|
||||||
|
 | |
| |
| |
| |
| Open reading frame (ORF) annotation in the exon skipping event |
| |
| |
| Splicing Quantitative Trait Loci (sQTLs) in the skipped exons |
| Splicing Quantitative Trait Methylation (sQTM) in the skipped exon |
| |
|
Gene summary for FER |
 Gene summary |
| Gene information | Gene symbol | FER | Gene ID | 2241 |
| Gene name | FER tyrosine kinase | |
| Synonyms | PPP1R74|TYK3|p94-Fer | |
| Cytomap | 5q21.3 | |
| Type of gene | protein-coding | |
| Description | tyrosine-protein kinase Ferfeline encephalitis virus-related kinase FERfer (fps/fes related) tyrosine kinasefujinami poultry sarcoma/Feline sarcoma-related protein Ferphosphoprotein NCP94protein phosphatase 1, regulatory subunit 74proto-oncogene c-F | |
| Modification date | 20180523 | |
| UniProtAcc | P16591 | |
| Context | PubMed: FER [Title/Abstract] AND exon [Title/Abstract] AND skip [Title/Abstract] - Title (PMID) |
| Gene ontology of each this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Gene | GO ID | GO term | PubMed ID |
| FER | GO:0007260 | tyrosine phosphorylation of STAT protein | 19147545 |
| FER | GO:0010591 | regulation of lamellipodium assembly | 19738202 |
| FER | GO:0018108 | peptidyl-tyrosine phosphorylation | 12972546|19738202 |
| FER | GO:0046777 | protein autophosphorylation | 7623846 |
Top |
Exon skipping events across known transcript of Ensembl for FER from UCSC genome browser |
| Skipped exons in TCGA and GTEx based on Ensembl gene isoform structure. * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Gene isoform structures and expression levels for FER |
| Expression levels of gene isoforms across TCGA. |
 |
| Expression levels of gene isoforms across GTEx. |
 |
Top |
Exon skipping events with PSIs in TCGA for FER |
| Information of exkip skipping event in TCGA. |
| Exon skip ID | chr | Exons involved in exon skipping | Skipped exon | ENSG | ENSTs |
| exon_skip_436666 | 5 | 108084667:108084694:108103793:108103939:108133824:108134090 | 108103793:108103939 | ENSG00000151422.8 | ENST00000504143.2 |
| exon_skip_436672 | 5 | 108103793:108103939:108118363:108118456:108133824:108134090 | 108118363:108118456 | ENSG00000151422.8 | ENST00000502752.1 |
| exon_skip_436673 | 5 | 108103793:108103939:108133824:108134090:108168470:108168521 | 108133824:108134090 | ENSG00000151422.8 | ENST00000281092.4 |
| exon_skip_436676 | 5 | 108133824:108134090:108168470:108168644:108171408:108171508 | 108168470:108168644 | ENSG00000151422.8 | ENST00000502752.1,ENST00000536402.1,ENST00000281092.4 |
| exon_skip_436678 | 5 | 108203467:108203651:108207065:108207203:108207793:108207913 | 108207065:108207203 | ENSG00000151422.8 | ENST00000504143.2,ENST00000536402.1,ENST00000281092.4,ENST00000438717.2 |
| exon_skip_436680 | 5 | 108233359:108233549:108281830:108281923:108290429:108290568 | 108281830:108281923 | ENSG00000151422.8 | ENST00000504143.2,ENST00000281092.4,ENST00000438717.2 |
| exon_skip_436685 | 5 | 108281830:108281923:108290429:108290568:108294925:108295018 | 108290429:108290568 | ENSG00000151422.8 | ENST00000536402.1 |
| exon_skip_436686 | 5 | 108281830:108281923:108290429:108290633:108294925:108295018 | 108290429:108290633 | ENSG00000151422.8 | ENST00000505323.1,ENST00000504143.2,ENST00000281092.4,ENST00000438717.2 |
| exon_skip_436687 | 5 | 108382804:108382899:108436096:108436220:108516447:108516602 | 108436096:108436220 | ENSG00000151422.8 | ENST00000504143.2,ENST00000281092.4,ENST00000438717.2 |
| PSI values of skipped exons in TCGA. |
 |
Top |
Exon skipping events with PSIs in GTEx for FER |
| Information of exkip skipping event in GTEx |
| Exon skip ID | chr | Exons involved in exon skipping | Skipped exon | ENSG | ENSTs |
| exon_skip_436665 | 5 | 108084667:108084694:108103793:108103939:108118363:108118456 | 108103793:108103939 | ENSG00000151422.8 | ENST00000502752.1 |
| exon_skip_436666 | 5 | 108084667:108084694:108103793:108103939:108133824:108134090 | 108103793:108103939 | ENSG00000151422.8 | ENST00000504143.2 |
| exon_skip_436672 | 5 | 108103793:108103939:108118363:108118456:108133824:108134090 | 108118363:108118456 | ENSG00000151422.8 | ENST00000502752.1 |
| exon_skip_436673 | 5 | 108103793:108103939:108133824:108134090:108168470:108168521 | 108133824:108134090 | ENSG00000151422.8 | ENST00000281092.4 |
| exon_skip_436676 | 5 | 108133824:108134090:108168470:108168644:108171408:108171508 | 108168470:108168644 | ENSG00000151422.8 | ENST00000281092.4,ENST00000536402.1,ENST00000502752.1 |
| exon_skip_436678 | 5 | 108203467:108203651:108207065:108207203:108207793:108207913 | 108207065:108207203 | ENSG00000151422.8 | ENST00000281092.4,ENST00000536402.1,ENST00000504143.2,ENST00000438717.2 |
| exon_skip_436685 | 5 | 108281830:108281923:108290429:108290568:108294925:108295018 | 108290429:108290568 | ENSG00000151422.8 | ENST00000536402.1 |
| exon_skip_436686 | 5 | 108281830:108281923:108290429:108290633:108294925:108295018 | 108290429:108290633 | ENSG00000151422.8 | ENST00000281092.4,ENST00000504143.2,ENST00000438717.2,ENST00000505323.1 |
| exon_skip_436687 | 5 | 108382804:108382899:108436096:108436220:108516447:108516602 | 108436096:108436220 | ENSG00000151422.8 | ENST00000281092.4,ENST00000504143.2,ENST00000438717.2 |
| PSI values of skipped exons in GTEx. |
 |
| * Skipped exon sequences. |
Top |
Open reading frame (ORF) annotation in the exon skipping event for FER |
| Open reading frame (ORF) of individual exon skipping events in TCGA based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000281092 | 108133824 | 108134090 | 5CDS-5UTR |
| ENST00000281092 | 108436096 | 108436220 | Frame-shift |
| ENST00000281092 | 108168470 | 108168644 | In-frame |
| ENST00000281092 | 108207065 | 108207203 | In-frame |
| ENST00000281092 | 108281830 | 108281923 | In-frame |
| ENST00000281092 | 108290429 | 108290633 | In-frame |
| Open reading frame (ORF) of individual exon skipping events in GTEx based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000281092 | 108133824 | 108134090 | 5CDS-5UTR |
| ENST00000281092 | 108436096 | 108436220 | Frame-shift |
| ENST00000281092 | 108168470 | 108168644 | In-frame |
| ENST00000281092 | 108207065 | 108207203 | In-frame |
| ENST00000281092 | 108290429 | 108290633 | In-frame |
Top |
Infer the effects of exon skipping event on protein functional features for FER |
| Exon skipping at the protein sequence level and followed lost functional features. * Click on the image to enlarge it in a new window. |
 |
| Loci of skipped exons in TCGA across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000281092 | 12136 | 822 | 108168470 | 108168644 | 592 | 765 | 69 | 127 |
| ENST00000281092 | 12136 | 822 | 108207065 | 108207203 | 1050 | 1187 | 222 | 267 |
| ENST00000281092 | 12136 | 822 | 108281830 | 108281923 | 1621 | 1713 | 412 | 443 |
| ENST00000281092 | 12136 | 822 | 108290429 | 108290633 | 1714 | 1917 | 443 | 511 |
| Loci of skipped exons in GTEx across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000281092 | 12136 | 822 | 108168470 | 108168644 | 592 | 765 | 69 | 127 |
| ENST00000281092 | 12136 | 822 | 108207065 | 108207203 | 1050 | 1187 | 222 | 267 |
| ENST00000281092 | 12136 | 822 | 108290429 | 108290633 | 1714 | 1917 | 443 | 511 |
| Lost protein functional features of individual exon skipping events in TCGA. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| P16591 | 69 | 127 | 1 | 369 | Alternative sequence | ID=VSP_043846;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:22223638;Dbxref=PMID:22223638 |
| P16591 | 69 | 127 | 1 | 175 | Alternative sequence | ID=VSP_041765;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| P16591 | 69 | 127 | 1 | 822 | Chain | ID=PRO_0000088084;Note=Tyrosine-protein kinase Fer |
| P16591 | 69 | 127 | 123 | 185 | Coiled coil | Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| P16591 | 69 | 127 | 1 | 259 | Domain | Note=F-BAR;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU01077 |
| P16591 | 69 | 127 | 1 | 300 | Region | Note=Important for interaction with membranes containing phosphoinositides |
| P16591 | 222 | 267 | 1 | 369 | Alternative sequence | ID=VSP_043846;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:22223638;Dbxref=PMID:22223638 |
| P16591 | 222 | 267 | 1 | 822 | Chain | ID=PRO_0000088084;Note=Tyrosine-protein kinase Fer |
| P16591 | 222 | 267 | 1 | 259 | Domain | Note=F-BAR;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU01077 |
| P16591 | 222 | 267 | 1 | 300 | Region | Note=Important for interaction with membranes containing phosphoinositides |
| P16591 | 222 | 267 | 234 | 234 | Sequence conflict | Note=S->N;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
| P16591 | 412 | 443 | 370 | 412 | Alternative sequence | ID=VSP_043847;Note=In isoform 3. LRCTEAKFSAQKELLEQKVQENDGKEPPPVVNYEEDARSVTSM->MEQKMKCPHCKDQLESGFGSQSCKTCALMFSSEPSTSEVHRDQ;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:22223638;Dbxref=PMID:22223638 |
| P16591 | 412 | 443 | 1 | 822 | Chain | ID=PRO_0000088084;Note=Tyrosine-protein kinase Fer |
| P16591 | 412 | 443 | 434 | 434 | Modified residue | Note=Phosphoserine;Ontology_term=ECO:0000244,ECO:0000244,ECO:0000244;evidence=ECO:0000244|PubMed:18691976,ECO:0000244|PubMed:19369195,ECO:0000244|PubMed:23186163;Dbxref=PMID:18691976,PMID:19369195,PMID:23186163 |
| P16591 | 412 | 443 | 412 | 412 | Natural variant | ID=VAR_041693;Note=M->V;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:17344846;Dbxref=dbSNP:rs33940843,PMID:17344846 |
| P16591 | 412 | 443 | 439 | 439 | Natural variant | ID=VAR_006282;Note=L->V;Ontology_term=ECO:0000269,ECO:0000269,ECO:0000269;evidence=ECO:0000269|PubMed:1651563,ECO:0000269|PubMed:17344846,ECO:0000269|PubMed:2725517;Dbxref=dbSNP:rs2229086,PMID:1651563,PMID:17344846,PMID:2725517 |
| P16591 | 412 | 443 | 443 | 443 | Natural variant | ID=VAR_041694;Note=A->P;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:17344846;Dbxref=dbSNP:rs34259824,PMID:17344846 |
| P16591 | 412 | 443 | 426 | 426 | Sequence conflict | Note=H->Q;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
| P16591 | 443 | 511 | 461 | 464 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2KK6 |
| P16591 | 443 | 511 | 480 | 484 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2KK6 |
| P16591 | 443 | 511 | 492 | 498 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2KK6 |
| P16591 | 443 | 511 | 501 | 510 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2KK6 |
| P16591 | 443 | 511 | 1 | 822 | Chain | ID=PRO_0000088084;Note=Tyrosine-protein kinase Fer |
| P16591 | 443 | 511 | 460 | 550 | Domain | Note=SH2;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00191 |
| P16591 | 443 | 511 | 467 | 472 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2KK6 |
| P16591 | 443 | 511 | 483 | 483 | Mutagenesis | Note=Abolishes kinase activity. Abolishes location at microtubules. R->Q;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:12972546;Dbxref=PMID:12972546 |
| P16591 | 443 | 511 | 443 | 443 | Natural variant | ID=VAR_041694;Note=A->P;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:17344846;Dbxref=dbSNP:rs34259824,PMID:17344846 |
| P16591 | 443 | 511 | 460 | 460 | Natural variant | ID=VAR_041695;Note=In a lung small cell carcinoma sample%3B somatic mutation. W->C;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:17344846;Dbxref=PMID:17344846 |
| P16591 | 443 | 511 | 507 | 507 | Natural variant | ID=VAR_051695;Note=I->T;Dbxref=dbSNP:rs34204308 |
| P16591 | 443 | 511 | 447 | 447 | Sequence conflict | Note=M->L;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
| P16591 | 443 | 511 | 485 | 485 | Sequence conflict | Note=S->G;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
| P16591 | 443 | 511 | 492 | 492 | Sequence conflict | Note=Y->H;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
| P16591 | 443 | 511 | 505 | 505 | Sequence conflict | Note=F->L;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
| P16591 | 443 | 511 | 455 | 457 | Turn | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2KK6 |
| Lost protein functional features of individual exon skipping events in GTEx. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| P16591 | 69 | 127 | 1 | 369 | Alternative sequence | ID=VSP_043846;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:22223638;Dbxref=PMID:22223638 |
| P16591 | 69 | 127 | 1 | 175 | Alternative sequence | ID=VSP_041765;Note=In isoform 2. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:14702039;Dbxref=PMID:14702039 |
| P16591 | 69 | 127 | 1 | 822 | Chain | ID=PRO_0000088084;Note=Tyrosine-protein kinase Fer |
| P16591 | 69 | 127 | 123 | 185 | Coiled coil | Ontology_term=ECO:0000255;evidence=ECO:0000255 |
| P16591 | 69 | 127 | 1 | 259 | Domain | Note=F-BAR;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU01077 |
| P16591 | 69 | 127 | 1 | 300 | Region | Note=Important for interaction with membranes containing phosphoinositides |
| P16591 | 222 | 267 | 1 | 369 | Alternative sequence | ID=VSP_043846;Note=In isoform 3. Missing;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:22223638;Dbxref=PMID:22223638 |
| P16591 | 222 | 267 | 1 | 822 | Chain | ID=PRO_0000088084;Note=Tyrosine-protein kinase Fer |
| P16591 | 222 | 267 | 1 | 259 | Domain | Note=F-BAR;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU01077 |
| P16591 | 222 | 267 | 1 | 300 | Region | Note=Important for interaction with membranes containing phosphoinositides |
| P16591 | 222 | 267 | 234 | 234 | Sequence conflict | Note=S->N;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
| P16591 | 443 | 511 | 461 | 464 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2KK6 |
| P16591 | 443 | 511 | 480 | 484 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2KK6 |
| P16591 | 443 | 511 | 492 | 498 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2KK6 |
| P16591 | 443 | 511 | 501 | 510 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2KK6 |
| P16591 | 443 | 511 | 1 | 822 | Chain | ID=PRO_0000088084;Note=Tyrosine-protein kinase Fer |
| P16591 | 443 | 511 | 460 | 550 | Domain | Note=SH2;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00191 |
| P16591 | 443 | 511 | 467 | 472 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2KK6 |
| P16591 | 443 | 511 | 483 | 483 | Mutagenesis | Note=Abolishes kinase activity. Abolishes location at microtubules. R->Q;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:12972546;Dbxref=PMID:12972546 |
| P16591 | 443 | 511 | 443 | 443 | Natural variant | ID=VAR_041694;Note=A->P;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:17344846;Dbxref=dbSNP:rs34259824,PMID:17344846 |
| P16591 | 443 | 511 | 460 | 460 | Natural variant | ID=VAR_041695;Note=In a lung small cell carcinoma sample%3B somatic mutation. W->C;Ontology_term=ECO:0000269;evidence=ECO:0000269|PubMed:17344846;Dbxref=PMID:17344846 |
| P16591 | 443 | 511 | 507 | 507 | Natural variant | ID=VAR_051695;Note=I->T;Dbxref=dbSNP:rs34204308 |
| P16591 | 443 | 511 | 447 | 447 | Sequence conflict | Note=M->L;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
| P16591 | 443 | 511 | 485 | 485 | Sequence conflict | Note=S->G;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
| P16591 | 443 | 511 | 492 | 492 | Sequence conflict | Note=Y->H;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
| P16591 | 443 | 511 | 505 | 505 | Sequence conflict | Note=F->L;Ontology_term=ECO:0000305;evidence=ECO:0000305 |
| P16591 | 443 | 511 | 455 | 457 | Turn | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2KK6 |
Top |
SNVs in the skipped exons for FER |
| - Lollipop plot for presenting exon skipping associated SNVs. * Click on the image to enlarge it in a new window. |
 |
| - Differential PSIs between mutated versus non-mutated samples. |
| - Non-synonymous mutations located in the skipped exons in TCGA. |
| Cancer type | Sample | ESID | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
| COAD | TCGA-CK-5916-01 | exon_skip_436680 | 108281831 | 108281923 | 108281887 | 108281887 | Frame_Shift_Del | A | - | p.I431fs |
| LIHC | TCGA-DD-A39Y-01 | exon_skip_436685 | 108290430 | 108290568 | 108290522 | 108290522 | Frame_Shift_Del | A | - | p.L474fs |
| LIHC | TCGA-DD-A39Y-01 | exon_skip_436686 | 108290430 | 108290633 | 108290522 | 108290522 | Frame_Shift_Del | A | - | p.L474fs |
| STAD | TCGA-HF-7132-01 | exon_skip_436685 | 108290430 | 108290568 | 108290522 | 108290522 | Frame_Shift_Del | A | - | p.L474fs |
| STAD | TCGA-HF-7132-01 | exon_skip_436685 | 108290430 | 108290568 | 108290522 | 108290522 | Frame_Shift_Del | A | - | p.L474X |
| STAD | TCGA-HF-7132-01 | exon_skip_436686 | 108290430 | 108290633 | 108290522 | 108290522 | Frame_Shift_Del | A | - | p.L474fs |
| STAD | TCGA-HF-7132-01 | exon_skip_436686 | 108290430 | 108290633 | 108290522 | 108290522 | Frame_Shift_Del | A | - | p.L474X |
| STAD | TCGA-HU-A4GQ-01 | exon_skip_436685 | 108290430 | 108290568 | 108290522 | 108290522 | Frame_Shift_Del | A | - | p.L474fs |
| STAD | TCGA-HU-A4GQ-01 | exon_skip_436685 | 108290430 | 108290568 | 108290522 | 108290522 | Frame_Shift_Del | A | - | p.L474X |
| STAD | TCGA-HU-A4GQ-01 | exon_skip_436686 | 108290430 | 108290633 | 108290522 | 108290522 | Frame_Shift_Del | A | - | p.L474fs |
| STAD | TCGA-HU-A4GQ-01 | exon_skip_436686 | 108290430 | 108290633 | 108290522 | 108290522 | Frame_Shift_Del | A | - | p.L474X |
| STAD | TCGA-HU-A4GT-01 | exon_skip_436685 | 108290430 | 108290568 | 108290522 | 108290522 | Frame_Shift_Del | A | - | p.L474fs |
| STAD | TCGA-HU-A4GT-01 | exon_skip_436685 | 108290430 | 108290568 | 108290522 | 108290522 | Frame_Shift_Del | A | - | p.L474X |
| STAD | TCGA-HU-A4GT-01 | exon_skip_436686 | 108290430 | 108290633 | 108290522 | 108290522 | Frame_Shift_Del | A | - | p.L474fs |
| STAD | TCGA-HU-A4GT-01 | exon_skip_436686 | 108290430 | 108290633 | 108290522 | 108290522 | Frame_Shift_Del | A | - | p.L474X |
| UCEC | TCGA-B5-A0K9-01 | exon_skip_436685 | 108290430 | 108290568 | 108290522 | 108290522 | Frame_Shift_Del | A | - | p.L474fs |
| UCEC | TCGA-B5-A0K9-01 | exon_skip_436686 | 108290430 | 108290633 | 108290522 | 108290522 | Frame_Shift_Del | A | - | p.L474fs |
| LIHC | TCGA-DD-A39Y-01 | exon_skip_436685 | 108290430 | 108290568 | 108290538 | 108290538 | Frame_Shift_Del | T | - | p.F480fs |
| LIHC | TCGA-DD-A39Y-01 | exon_skip_436686 | 108290430 | 108290633 | 108290538 | 108290538 | Frame_Shift_Del | T | - | p.F480fs |
| LIHC | TCGA-G3-A3CJ-01 | exon_skip_436685 | 108290430 | 108290568 | 108290538 | 108290538 | Frame_Shift_Del | T | - | p.F480fs |
| LIHC | TCGA-G3-A3CJ-01 | exon_skip_436686 | 108290430 | 108290633 | 108290538 | 108290538 | Frame_Shift_Del | T | - | p.F480fs |
| LIHC | TCGA-BC-A112-01 | exon_skip_436685 | 108290430 | 108290568 | 108290521 | 108290522 | Frame_Shift_Ins | - | A | p.*474fs |
| LIHC | TCGA-BC-A112-01 | exon_skip_436686 | 108290430 | 108290633 | 108290521 | 108290522 | Frame_Shift_Ins | - | A | p.*474fs |
| READ | TCGA-EI-6884-01 | exon_skip_436685 | 108290430 | 108290568 | 108290521 | 108290522 | Frame_Shift_Ins | - | A | p.L474fs |
| READ | TCGA-EI-6884-01 | exon_skip_436686 | 108290430 | 108290633 | 108290521 | 108290522 | Frame_Shift_Ins | - | A | p.L474fs |
| LUAD | TCGA-86-6851-01 | exon_skip_436673 | 108133825 | 108134090 | 108134001 | 108134001 | Nonsense_Mutation | A | T | p.K40* |
| STAD | TCGA-BR-8077-01 | exon_skip_436673 | 108133825 | 108134090 | 108134020 | 108134020 | Nonsense_Mutation | T | A | p.L46* |
| STAD | TCGA-BR-8077-01 | exon_skip_436673 | 108133825 | 108134090 | 108134020 | 108134020 | Nonsense_Mutation | T | A | p.L46X |
| LUAD | TCGA-17-Z056-01 | exon_skip_436673 | 108133825 | 108134090 | 108134022 | 108134022 | Nonsense_Mutation | C | T | p.Q47* |
| STAD | TCGA-CD-A4MJ-01 | exon_skip_436676 | 108168471 | 108168644 | 108168618 | 108168618 | Nonsense_Mutation | C | T | p.Q119* |
| BLCA | TCGA-ZF-AA4V-01 | exon_skip_436680 | 108281831 | 108281923 | 108281874 | 108281874 | Nonsense_Mutation | C | T | p.Q323* |
| LUAD | TCGA-17-Z031-01 | exon_skip_436685 | 108290430 | 108290568 | 108290505 | 108290505 | Nonsense_Mutation | G | T | p.E469* |
| LUAD | TCGA-17-Z031-01 | exon_skip_436686 | 108290430 | 108290633 | 108290505 | 108290505 | Nonsense_Mutation | G | T | p.E469* |
| COAD | TCGA-D5-6930-01 | exon_skip_436685 | 108290430 | 108290568 | 108290522 | 108290522 | Nonsense_Mutation | A | - | p.L474X |
| COAD | TCGA-D5-6930-01 | exon_skip_436686 | 108290430 | 108290633 | 108290522 | 108290522 | Nonsense_Mutation | A | - | p.L474X |
| BLCA | TCGA-G2-A2EC-01 | exon_skip_436686 | 108290430 | 108290633 | 108290634 | 108290634 | Splice_Site | G | A | p.D511_splice |
| PAAD | TCGA-IB-7651-01 | exon_skip_436686 | 108290430 | 108290633 | 108290635 | 108290635 | Splice_Site | T | C | . |
| - Depth of coverage in the three exons composing exon skipping event |
| Depth of coverage in three exons | Mutation description |
| - Non-synonymous mutations located in the skipped exons in CCLE. |
| Sample | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
| DV90_LUNG | 108290430 | 108290633 | 108290522 | 108290522 | Frame_Shift_Del | A | - | p.L474fs |
| DV90_LUNG | 108290430 | 108290568 | 108290522 | 108290522 | Frame_Shift_Del | A | - | p.L474fs |
| CCK81_LARGE_INTESTINE | 108290430 | 108290633 | 108290522 | 108290522 | Frame_Shift_Del | A | - | p.L474fs |
| CCK81_LARGE_INTESTINE | 108290430 | 108290568 | 108290522 | 108290522 | Frame_Shift_Del | A | - | p.L474fs |
| LOVO_LARGE_INTESTINE | 108290430 | 108290633 | 108290522 | 108290522 | Frame_Shift_Del | A | - | p.L474fs |
| LOVO_LARGE_INTESTINE | 108290430 | 108290568 | 108290522 | 108290522 | Frame_Shift_Del | A | - | p.L474fs |
| LS180_LARGE_INTESTINE | 108290430 | 108290633 | 108290522 | 108290522 | Frame_Shift_Del | A | - | p.L474fs |
| LS180_LARGE_INTESTINE | 108290430 | 108290568 | 108290522 | 108290522 | Frame_Shift_Del | A | - | p.L474fs |
| SNU1_STOMACH | 108436097 | 108436220 | 108436204 | 108436204 | Frame_Shift_Del | A | - | p.K678fs |
| PACADD137_PANCREAS | 108133825 | 108134090 | 108133897 | 108133897 | Missense_Mutation | G | A | p.S5N |
| AGS_STOMACH | 108133825 | 108134090 | 108134052 | 108134052 | Missense_Mutation | A | G | p.S57G |
| NCIH2023_LUNG | 108133825 | 108134090 | 108134071 | 108134071 | Missense_Mutation | A | T | p.Y63F |
| SNU81_LARGE_INTESTINE | 108168471 | 108168644 | 108168547 | 108168547 | Missense_Mutation | G | A | p.G95E |
| RMUGS_OVARY | 108168471 | 108168644 | 108168634 | 108168634 | Missense_Mutation | A | C | p.E124A |
| HCT15_LARGE_INTESTINE | 108207066 | 108207203 | 108207119 | 108207119 | Missense_Mutation | T | C | p.I240T |
| HRT18_LARGE_INTESTINE | 108207066 | 108207203 | 108207119 | 108207119 | Missense_Mutation | T | C | p.I240T |
| LB647SCLC_LUNG | 108290430 | 108290633 | 108290480 | 108290480 | Missense_Mutation | G | T | p.W460C |
| LB647SCLC_LUNG | 108290430 | 108290568 | 108290480 | 108290480 | Missense_Mutation | G | T | p.W460C |
| OCUBM_BREAST | 108290430 | 108290633 | 108290569 | 108290569 | Missense_Mutation | G | C | p.G490A |
| OCUBM_BREAST | 108290430 | 108290568 | 108290569 | 108290569 | Missense_Mutation | G | C | p.G490A |
| 647V_URINARY_TRACT | 108436097 | 108436220 | 108436143 | 108436143 | Missense_Mutation | A | T | p.K657N |
| JHUEM7_ENDOMETRIUM | 108436097 | 108436220 | 108436168 | 108436168 | Missense_Mutation | T | G | p.L666V |
| HEC1A_ENDOMETRIUM | 108436097 | 108436220 | 108436211 | 108436211 | Missense_Mutation | G | A | p.C680Y |
| C4I_CERVIX | 108168471 | 108168644 | 108168472 | 108168472 | Splice_Site | C | T | p.S70F |
| CS1_BONE | 108168471 | 108168644 | 108168472 | 108168472 | Splice_Site | C | T | p.S70F |
| NCIH1304_LUNG | 108168471 | 108168644 | 108168472 | 108168472 | Splice_Site | C | T | p.S70F |
| NCIH1563_LUNG | 108168471 | 108168644 | 108168472 | 108168472 | Splice_Site | C | T | p.S70F |
| NCIH2135_LUNG | 108168471 | 108168644 | 108168472 | 108168472 | Splice_Site | C | T | p.S70F |
| SUDHL5_HAEMATOPOIETIC_AND_LYMPHOID_TISSUE | 108168471 | 108168644 | 108168472 | 108168472 | Splice_Site | C | T | p.S70F |
Top |
Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for FER |
| sQTL information located at the skipped exons. |
| Exon skip ID | Chromosome | Three exons | Skippped exon | ENST | Cancer type | SNP id | Location | DNA change (ref/var) | P-value |
Top |
Splicing Quantitative Trait Methylation (sQTM) in the skipped exon for FER |
Top |
Survival analysis of Splicing Quantitative Trait Methylation (sQTM) in the skipped exon for FER |
Top |
RelatedDrugs for FER |
| Approved drugs targeting this gene. (DrugBank Version 5.1.0 2018-04-02) |
| Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
| P16591 | DB12010 | Fostamatinib | Tyrosine-protein kinase Fer | small molecule | approved|investigational |
Top |
RelatedDiseases for FER |
| Diseases associated with this gene. (DisGeNet 4.0) |
| Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2018-Present -The University of Texas Health Science Center at Houston (UTHealth)
|