|
||||||
|
 | |
| |
| |
| |
| Open reading frame (ORF) annotation in the exon skipping event |
| |
| |
| Splicing Quantitative Trait Loci (sQTLs) in the skipped exons |
| Splicing Quantitative Trait Methylation (sQTM) in the skipped exon |
| |
|
Gene summary for DNAJC24 |
 Gene summary |
| Gene information | Gene symbol | DNAJC24 | Gene ID | 120526 |
| Gene name | DnaJ heat shock protein family (Hsp40) member C24 | |
| Synonyms | DPH4|JJJ3|ZCSL3 | |
| Cytomap | 11p13 | |
| Type of gene | protein-coding | |
| Description | dnaJ homolog subfamily C member 241700030A21RikCSL-type zinc finger-containing protein 3DPH4 homolog (JJJ3, S. cerevisiae)DPH4, JJJ3 homologDnaJ (Hsp40) homolog, subfamily C, member 24diphthamide biosynthesis protein 4zinc finger, CSL domain contai | |
| Modification date | 20180523 | |
| UniProtAcc | Q6P3W2 | |
| Context | PubMed: DNAJC24 [Title/Abstract] AND exon [Title/Abstract] AND skip [Title/Abstract] - Title (PMID) |
| Gene ontology of each this gene with evidence of Inferred from Direct Assay (IDA) from Entrez |
| Gene | GO ID | GO term | PubMed ID |
| DNAJC24 | GO:0032781 | positive regulation of ATPase activity | 22367199 |
Top |
Exon skipping events across known transcript of Ensembl for DNAJC24 from UCSC genome browser |
| Skipped exons in TCGA and GTEx based on Ensembl gene isoform structure. * Click on the image to open the UCSC genome browser with custom track showing this image in a new window. |
 |
Top |
Gene isoform structures and expression levels for DNAJC24 |
| Expression levels of gene isoforms across TCGA. |
 |
| Expression levels of gene isoforms across GTEx. |
 |
Top |
Exon skipping events with PSIs in TCGA for DNAJC24 |
| Information of exkip skipping event in TCGA. |
| Exon skip ID | chr | Exons involved in exon skipping | Skipped exon | ENSG | ENSTs |
| exon_skip_57559 | 11 | 31392353:31392406:31417829:31417941:31436357:31436453 | 31417829:31417941 | ENSG00000170946.10 | ENST00000525511.1 |
| exon_skip_57560 | 11 | 31392353:31392406:31429002:31429090:31429656:31429722 | 31429002:31429090 | ENSG00000170946.10 | ENST00000532385.1 |
| exon_skip_57562 | 11 | 31392353:31392406:31429656:31429877:31436357:31436453 | 31429656:31429877 | ENSG00000170946.10 | ENST00000527731.1 |
| exon_skip_57564 | 11 | 31392353:31392406:31436357:31436496:31447833:31447902 | 31436357:31436496 | ENSG00000170946.10 | ENST00000465995.1 |
| exon_skip_57569 | 11 | 31429656:31429877:31436357:31436496:31447833:31447902 | 31436357:31436496 | ENSG00000170946.10 | ENST00000527731.1 |
| exon_skip_57571 | 11 | 31436357:31436496:31443518:31443679:31447833:31447902 | 31443518:31443679 | ENSG00000170946.10 | ENST00000536040.1,ENST00000526042.1 |
| exon_skip_57574 | 11 | 31436357:31436496:31447833:31447902:31451817:31451950 | 31447833:31447902 | ENSG00000170946.10 | ENST00000465995.1 |
| exon_skip_57579 | 11 | 31447836:31447902:31451029:31451153:31451817:31451950 | 31451029:31451153 | ENSG00000170946.10 | ENST00000395949.2 |
| PSI values of skipped exons in TCGA. |
 |
Top |
Exon skipping events with PSIs in GTEx for DNAJC24 |
| Information of exkip skipping event in GTEx |
| Exon skip ID | chr | Exons involved in exon skipping | Skipped exon | ENSG | ENSTs |
| exon_skip_57556 | 11 | 31392353:31392406:31395649:31395752:31429002:31429090 | 31395649:31395752 | ENSG00000170946.10 | ENST00000526529.1 |
| exon_skip_57559 | 11 | 31392353:31392406:31417829:31417941:31436357:31436453 | 31417829:31417941 | ENSG00000170946.10 | ENST00000525511.1 |
| exon_skip_57560 | 11 | 31392353:31392406:31429002:31429090:31429656:31429722 | 31429002:31429090 | ENSG00000170946.10 | ENST00000532385.1 |
| exon_skip_57562 | 11 | 31392353:31392406:31429656:31429877:31436357:31436453 | 31429656:31429877 | ENSG00000170946.10 | ENST00000527731.1 |
| exon_skip_57564 | 11 | 31392353:31392406:31436357:31436496:31447833:31447902 | 31436357:31436496 | ENSG00000170946.10 | ENST00000465995.1 |
| exon_skip_57569 | 11 | 31429656:31429877:31436357:31436496:31447833:31447902 | 31436357:31436496 | ENSG00000170946.10 | ENST00000527731.1 |
| exon_skip_57571 | 11 | 31436357:31436496:31443518:31443679:31447833:31447902 | 31443518:31443679 | ENSG00000170946.10 | ENST00000526042.1,ENST00000536040.1 |
| exon_skip_57574 | 11 | 31436357:31436496:31447833:31447902:31451817:31451950 | 31447833:31447902 | ENSG00000170946.10 | ENST00000465995.1 |
| exon_skip_57579 | 11 | 31447836:31447902:31451029:31451153:31451817:31451950 | 31451029:31451153 | ENSG00000170946.10 | ENST00000395949.2 |
| PSI values of skipped exons in GTEx. |
 |
| * Skipped exon sequences. |
Top |
Open reading frame (ORF) annotation in the exon skipping event for DNAJC24 |
| Open reading frame (ORF) of individual exon skipping events in TCGA based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000465995 | 31436357 | 31436496 | Frame-shift |
| ENST00000465995 | 31447833 | 31447902 | In-frame |
| Open reading frame (ORF) of individual exon skipping events in GTEx based on the Ensembl gene structure combined from isoforms. |
| ENST | Start of skipped exon | End of skipped exon | ORF |
| ENST00000465995 | 31436357 | 31436496 | Frame-shift |
| ENST00000465995 | 31447833 | 31447902 | In-frame |
Top |
Infer the effects of exon skipping event on protein functional features for DNAJC24 |
| Exon skipping at the protein sequence level and followed lost functional features. * Click on the image to enlarge it in a new window. |
 |
| Loci of skipped exons in TCGA across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000465995 | 2021 | 149 | 31447833 | 31447902 | 357 | 425 | 83 | 106 |
| Loci of skipped exons in GTEx across genomic, transcript, and protein sequence levels of In-frame cases. |
| ENST | Length of mRNA | Length of AA seq. | Genomic start | Genomic end | mRNA start | mRNA end | AA start | AA end |
| ENST00000465995 | 2021 | 149 | 31447833 | 31447902 | 357 | 425 | 83 | 106 |
| Lost protein functional features of individual exon skipping events in TCGA. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| Q6P3W2 | 83 | 106 | 84 | 149 | Alternative sequence | ID=VSP_056274;Note=In isoform 2. EDDLRNVGPVDAQVYLEEMSWNEGDHSFYLSCRCGGKYSVSKDEAEEVSLISCDTCSLIIELLHYN->GS;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15489334;Dbxref=PMID:15489334 |
| Q6P3W2 | 83 | 106 | 92 | 98 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2L6L |
| Q6P3W2 | 83 | 106 | 102 | 105 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2L6L |
| Q6P3W2 | 83 | 106 | 1 | 149 | Chain | ID=PRO_0000082622;Note=DnaJ homolog subfamily C member 24 |
| Q6P3W2 | 83 | 106 | 77 | 88 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2L6L |
| Q6P3W2 | 83 | 106 | 99 | 101 | Turn | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2L6L |
| Q6P3W2 | 83 | 106 | 106 | 109 | Turn | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2L6L |
| Q6P3W2 | 83 | 106 | 93 | 148 | Zinc finger | Note=DPH-type;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00456 |
| Lost protein functional features of individual exon skipping events in GTEx. |
| UniProt acc. | Start of exon skipping (AA) | End of exon skipping (AA) | Protein feature start (AA) | Protein feature end (AA) | Category of protein feature | Description of feature |
| Q6P3W2 | 83 | 106 | 84 | 149 | Alternative sequence | ID=VSP_056274;Note=In isoform 2. EDDLRNVGPVDAQVYLEEMSWNEGDHSFYLSCRCGGKYSVSKDEAEEVSLISCDTCSLIIELLHYN->GS;Ontology_term=ECO:0000303;evidence=ECO:0000303|PubMed:15489334;Dbxref=PMID:15489334 |
| Q6P3W2 | 83 | 106 | 92 | 98 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2L6L |
| Q6P3W2 | 83 | 106 | 102 | 105 | Beta strand | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2L6L |
| Q6P3W2 | 83 | 106 | 1 | 149 | Chain | ID=PRO_0000082622;Note=DnaJ homolog subfamily C member 24 |
| Q6P3W2 | 83 | 106 | 77 | 88 | Helix | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2L6L |
| Q6P3W2 | 83 | 106 | 99 | 101 | Turn | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2L6L |
| Q6P3W2 | 83 | 106 | 106 | 109 | Turn | Ontology_term=ECO:0000244;evidence=ECO:0000244|PDB:2L6L |
| Q6P3W2 | 83 | 106 | 93 | 148 | Zinc finger | Note=DPH-type;Ontology_term=ECO:0000255;evidence=ECO:0000255|PROSITE-ProRule:PRU00456 |
Top |
SNVs in the skipped exons for DNAJC24 |
| - Lollipop plot for presenting exon skipping associated SNVs. * Click on the image to enlarge it in a new window. |
 |
| - Differential PSIs between mutated versus non-mutated samples. |
| - Non-synonymous mutations located in the skipped exons in TCGA. |
| Cancer type | Sample | ESID | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
| STAD | TCGA-BR-6452-01 | exon_skip_57569 exon_skip_57564 | 31436358 | 31436496 | 31436468 | 31436468 | Frame_Shift_Del | A | - | p.T74fs |
| ESCA | TCGA-L5-A8NT-01 | exon_skip_57569 exon_skip_57564 | 31436358 | 31436496 | 31436406 | 31436406 | Nonsense_Mutation | G | T | p.E53* |
| ESCA | TCGA-L5-A8NT-01 | exon_skip_57569 exon_skip_57564 | 31436358 | 31436496 | 31436406 | 31436406 | Nonsense_Mutation | G | T | p.E54* |
| ESCA | TCGA-L5-A8NT-01 | exon_skip_57569 exon_skip_57564 | 31436358 | 31436496 | 31436406 | 31436406 | Nonsense_Mutation | G | T | p.E54X |
| BLCA | TCGA-DK-A6AW-01 | exon_skip_57574 | 31447834 | 31447902 | 31447884 | 31447884 | Nonsense_Mutation | G | T | p.E101* |
| - Depth of coverage in the three exons composing exon skipping event |
| Depth of coverage in three exons | Mutation description |
| - Non-synonymous mutations located in the skipped exons in CCLE. |
| Sample | Skipped exon start | Skipped exon end | Mutation start | Mutation end | Mutation type | Reference seq | Mutation seq | AAchange |
| HCC1187_BREAST | 31447834 | 31447902 | 31447888 | 31447892 | Frame_Shift_Del | TGTCT | - | p.MS102fs |
| JHUEM7_ENDOMETRIUM | 31436358 | 31436496 | 31436427 | 31436427 | Missense_Mutation | G | A | p.E61K |
| DL40_HAEMATOPOIETIC_AND_LYMPHOID_TISSUE | 31436358 | 31436496 | 31436429 | 31436429 | Missense_Mutation | A | C | p.E61D |
| COGN278_AUTONOMIC_GANGLIA | 31447834 | 31447902 | 31447839 | 31447839 | Missense_Mutation | G | A | p.D86N |
| RERFLCAD1_LUNG | 31447834 | 31447902 | 31447839 | 31447839 | Missense_Mutation | G | T | p.D86Y |
Top |
Splicing Quantitative Trait Loci (sQTL) in the exon skipping event for DNAJC24 |
| sQTL information located at the skipped exons. |
| Exon skip ID | Chromosome | Three exons | Skippped exon | ENST | Cancer type | SNP id | Location | DNA change (ref/var) | P-value |
Top |
Splicing Quantitative Trait Methylation (sQTM) in the skipped exon for DNAJC24 |
Top |
Survival analysis of Splicing Quantitative Trait Methylation (sQTM) in the skipped exon for DNAJC24 |
Top |
RelatedDrugs for DNAJC24 |
| Approved drugs targeting this gene. (DrugBank Version 5.1.0 2018-04-02) |
| Gene | UniProtAcc | DrugBank ID | Drug name | Drug activity | Drug type | Drug status |
Top |
RelatedDiseases for DNAJC24 |
| Diseases associated with this gene. (DisGeNet 4.0) |
| Gene | Disease ID | Disease name | # pubmeds | Source |
Copyright 2018-Present -The University of Texas Health Science Center at Houston (UTHealth)
|