exon_skip_42584 | 75673297 | 75673516 | 75673438 | 75673439 | Frame_Shift_Ins | - | G | p.R201fs |
| KIRC | TCGA-CW-5587-01 | exon_skip_42584 | 75673297 | 75673516 | 75673335 | 75673335 | Nonsense_Mutation | C | T | p.Q167X |
| COAD | TCGA-AA-3510-01 | exon_skip_42584 | 75673297 | 75673516 | 75673383 | 75673383 | Nonsense_Mutation | G | T | p.E183X |
| READ | TCGA-AG-A002-01 | exon_skip_42584 | 75673297 | 75673516 | 75673383 | 75673383 | Nonsense_Mutation | G | T | p.E183X |
| UCEC | TCGA-BS-A0TC-01 | exon_skip_42584 | 75673297 | 75673516 | 75673383 | 75673383 | Nonsense_Mutation | G | T | p.E183* |
| - Depth of coverage in the three exons composing exon skipping event |
| Depth of coverage in three exons | Mutation description |
 | Sample: TCGA-AA-3510-01 |
| Cancer type: COAD | |
| ESID: exon_skip_42584 | |
| Skipped exon start: 75673297 | |
| Skipped exon end: 75673516 | |
| Mutation start: 75673383 | |
| Mutation end: 75673383 | |
| Mutation type: Nonsense_Mutation | |
| Reference seq: G | |
| Mutation seq: T | |
| AAchange: p.E183X | |
exon_skip_106511_COAD_TCGA-AA-3510-01.png | |
exon_skip_122982_COAD_TCGA-AA-3510-01.png | |
exon_skip_29723_COAD_TCGA-AA-3510-01.png | |
exon_skip_334330_COAD_TCGA-AA-3510-01.png | |
exon_skip_42584_COAD_TCGA-AA-3510-01.png | |
 | Sample: TCGA-LN-A7HV-01 |
| Cancer type: ESCA | |
| ESID: exon_skip_42584 | |
| Skipped exon start: 75673297 | |
| Skipped exon end: 75673516 | |
| Mutation start: 75673298 | |
| Mutation end: 75673298 | |
| Mutation type: Frame_Shift_Del | |
| Reference seq: A | |
| Mutation seq: - | |
| AAchange: p.K156fs | |
exon_skip_42584_ESCA_TCGA-LN-A7HV-01.png | |
 | Sample: TCGA-CG-5723-01 |
| Cancer type: STAD | |
| ESID: exon_skip_42584 | |
| Skipped exon start: 75673297 | |
| Skipped exon end: 75673516 | |
| Mutation start: 75673438 | |
| Mutation end: 75673438 | |
| Mutation type: Frame_Shift_Del | |
| Reference seq: G | |
| Mutation seq: - | |
| AAchange: p.R201fs | |
exon_skip_101055_STAD_TCGA-CG-5723-01.png | |
exon_skip_135181_STAD_TCGA-CG-5723-01.png | |
exon_skip_143805_STAD_TCGA-CG-5723-01.png | |
exon_skip_287270_STAD_TCGA-CG-5723-01.png | |
exon_skip_325884_STAD_TCGA-CG-5723-01.png | |
exon_skip_352908_STAD_TCGA-CG-5723-01.png | |
exon_skip_353222_STAD_TCGA-CG-5723-01.png | |
exon_skip_356108_STAD_TCGA-CG-5723-01.png | |
exon_skip_381180_STAD_TCGA-CG-5723-01.png | |
exon_skip_42584_STAD_TCGA-CG-5723-01.png | |
exon_skip_447822_STAD_TCGA-CG-5723-01.png | |
exon_skip_53674_STAD_TCGA-CG-5723-01.png | |
exon_skip_60290_STAD_TCGA-CG-5723-01.png | |
exon_skip_60294_STAD_TCGA-CG-5723-01.png | |
exon_skip_71774_STAD_TCGA-CG-5723-01.png | |
exon_skip_78894_STAD_TCGA-CG-5723-01.png | |
exon_skip_84515_STAD_TCGA-CG-5723-01.png | |
exon_skip_92488_STAD_TCGA-CG-5723-01.png | |
 | Sample: TCGA-BR-4370-01 |
| Cancer type: STAD | |
| ESID: exon_skip_42584 | |
| Skipped exon start: 75673297 | |
| Skipped exon end: 75673516 | |
| Mutation start: 75673438 | |
| Mutation end: 75673439 | |
| Mutation type: Frame_Shift_Ins | |
| Reference seq: - | |
| Mutation seq: G | |
| AAchange: p.R201fs | |
exon_skip_140730_STAD_TCGA-BR-4370-01.png | |
exon_skip_2974_STAD_TCGA-BR-4370-01.png | |
exon_skip_330351_STAD_TCGA-BR-4370-01.png | |
exon_skip_357567_STAD_TCGA-BR-4370-01.png | |
exon_skip_357575_STAD_TCGA-BR-4370-01.png | |
exon_skip_357579_STAD_TCGA-BR-4370-01.png | |
exon_skip_372669_STAD_TCGA-BR-4370-01.png | |
exon_skip_383154_STAD_TCGA-BR-4370-01.png | |
exon_skip_383156_STAD_TCGA-BR-4370-01.png | |
exon_skip_389202_STAD_TCGA-BR-4370-01.png | |
exon_skip_42584_STAD_TCGA-BR-4370-01.png | |
exon_skip_439047_STAD_TCGA-BR-4370-01.png | |
exon_skip_439048_STAD_TCGA-BR-4370-01.png | |
exon_skip_450406_STAD_TCGA-BR-4370-01.png | |
exon_skip_483956_STAD_TCGA-BR-4370-01.png | |
| - Non-synonymous mutations located in the skipped exons in CCLE. |
| Sample | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
Top |
Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for PLAU |
| sQTL information located at the skipped exons. |
| Exon skip ID | Chromosome | Three exons | Skippped exon | ENST | Cancer type | SNP id | Location | DNA change (ref/var) | P-value |
Top |
Splicing Quantitative Trait Methylation (sQTM) in the skipped exon for PLAU |
Top |
Survival analysis of Splicing Quantitative Trait Methylation (sQTM) in the skipped exon for PLAU |
Top |
RelatedDrugs for PLAU |
| Approved drugs targeting this gene. (DrugBank Version 5.1.0 2018-04-02) |
| Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
| P00749 | DB00594 | Amiloride | Urokinase-type plasminogen activator | small molecule | approved | |
| P00749 | DB00013 | Urokinase | Urokinase-type plasminogen activator | biotech | approved|investigational|withdrawn |
Top |
RelatedDiseases for PLAU |
| Diseases associated with this gene. (DisGeNet 4.0) |
| Gene | Disease ID | Disease name | # pubmeds | Source |
| PLAU | C0027051 | Myocardial Infarction | 6 | CTD_human |
| PLAU | C0034065 | Pulmonary Embolism | 6 | CTD_human |
| PLAU | C0040053 | Thrombosis | 6 | CTD_human |
| PLAU | C2937358 | Cerebral Hemorrhage | 5 | CTD_human |
| PLAU | C0003838 | Arterial Occlusive Diseases | 4 | CTD_human |
| PLAU | C0007786 | Brain Ischemia | 4 | CTD_human |
| PLAU | C0018128 | Graft Occlusion, Vascular | 4 | CTD_human |
| PLAU | C0019080 | Hemorrhage | 4 | CTD_human |
| PLAU | C0042487 | Venous Thrombosis | 4 | CTD_human |
| PLAU | C0151699 | Intracranial Hemorrhages | 4 | CTD_human |
| PLAU | C0007785 | Cerebral Infarction | 3 | CTD_human |
| PLAU | C0033578 | Prostatic Neoplasms | 3 | CTD_human |
| PLAU | C0740392 | Infarction, Middle Cerebral Artery | 3 | CTD_human |
| PLAU | C0007820 | Cerebrovascular Disorders | 2 | CTD_human |
| PLAU | C0010068 | Coronary heart disease | 2 | CTD_human |
| PLAU | C0022116 | Ischemia | 2 | CTD_human |
| PLAU | C0023890 | Liver Cirrhosis | 2 | CTD_human |
| PLAU | C0027626 | Neoplasm Invasiveness | 2 | CTD_human |
| PLAU | C0034152 | Henoch-Schoenlein Purpura | 2 | CTD_human |
| PLAU | C0001418 | Adenocarcinoma | 1 | CTD_human |
| PLAU | C0002962 | Angina Pectoris | 1 | CTD_human |
| PLAU | C0002965 | Angina, Unstable | 1 | CTD_human |
| PLAU | C0003460 | Anuria | 1 | CTD_human |
| PLAU | C0004096 | Asthma | 1 | CTD_human |
| PLAU | C0005967 | Bone neoplasms | 1 | CTD_human |
| PLAU | C0007138 | Carcinoma, Transitional Cell | 1 | CTD_human |
| PLAU | C0007273 | Carotid Artery Diseases | 1 | CTD_human |
| PLAU | C0007781 | Intracranial Embolism and Thrombosis | 1 | CTD_human |
| PLAU | C0017661 | IGA Glomerulonephritis | 1 | CTD_human |
| PLAU | C0018814 | Heart Rupture, Post-Infarction | 1 | CTD_human |
| PLAU | C0018965 | Hematuria | 1 | CTD_human |
| PLAU | C0020649 | Hypotension | 1 | CTD_human |
| PLAU | C0023893 | Liver Cirrhosis, Experimental | 1 | CTD_human |
| PLAU | C0027627 | Neoplasm Metastasis | 1 | CTD_human |
| PLAU | C0027643 | Neoplasm Recurrence, Local | 1 | CTD_human |
| PLAU | C0027697 | Nephritis | 1 | CTD_human |
| PLAU | C0030297 | Pancreatic Neoplasm | 1 | CTD_human |
| PLAU | C0035126 | Reperfusion Injury | 1 | CTD_human |
| PLAU | C0038356 | Stomach Neoplasms | 1 | CTD_human |
| PLAU | C0038454 | Cerebrovascular accident | 1 | CTD_human |
| PLAU | C0040038 | Thromboembolism | 1 | CTD_human |
| PLAU | C0042510 | Ventricular Fibrillation | 1 | CTD_human |
| PLAU | C0149649 | Cholesterol Embolism | 1 | CTD_human |
| PLAU | C0338575 | Sagittal Sinus Thrombosis | 1 | CTD_human |
| PLAU | C0403823 | Asthenozoospermia | 1 | CTD_human |
| PLAU | C1527311 | Brain Edema | 1 | CTD_human |
| PLAU | C1800706 | Idiopathic Pulmonary Fibrosis | 1 | CTD_human |
Copyright 2018-Present -The University of Texas Health Science Center at Houston (UTHealth)
|