ExonSkipDB: functional annotation of exon skipping event in human

Gene summary for USP25

Gene summary

Gene information	Gene symbol	USP25
	Gene ID	29761
	Gene name	ubiquitin specific peptidase 25
	Synonyms	USP21
	Cytomap	21q21.1
	Type of gene	protein-coding
	Description	ubiquitin carboxyl-terminal hydrolase 25USP on chromosome 21deubiquitinating enzyme 25ubiquitin thioesterase 25ubiquitin thiolesterase 25ubiquitin-specific processing protease 25
	Modification date	20180523
	UniProtAcc	Q9UHP3
	Context	PubMed: USP25 [Title/Abstract] AND exon [Title/Abstract] AND skip [Title/Abstract] - Title (PMID)

Gene ontology of each this gene with evidence of Inferred from Direct Assay (IDA) from Entrez

Gene	GO ID	GO term	PubMed ID
USP25	GO:0016579	protein deubiquitination	22590560

Top

Exon skipping events across known transcript of Ensembl for USP25 from UCSC genome browser

Skipped exons in TCGA and GTEx based on Ensembl gene isoform structure.
* Click on the image to open the UCSC genome browser with custom track showing this image in a new window.

Top

Gene isoform structures and expression levels for USP25

Expression levels of gene isoforms across TCGA.

Expression levels of gene isoforms across GTEx.

Top

Exon skipping events with PSIs in TCGA for USP25

Information of exkip skipping event in TCGA.

Exon skip ID	chr	Exons involved in exon skipping	Skipped exon	ENSG	ENSTs
exon_skip_358913	21	17102495:17102757:17135209:17135287:17138315:17138460	17135209:17135287	ENSG00000155313.11	ENST00000400183.2,ENST00000351097.5,ENST00000285681.2
exon_skip_358920	21	17138320:17138460:17150222:17150346:17163820:17163983	17150222:17150346	ENSG00000155313.11	ENST00000400183.2,ENST00000285679.6,ENST00000351097.5,ENST00000285681.2
exon_skip_358928	21	17163822:17163983:17172075:17172162:17177439:17177577	17172075:17172162	ENSG00000155313.11	ENST00000547201.1,ENST00000400183.2,ENST00000285679.6,ENST00000351097.5,ENST00000285681.2,ENST00000549362.1
exon_skip_358929	21	17177439:17177577:17181127:17181204:17183455:17183529	17181127:17181204	ENSG00000155313.11	ENST00000547201.1,ENST00000400183.2,ENST00000285679.6,ENST00000285681.2
exon_skip_358937	21	17191016:17191165:17196357:17196485:17197284:17197380	17196357:17196485	ENSG00000155313.11	ENST00000400183.2,ENST00000285679.6,ENST00000285681.2
exon_skip_358939	21	17197328:17197380:17198522:17198684:17199295:17199522	17198522:17198684	ENSG00000155313.11	ENST00000400183.2,ENST00000285679.6,ENST00000285681.2
exon_skip_358941	21	17199295:17199522:17202849:17202920:17203719:17203948	17202849:17202920	ENSG00000155313.11	ENST00000453553.1,ENST00000400183.2,ENST00000285679.6,ENST00000285681.2
exon_skip_358947	21	17203719:17203948:17205666:17205867:17214716:17214859	17205666:17205867	ENSG00000155313.11	ENST00000400183.2,ENST00000285679.6,ENST00000285681.2
exon_skip_358953	21	17205666:17205867:17214716:17214859:17236586:17236765	17214716:17214859	ENSG00000155313.11	ENST00000285679.6
exon_skip_358955	21	17214836:17214859:17219981:17220095:17222095:17222191	17219981:17220095	ENSG00000155313.11	ENST00000400183.2,ENST00000449491.1
exon_skip_358958	21	17214836:17214859:17222095:17222191:17236586:17236765	17222095:17222191	ENSG00000155313.11	ENST00000285681.2
exon_skip_358960	21	17214836:17214859:17236586:17236765:17238584:17238663	17236586:17236765	ENSG00000155313.11	ENST00000285679.6
exon_skip_358961	21	17219981:17220095:17222095:17222191:17236586:17236765	17222095:17222191	ENSG00000155313.11	ENST00000400183.2,ENST00000449491.1
exon_skip_358963	21	17242386:17242466:17246721:17246845:17250114:17250310	17246721:17246845	ENSG00000155313.11	ENST00000400183.2,ENST00000285679.6,ENST00000351097.5,ENST00000285681.2

PSI values of skipped exons in TCGA.

Top

Exon skipping events with PSIs in GTEx for USP25

Information of exkip skipping event in GTEx

Exon skip ID	chr	Exons involved in exon skipping	Skipped exon	ENSG	ENSTs
exon_skip_358913	21	17102495:17102757:17135209:17135287:17138315:17138460	17135209:17135287	ENSG00000155313.11	ENST00000351097.5,ENST00000285681.2,ENST00000400183.2
exon_skip_358920	21	17138320:17138460:17150222:17150346:17163820:17163983	17150222:17150346	ENSG00000155313.11	ENST00000285679.6,ENST00000351097.5,ENST00000285681.2,ENST00000400183.2
exon_skip_358928	21	17163822:17163983:17172075:17172162:17177439:17177577	17172075:17172162	ENSG00000155313.11	ENST00000285679.6,ENST00000351097.5,ENST00000285681.2,ENST00000400183.2,ENST00000547201.1,ENST00000549362.1
exon_skip_358929	21	17177439:17177577:17181127:17181204:17183455:17183529	17181127:17181204	ENSG00000155313.11	ENST00000285679.6,ENST00000285681.2,ENST00000400183.2,ENST00000547201.1
exon_skip_358937	21	17191016:17191165:17196357:17196485:17197284:17197380	17196357:17196485	ENSG00000155313.11	ENST00000285679.6,ENST00000285681.2,ENST00000400183.2
exon_skip_358939	21	17197328:17197380:17198522:17198684:17199295:17199522	17198522:17198684	ENSG00000155313.11	ENST00000285679.6,ENST00000285681.2,ENST00000400183.2
exon_skip_358941	21	17199295:17199522:17202849:17202920:17203719:17203948	17202849:17202920	ENSG00000155313.11	ENST00000285679.6,ENST00000285681.2,ENST00000400183.2,ENST00000453553.1
exon_skip_358947	21	17203719:17203948:17205666:17205867:17214716:17214859	17205666:17205867	ENSG00000155313.11	ENST00000285679.6,ENST00000285681.2,ENST00000400183.2
exon_skip_358953	21	17205666:17205867:17214716:17214859:17236586:17236765	17214716:17214859	ENSG00000155313.11	ENST00000285679.6
exon_skip_358955	21	17214836:17214859:17219981:17220095:17222095:17222191	17219981:17220095	ENSG00000155313.11	ENST00000400183.2,ENST00000449491.1
exon_skip_358958	21	17214836:17214859:17222095:17222191:17236586:17236765	17222095:17222191	ENSG00000155313.11	ENST00000285681.2
exon_skip_358960	21	17214836:17214859:17236586:17236765:17238584:17238663	17236586:17236765	ENSG00000155313.11	ENST00000285679.6
exon_skip_358961	21	17219981:17220095:17222095:17222191:17236586:17236765	17222095:17222191	ENSG00000155313.11	ENST00000400183.2,ENST00000449491.1
exon_skip_358963	21	17242386:17242466:17246721:17246845:17250114:17250310	17246721:17246845	ENSG00000155313.11	ENST00000285679.6,ENST00000351097.5,ENST00000285681.2,ENST00000400183.2

PSI values of skipped exons in GTEx.

* Skipped exon sequences.

Top

Open reading frame (ORF) annotation in the exon skipping event for USP25

Open reading frame (ORF) of individual exon skipping events in TCGA based on the Ensembl gene structure combined from isoforms.

ENST	Start of skipped exon	End of skipped exon	ORF
ENST00000285681	17150222	17150346	Frame-shift
ENST00000285681	17181127	17181204	Frame-shift
ENST00000285681	17196357	17196485	Frame-shift
ENST00000285681	17202849	17202920	Frame-shift
ENST00000285681	17246721	17246845	Frame-shift
ENST00000285681	17135209	17135287	In-frame
ENST00000285681	17172075	17172162	In-frame
ENST00000285681	17198522	17198684	In-frame
ENST00000285681	17205666	17205867	In-frame
ENST00000285681	17222095	17222191	In-frame

Open reading frame (ORF) of individual exon skipping events in GTEx based on the Ensembl gene structure combined from isoforms.

ENST	Start of skipped exon	End of skipped exon	ORF
ENST00000285681	17150222	17150346	Frame-shift
ENST00000285681	17181127	17181204	Frame-shift
ENST00000285681	17196357	17196485	Frame-shift
ENST00000285681	17202849	17202920	Frame-shift
ENST00000285681	17246721	17246845	Frame-shift
ENST00000285681	17135209	17135287	In-frame
ENST00000285681	17172075	17172162	In-frame
ENST00000285681	17198522	17198684	In-frame
ENST00000285681	17205666	17205867	In-frame
ENST00000285681	17222095	17222191	In-frame

Top

Infer the effects of exon skipping event on protein functional features for USP25

Exon skipping at the protein sequence level and followed lost functional features.
* Click on the image to enlarge it in a new window.

Loci of skipped exons in TCGA across genomic, transcript, and protein sequence levels of In-frame cases.

ENST	Length of mRNA	Length of AA seq.	Genomic start	Genomic end	mRNA start	mRNA end	AA start	AA end
ENST00000285681	5233	1055	17135209	17135287	415	492	15	41
ENST00000285681	5233	1055	17172075	17172162	925	1011	185	214
ENST00000285681	5233	1055	17198522	17198684	1674	1835	435	488
ENST00000285681	5233	1055	17205666	17205867	2363	2563	664	731
ENST00000285681	5233	1055	17222095	17222191	2707	2802	779	811

Loci of skipped exons in GTEx across genomic, transcript, and protein sequence levels of In-frame cases.

ENST	Length of mRNA	Length of AA seq.	Genomic start	Genomic end	mRNA start	mRNA end	AA start	AA end
ENST00000285681	5233	1055	17135209	17135287	415	492	15	41
ENST00000285681	5233	1055	17172075	17172162	925	1011	185	214
ENST00000285681	5233	1055	17198522	17198684	1674	1835	435	488
ENST00000285681	5233	1055	17205666	17205867	2363	2563	664	731
ENST00000285681	5233	1055	17222095	17222191	2707	2802	779	811

Lost protein functional features of individual exon skipping events in TCGA.

UniProt acc.	Start of exon skipping (AA)	End of exon skipping (AA)	Protein feature start (AA)	Protein feature end (AA)	Category of protein feature	Description of feature
Q9UHP3	15	41	1	1055	Chain	ID=PRO_0000080653;Note=Ubiquitin carboxyl-terminal hydrolase 25
Q9UHP3	15	41	14	57	Domain	Note=UBA-like
Q9UHP3	15	41	12	27	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:2MUX
Q9UHP3	15	41	33	43	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:2MUX
Q9UHP3	185	214	1	1055	Chain	ID=PRO_0000080653;Note=Ubiquitin carboxyl-terminal hydrolase 25
Q9UHP3	185	214	169	657	Domain	Note=USP
Q9UHP3	435	488	1	1055	Chain	ID=PRO_0000080653;Note=Ubiquitin carboxyl-terminal hydrolase 25
Q9UHP3	435	488	169	657	Domain	Note=USP
Q9UHP3	664	731	1	1055	Chain	ID=PRO_0000080653;Note=Ubiquitin carboxyl-terminal hydrolase 25
Q9UHP3	664	731	684	717	Coiled coil	Ontology_term=ECO:0000255;evidence=ECO:0000255
Q9UHP3	779	811	779	779	Alternative sequence	ID=VSP_039632;Note=In isoform USP25b. S->SIMMTPNMQGIIMAIGKSRSVYDRCGPEAGFFK;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:10644437;Dbxref=PMID:10644437
Q9UHP3	779	811	779	779	Alternative sequence	ID=VSP_039631;Note=In isoform USP25m. S->SKPENTTSQPLSNQRVVEVAIPHVGKFMIESKEGGYDDEIMMTPNMQGIIMAIGKSRSVYDRCGPEAGFFK;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.3
Q9UHP3	779	811	1	1055	Chain	ID=PRO_0000080653;Note=Ubiquitin carboxyl-terminal hydrolase 25

Lost protein functional features of individual exon skipping events in GTEx.

UniProt acc.	Start of exon skipping (AA)	End of exon skipping (AA)	Protein feature start (AA)	Protein feature end (AA)	Category of protein feature	Description of feature
Q9UHP3	15	41	1	1055	Chain	ID=PRO_0000080653;Note=Ubiquitin carboxyl-terminal hydrolase 25
Q9UHP3	15	41	14	57	Domain	Note=UBA-like
Q9UHP3	15	41	12	27	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:2MUX
Q9UHP3	15	41	33	43	Helix	Ontology_term=ECO:0000244;evidence=ECO:0000244\|PDB:2MUX
Q9UHP3	185	214	1	1055	Chain	ID=PRO_0000080653;Note=Ubiquitin carboxyl-terminal hydrolase 25
Q9UHP3	185	214	169	657	Domain	Note=USP
Q9UHP3	435	488	1	1055	Chain	ID=PRO_0000080653;Note=Ubiquitin carboxyl-terminal hydrolase 25
Q9UHP3	435	488	169	657	Domain	Note=USP
Q9UHP3	664	731	1	1055	Chain	ID=PRO_0000080653;Note=Ubiquitin carboxyl-terminal hydrolase 25
Q9UHP3	664	731	684	717	Coiled coil	Ontology_term=ECO:0000255;evidence=ECO:0000255
Q9UHP3	779	811	779	779	Alternative sequence	ID=VSP_039632;Note=In isoform USP25b. S->SIMMTPNMQGIIMAIGKSRSVYDRCGPEAGFFK;Ontology_term=ECO:0000303;evidence=ECO:0000303\|PubMed:10644437;Dbxref=PMID:10644437
Q9UHP3	779	811	779	779	Alternative sequence	ID=VSP_039631;Note=In isoform USP25m. S->SKPENTTSQPLSNQRVVEVAIPHVGKFMIESKEGGYDDEIMMTPNMQGIIMAIGKSRSVYDRCGPEAGFFK;Ontology_term=ECO:0000303;evidence=ECO:0000303\|Ref.3
Q9UHP3	779	811	1	1055	Chain	ID=PRO_0000080653;Note=Ubiquitin carboxyl-terminal hydrolase 25

Top

SNVs in the skipped exons for USP25

- Lollipop plot for presenting exon skipping associated SNVs.
* Click on the image to enlarge it in a new window.

- Differential PSIs between mutated versus non-mutated samples.

USP25_READ_exon_skip_358963_psi_boxplot.png
boxplot

- Non-synonymous mutations located in the skipped exons in TCGA.

Cancer type	Sample	ESID	Skipped exon start	Skipped exon end	Mutation start	Mutation end	Mutation type	Reference seq	Mutation seq	AAchange
LIHC	TCGA-BC-A3KG-01	exon_skip_358953	17214717	17214859	17214757	17214757	Frame_Shift_Del	A	-	p.S745fs
UCEC	TCGA-BS-A0UF-01	exon_skip_358913	17135210	17135287	17135240	17135240	Nonsense_Mutation	G	T	p.E26*
BLCA	TCGA-2F-A9KT-01	exon_skip_358920	17150223	17150346	17150261	17150261	Nonsense_Mutation	C	T	p.Q103*
DLBC	TCGA-GR-7353-01	exon_skip_358929	17181128	17181204	17181168	17181168	Nonsense_Mutation	T	G	p.L274X
LUAD	TCGA-50-5946-01	exon_skip_358937	17196358	17196485	17196427	17196427	Nonsense_Mutation	G	T	p.G384*
THYM	TCGA-XU-AAXX-01	exon_skip_358939	17198523	17198684	17198587	17198587	Nonsense_Mutation	G	T	p.E457X
COAD	TCGA-AD-6889-01	exon_skip_358947	17205667	17205867	17205756	17205756	Nonsense_Mutation	C	T	p.R695X
PAAD	TCGA-2J-AABT-01	exon_skip_358947	17205667	17205867	17205843	17205843	Nonsense_Mutation	G	T	p.E724*
LUAD	TCGA-17-Z026-01	exon_skip_358953	17214717	17214859	17214816	17214816	Nonsense_Mutation	C	G	p.S765*
LUSC	TCGA-60-2713-01	exon_skip_358953	17214717	17214859	17214842	17214842	Nonsense_Mutation	G	T	p.E774*
READ	TCGA-F5-6814-01	exon_skip_358963	17246722	17246845	17246810	17246810	Nonsense_Mutation	G	T	p.E922X

- Depth of coverage in the three exons composing exon skipping event

Depth of coverage in three exons	Mutation description
	Sample: TCGA-F5-6814-01
	Cancer type: READ
	ESID: exon_skip_358963
	Skipped exon start: 17246722
	Skipped exon end: 17246845
	Mutation start: 17246810
	Mutation end: 17246810
	Mutation type: Nonsense_Mutation
	Reference seq: G
	Mutation seq: T
	AAchange: p.E922X
exon_skip_104037_READ_TCGA-F5-6814-01.png
exon_skip_108731_READ_TCGA-F5-6814-01.png
exon_skip_111139_READ_TCGA-F5-6814-01.png
exon_skip_111141_READ_TCGA-F5-6814-01.png
exon_skip_134785_READ_TCGA-F5-6814-01.png
exon_skip_138676_READ_TCGA-F5-6814-01.png
exon_skip_141979_READ_TCGA-F5-6814-01.png
exon_skip_142361_READ_TCGA-F5-6814-01.png
exon_skip_142369_READ_TCGA-F5-6814-01.png
exon_skip_142374_READ_TCGA-F5-6814-01.png
exon_skip_145114_READ_TCGA-F5-6814-01.png
exon_skip_145115_READ_TCGA-F5-6814-01.png
exon_skip_153669_READ_TCGA-F5-6814-01.png
exon_skip_28270_READ_TCGA-F5-6814-01.png
exon_skip_290191_READ_TCGA-F5-6814-01.png
exon_skip_296525_READ_TCGA-F5-6814-01.png
exon_skip_358963_READ_TCGA-F5-6814-01.png
exon_skip_428765_READ_TCGA-F5-6814-01.png
exon_skip_43545_READ_TCGA-F5-6814-01.png
exon_skip_444150_READ_TCGA-F5-6814-01.png
exon_skip_479241_READ_TCGA-F5-6814-01.png
exon_skip_497224_READ_TCGA-F5-6814-01.png

- Non-synonymous mutations located in the skipped exons in CCLE.

Sample	Skipped exon start	Skipped exon end	Mutation start	Mutation end	Mutation type	Reference seq	Mutation seq	AAchange
BICR18_UPPER_AERODIGESTIVE_TRACT	17246722	17246845	17246788	17246789	Frame_Shift_Del	CT	-	p.L915fs
DBTRG05MG_CENTRAL_NERVOUS_SYSTEM	17236587	17236765	17236670	17236671	In_Frame_Ins	-	GTG	p.808_808V>VV
UMCHOR1_BONE	17135210	17135287	17135220	17135220	Missense_Mutation	C	A	p.T19K
HEC251_ENDOMETRIUM	17135210	17135287	17135256	17135256	Missense_Mutation	A	C	p.N31T
KYSE520_OESOPHAGUS	17135210	17135287	17135275	17135275	Missense_Mutation	G	T	p.Q37H
NCIH1651_LUNG	17150223	17150346	17150234	17150234	Missense_Mutation	C	T	p.L94F
HEC6_ENDOMETRIUM	17150223	17150346	17150288	17150288	Missense_Mutation	G	A	p.E112K
SUPHD1_HAEMATOPOIETIC_AND_LYMPHOID_TISSUE	17172076	17172162	17172148	17172148	Missense_Mutation	C	A	p.P210T
SNU81_LARGE_INTESTINE	17172076	17172162	17172152	17172152	Missense_Mutation	G	A	p.R211Q
SNU81_LARGE_INTESTINE	17181128	17181204	17181161	17181161	Missense_Mutation	G	T	p.D272Y
22RV1_PROSTATE	17181128	17181204	17181199	17181199	Missense_Mutation	G	T	p.E284D
DU145_PROSTATE	17196358	17196485	17196389	17196389	Missense_Mutation	C	T	p.T371I
JEKO1_HAEMATOPOIETIC_AND_LYMPHOID_TISSUE	17196358	17196485	17196464	17196464	Missense_Mutation	C	G	p.P396R
SKMEL1_SKIN	17198523	17198684	17198531	17198531	Missense_Mutation	G	C	p.S438T
HCC2450_LUNG	17198523	17198684	17198572	17198572	Missense_Mutation	C	T	p.L452F
CORL95_LUNG	17198523	17198684	17198576	17198576	Missense_Mutation	A	G	p.Q453R
PF382_HAEMATOPOIETIC_AND_LYMPHOID_TISSUE	17198523	17198684	17198615	17198615	Missense_Mutation	C	G	p.T466S
HT115_LARGE_INTESTINE	17202850	17202920	17202880	17202880	Missense_Mutation	G	A	p.R575Q
SNU1040_LARGE_INTESTINE	17202850	17202920	17202880	17202880	Missense_Mutation	G	A	p.R575Q
BCPAP_THYROID	17202850	17202920	17202894	17202894	Missense_Mutation	A	G	p.M580V
MZ1PC_PANCREAS	17205667	17205867	17205696	17205696	Missense_Mutation	C	T	p.L675F
KOSC2_UPPER_AERODIGESTIVE_TRACT	17205667	17205867	17205826	17205826	Missense_Mutation	C	T	p.A718V
NKL_HAEMATOPOIETIC_AND_LYMPHOID_TISSUE	17205667	17205867	17205862	17205862	Missense_Mutation	C	T	p.T730I
SW756_CERVIX	17214717	17214859	17214762	17214762	Missense_Mutation	G	A	p.S747N
SNU1040_LARGE_INTESTINE	17214717	17214859	17214822	17214822	Missense_Mutation	A	G	p.E767G
GAK_SKIN	17214717	17214859	17214840	17214840	Missense_Mutation	C	T	p.P773L
HN_UPPER_AERODIGESTIVE_TRACT	17214717	17214859	17214840	17214840	Missense_Mutation	C	T	p.P773L
RKO_LARGE_INTESTINE	17236587	17236765	17236737	17236737	Missense_Mutation	G	C	p.G830R
NCIH2291_LUNG	17246722	17246845	17246822	17246822	Missense_Mutation	C	T	p.H926Y
HEC251_ENDOMETRIUM	17135210	17135287	17135240	17135240	Nonsense_Mutation	G	T	p.E26*
SH4_SKIN	17196358	17196485	17196465	17196466	Nonsense_Mutation	CC	TT	p.Q397*
SNU81_LARGE_INTESTINE	17205667	17205867	17205681	17205681	Nonsense_Mutation	G	T	p.E670*
EVSAT_BREAST	17214717	17214859	17214827	17214827	Nonsense_Mutation	G	T	p.E769*
CP50EBV_MATCHED_NORMAL_TISSUE	17202850	17202920	17202920	17202920	Splice_Site	A	G	p.Q588Q
CP50MELB_SKIN	17202850	17202920	17202920	17202920	Splice_Site	A	G	p.Q588Q

Top

Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for USP25

sQTL information located at the skipped exons.

Exon skip ID

Chromosome

Three exons

Skippped exon

ENST

Cancer type

SNP id

Location

DNA change (ref/var)

P-value

Top

Splicing Quantitative Trait Methylation (sQTM) in the skipped exon for USP25

Top

Survival analysis of Splicing Quantitative Trait Methylation (sQTM) in the skipped exon for USP25

Top

RelatedDrugs for USP25

Approved drugs targeting this gene.
(DrugBank Version 5.1.0 2018-04-02)

Gene

UniProtAcc

DrugBank ID

Drug name

Drug activity

Drug type

Drug status

Top

RelatedDiseases for USP25

Diseases associated with this gene.
(DisGeNet 4.0)

Gene

Disease ID

Disease name

# pubmeds

Source

	Gene summary
	Gene structures and expression levels
	Exon skipping events with PSIs in TCGA
	Exon skipping events with PSIs in GTEx
	Open reading frame (ORF) annotation in the exon skipping event
	Exon skipping events in the canonical protein sequence
	SNVs in the skipped exons with depth of coverage
	Splicing Quantitative Trait Loci (sQTLs) in the skipped exons
	Splicing Quantitative Trait Methylation (sQTM) in the skipped exon
	Related drugs with this gene
	Related diseases with this gene

Home

Download

Statistics

Landscape

Help

Contact