|
||||||
|
 | |
| |
| |
| |
| Open reading frame (ORF) annotation in the exon skipping event |
| |
| |
| Splicing Quantitative Trait Loci (sQTLs) in the skipped exons |
| Splicing Quantitative Trait Methylation (sQTM) in the skipped exon |
| |
|
Gene summary for IL37 |
 Gene summary |
| Gene information | Gene symbol | IL37 | Gene ID | 27178 |
| Gene name | interleukin 37 | |
| Synonyms | FIL1|FIL1(ZETA)|FIL1Z|IL-1F7|IL-1H|IL-1H4|IL-1RP1|IL-37|IL1F7|IL1H4|IL1RP1 | |
| Cytomap | 2q14.1 | |
| Type of gene | protein-coding | |
| Description | interleukin-37FIL1 zetaIL-1 zetaIL-1F7b (IL-1H4, IL-1H, IL-1RP1)IL-1X proteinIL1F7 (canonical product IL-1F7b)interleukin 1 family member 7interleukin 1, zetainterleukin-1 homolog 4interleukin-1 superfamily zinterleukin-1-related proteininterle | |
| Modification date | 20180523 | |
| UniProtAcc | Q9NZH6 | |
| Context | PubMed: IL37 [Title/Abstract] AND exon [Title/Abstract] AND skip [Title/Abstract] - Title (PMID) |
| Gene ontology of each this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Gene | GO ID | GO term | PubMed ID |
Top |
Exon skipping events across known transcript of Ensembl for IL37 from UCSC genome browser |
| Skipped exons in TCGA and GTEx based on Ensembl gene isoform structure. * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Gene isoform structures and expression levels for IL37 |
| Expression levels of gene isoforms across TCGA. |
 |
| Expression levels of gene isoforms across GTEx. |
 |
Top |
Exon skipping events with PSIs in TCGA for IL37 |
| Information of exkip skipping event in TCGA. |
| Exon skip ID | chr | Exons involved in exon skipping | Skipped exon | ENSG | ENSTs |
| exon_skip_328858 | 2 | 113670547:113670671:113671368:113671431:113675211:113675354 | 113671368:113671431 | ENSG00000125571.5 | ENST00000353225.3 |
| exon_skip_328859 | 2 | 113670547:113670671:113674705:113674825:113675211:113675354 | 113674705:113674825 | ENSG00000125571.5 | ENST00000352179.3 |
| exon_skip_328861 | 2 | 113671368:113671431:113674705:113674825:113675211:113675354 | 113674705:113674825 | ENSG00000125571.5 | ENST00000263326.3 |
| PSI values of skipped exons in TCGA. |
 |
Top |
Exon skipping events with PSIs in GTEx for IL37 |
| Information of exkip skipping event in GTEx |
| Exon skip ID | chr | Exons involved in exon skipping | Skipped exon | ENSG | ENSTs |
| exon_skip_328858 | 2 | 113670547:113670671:113671368:113671431:113675211:113675354 | 113671368:113671431 | ENSG00000125571.5 | ENST00000353225.3 |
| exon_skip_328859 | 2 | 113670547:113670671:113674705:113674825:113675211:113675354 | 113674705:113674825 | ENSG00000125571.5 | ENST00000352179.3 |
| exon_skip_328861 | 2 | 113671368:113671431:113674705:113674825:113675211:113675354 | 113674705:113674825 | ENSG00000125571.5 | ENST00000263326.3 |
| PSI values of skipped exons in GTEx. |
 |
| * Skipped exon sequences. |
Top |
Open reading frame (ORF) annotation in the exon skipping event for IL37 |
| Open reading frame (ORF) of individual exon skipping events in TCGA based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000263326 | 113674705 | 113674825 | In-frame |
| Open reading frame (ORF) of individual exon skipping events in GTEx based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000263326 | 113674705 | 113674825 | In-frame |
Top |
Infer the effects of exon skipping event on protein functional features for IL37 |
| Exon skipping at the protein sequence level and followed lost functional features. * Click on the image to enlarge it in a new window. |
 |
| Loci of skipped exons in TCGA across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000263326 | 789 | 218 | 113674705 | 113674825 | 188 | 307 | 48 | 88 |
| Loci of skipped exons in GTEx across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000263326 | 789 | 218 | 113674705 | 113674825 | 188 | 307 | 48 | 88 |
| Lost protein functional features of individual exon skipping events in TCGA. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| Q9NZH6 | 48 | 88 | 1 | 49 | Alternative sequence | ID=VSP_002653;Note=In isoform A. MSFVGENSGVKMGSEDWEKDEPQCCLEDPAGSPLEPGPSLPTMNFVHTS->MSGCDRRETETKGKNSFKKRLRG;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:10625660;Dbxref=PMID:10625660 |
| Q9NZH6 | 48 | 88 | 28 | 88 | Alternative sequence | ID=VSP_002655;Note=In isoform E. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:11991723;Dbxref=PMID:11991723 |
| Q9NZH6 | 48 | 88 | 28 | 49 | Alternative sequence | ID=VSP_002654;Note=In isoform D. DPAGSPLEPGPSLPTMNFVHTS->G;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303|PubMed:11991723,ECO:0000303|PubMed:19054851;Dbxref=PMID:11991723,PMID:19054851 |
| Q9NZH6 | 48 | 88 | 49 | 89 | Alternative sequence | ID=VSP_002656;Note=In isoform C. SPKVKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPE->K;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:11145836;Dbxref=PMID:11145836 |
| Q9NZH6 | 48 | 88 | 58 | 73 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:5HN1 |
| Q9NZH6 | 48 | 88 | 76 | 81 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:5HN1 |
| Q9NZH6 | 48 | 88 | 46 | 218 | Chain | ID=PRO_0000015336;Note=Interleukin-37 |
| Q9NZH6 | 48 | 88 | 50 | 50 | Natural variant | ID=VAR_049574;Note=P->R;Dbxref=dbSNP:rs2708943 |
| Q9NZH6 | 48 | 88 | 54 | 54 | Natural variant | ID=VAR_049575;Note=N->S;Dbxref=dbSNP:rs2723183 |
| Lost protein functional features of individual exon skipping events in GTEx. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| Q9NZH6 | 48 | 88 | 1 | 49 | Alternative sequence | ID=VSP_002653;Note=In isoform A. MSFVGENSGVKMGSEDWEKDEPQCCLEDPAGSPLEPGPSLPTMNFVHTS->MSGCDRRETETKGKNSFKKRLRG;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:10625660;Dbxref=PMID:10625660 |
| Q9NZH6 | 48 | 88 | 28 | 88 | Alternative sequence | ID=VSP_002655;Note=In isoform E. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:11991723;Dbxref=PMID:11991723 |
| Q9NZH6 | 48 | 88 | 28 | 49 | Alternative sequence | ID=VSP_002654;Note=In isoform D. DPAGSPLEPGPSLPTMNFVHTS->G;Ontology_term=ECO:0000303,ECO:0000303;evidence=ECO:0000303|PubMed:11991723,ECO:0000303|PubMed:19054851;Dbxref=PMID:11991723,PMID:19054851 |
| Q9NZH6 | 48 | 88 | 49 | 89 | Alternative sequence | ID=VSP_002656;Note=In isoform C. SPKVKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPE->K;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:11145836;Dbxref=PMID:11145836 |
| Q9NZH6 | 48 | 88 | 58 | 73 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:5HN1 |
| Q9NZH6 | 48 | 88 | 76 | 81 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:5HN1 |
| Q9NZH6 | 48 | 88 | 46 | 218 | Chain | ID=PRO_0000015336;Note=Interleukin-37 |
| Q9NZH6 | 48 | 88 | 50 | 50 | Natural variant | ID=VAR_049574;Note=P->R;Dbxref=dbSNP:rs2708943 |
| Q9NZH6 | 48 | 88 | 54 | 54 | Natural variant | ID=VAR_049575;Note=N->S;Dbxref=dbSNP:rs2723183 |
Top |
SNVs in the skipped exons for IL37 |
| - Lollipop plot for presenting exon skipping associated SNVs. * Click on the image to enlarge it in a new window. |
 |
| - Differential PSIs between mutated versus non-mutated samples. |
| - Non-synonymous mutations located in the skipped exons in TCGA. |
| Cancer type | Sample | ESID | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
| STAD | TCGA-MX-A5UJ-01 | exon_skip_328858 | 113671369 | 113671431 | 113671382 | 113671382 | Frame_Shift_Del | C | - | p.S32fs |
| STAD | TCGA-BR-4280-01 | exon_skip_328858 | 113671369 | 113671431 | 113671381 | 113671382 | Frame_Shift_Ins | - | C | p.S32fs |
| KICH | TCGA-KL-8345-01 | exon_skip_328858 | 113671369 | 113671431 | 113671391 | 113671392 | Frame_Shift_Ins | - | C | p.E35fs |
| - Depth of coverage in the three exons composing exon skipping event |
| Depth of coverage in three exons | Mutation description |
| - Non-synonymous mutations located in the skipped exons in CCLE. |
| Sample | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
| CCK81_LARGE_INTESTINE | 113671369 | 113671431 | 113671375 | 113671375 | Missense_Mutation | C | T | p.A30V |
| R262_CENTRAL_NERVOUS_SYSTEM | 113671369 | 113671431 | 113671381 | 113671381 | Missense_Mutation | G | T | p.S32I |
| 2313287_STOMACH | 113671369 | 113671431 | 113671429 | 113671429 | Missense_Mutation | C | T | p.T48I |
| SNU1040_LARGE_INTESTINE | 113674706 | 113674825 | 113674715 | 113674715 | Missense_Mutation | T | C | p.V52A |
| HEC59_ENDOMETRIUM | 113674706 | 113674825 | 113674795 | 113674795 | Missense_Mutation | G | A | p.A79T |
| NCIH1793_LUNG | 113674706 | 113674825 | 113674823 | 113674823 | Missense_Mutation | C | A | p.P88Q |
Top |
Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for IL37 |
| sQTL information located at the skipped exons. |
| Exon skip ID | Chromosome | Three exons | Skippped exon | ENST | Cancer type | SNP id | Location | DNA change (ref/var) | P-value |
Top |
Splicing Quantitative Trait Methylation (sQTM) in the skipped exon for IL37 |
Top |
Survival analysis of Splicing Quantitative Trait Methylation (sQTM) in the skipped exon for IL37 |
Top |
RelatedDrugs for IL37 |
| Approved drugs targeting this gene. (DrugBank Version 5.1.0 2018-04-02) |
| Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
RelatedDiseases for IL37 |
| Diseases associated with this gene. (DisGeNet 4.0) |
| Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2018-Present -The University of Texas Health Science Center at Houston (UTHealth)
|